F477106

General Info

Members Datasets Scaffolds Average Seq Length
717 327 678 241

Family's Representative Sequence

Representative Sequence 3300025294|Ga0209025_1004726|Ga0209025_10047268
Length 244
Sequence MNNTPQLSVVVPVFNERDNVAPLVHEITAALRGRTDFEIVYIDDQSRDDTLQVLQALKAEVPELRVISHVKQSGQSTAVRNGVKAARGEWIATLDGDGQNDPADIPKLLEKRDATAAGEGIKLFAGWRVNRQDSGSKRWASRWANAIRSRMLRDDTPDTGCGIKLFERAAFLELPYFDHMHRYLPALMQRAGWKTVSVPVNHRPRSAGVSKYNNLNRALVGISDLRGVAWLIKRGKVTAVRELS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
8 2643221586 Lysobacter sp. Root667 Isolate Unclassified
9 2643221593 Lysobacter sp. Root690 Isolate Unclassified
10 2643221612 Lysobacter sp. Root76 Isolate Unclassified
11 2643221695 Lysobacter sp. Root494 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2818991457 Xanthomonas translucens 569 Isolate Unclassified
17 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
18 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
19 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
20 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
21 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
22 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
23 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
24 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
25 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
26 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
27 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
28 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
29 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
30 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
31 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
32 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
33 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
34 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
35 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
36 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
37 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
38 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
39 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
40 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
41 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
42 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
43 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
44 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
45 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
46 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
47 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
48 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
49 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
50 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
51 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
52 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
53 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
60 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
61 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
77 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
201 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
202 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
203 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
204 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
212 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
215 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
222 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
223 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
227 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
228 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
229 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
230 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
231 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
232 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
233 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
234 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
235 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
236 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
237 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
238 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
239 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
240 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
241 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
242 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
243 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
244 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
271 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
272 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
273 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
274 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
275 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
276 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
277 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
278 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
279 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
280 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
305 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
306 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
312 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
317 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
320 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
321 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
324 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
325 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
326 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
327 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.56
Metatranscriptomes 0
Isolates 5.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 12.69
Nodule 0
Rhizoplane 3.21
Rhizosphere 71.83
Stem 0
Stem Tuber 0
Unclassified 12.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_670719 2162886007 Bacteria 13757
2 JGI25152J39213_1000038 3300002773 Bacteria 91482
3 JGI25150J39212_1000853 3300002774 Bacteria 10154
4 JGI25151J46595_10000088 3300003187 Bacteria 124209
5 JGI25151J46595_10000150 3300003187 Bacteria 91486
6 JGI25151J46595_10017285 3300003187 Bacteria 3132
7 JGI25153J46596_10000114 3300003215 Bacteria 91486
8 JGI26145J50221_1001441 3300003371 Bacteria 1888
9 JGI26141J51220_1002698 3300003503 Bacteria 1084
10 Ga0055526_1000004 3300003771 Bacteria 355037
11 Ga0055526_1000814 3300003771 Bacteria 23259
12 Ga0055526_1026191 3300003771 Bacteria 1847
13 Ga0055537_1000242 3300003773 Bacteria 40009
14 Ga0055537_1000989 3300003773 Bacteria 12883
15 Ga0055524_1000004 3300003775 Bacteria 354710
16 Ga0055524_1021838 3300003775 Bacteria 2108
17 Ga0055524_1032910 3300003775 Bacteria 1460
18 Ga0055524_1032988 3300003775 Bacteria 1457
19 Ga0055536_1008305 3300003781 Bacteria 4485
20 Ga0055536_1009780 3300003781 Bacteria 3911
21 Ga0055536_1056115 3300003781 Bacteria 838
22 Ga0055534_1000011 3300003784 Bacteria 168909
23 Ga0055534_1000307 3300003784 Bacteria 32970
24 Ga0055528_1000015 3300003790 Bacteria 169011
25 Ga0055528_1000402 3300003790 Bacteria 35107
26 Ga0055530_10000735 3300003791 Bacteria 27312
27 Ga0055530_10001883 3300003791 Bacteria 14399
28 Ga0055530_10001945 3300003791 Bacteria 14107
29 Ga0055531_10001754 3300003794 Bacteria 15455
30 Ga0055531_10005310 3300003794 Bacteria 7562
31 Ga0055531_10010821 3300003794 Bacteria 4485
32 Ga0055531_10011663 3300003794 Bacteria 4211
33 Ga0055531_10012552 3300003794 Bacteria 3975
34 Ga0055531_10015883 3300003794 Bacteria 3285
35 Ga0055531_10024977 3300003794 Bacteria 2186
36 Ga0058692_1000081 3300003856 Bacteria 69376
37 Ga0065714_10010475 3300005288 Bacteria 5834
38 Ga0065704_10070599 3300005289 Bacteria 19419
39 Ga0065704_10073328 3300005289 Bacteria 7305
40 Ga0065715_10124790 3300005293 Bacteria 2145
41 Ga0065715_10391905 3300005293 Bacteria 889
42 Ga0070683_100471253 3300005329 Bacteria 1199
43 Ga0070670_100003557 3300005331 Bacteria 12962
44 Ga0070670_100081203 3300005331 Bacteria 2786
45 Ga0070670_100093679 3300005331 Bacteria 2583
46 Ga0070670_100194358 3300005331 Bacteria 1762
47 Ga0070666_10000953 3300005335 Bacteria 17631
48 Ga0070666_10119214 3300005335 Bacteria 1829
49 Ga0070666_10221736 3300005335 Bacteria 1334
50 Ga0070682_100077670 3300005337 Bacteria 2140
51 Ga0070660_100061822 3300005339 Bacteria 2908
52 Ga0070660_100281257 3300005339 Bacteria 1361
53 Ga0070660_100662229 3300005339 Bacteria 874
54 Ga0070661_100002100 3300005344 Bacteria 13716
55 Ga0070661_100069955 3300005344 Bacteria 2580
56 Ga0070661_100084608 3300005344 Bacteria 2343
57 Ga0070661_100230344 3300005344 Bacteria 1424
58 Ga0070661_100454405 3300005344 Bacteria 1019
59 Ga0070668_100020594 3300005347 Bacteria 4978
60 Ga0070669_100012531 3300005353 Bacteria 6014
61 Ga0070669_100201861 3300005353 Bacteria 1565
62 Ga0070675_100242239 3300005354 Bacteria 1576
63 Ga0070671_100092317 3300005355 Bacteria 2536
64 Ga0070671_100328878 3300005355 Bacteria 1303
65 Ga0070688_100179863 3300005365 Bacteria 1466
66 Ga0070659_100006373 3300005366 Bacteria 8523
67 Ga0070659_100303267 3300005366 Bacteria 1332
68 Ga0070659_100538480 3300005366 Bacteria 999
69 Ga0070667_100000093 3300005367 Bacteria 111322
70 Ga0070667_100005913 3300005367 Bacteria 10188
71 Ga0070667_100016216 3300005367 Bacteria 6165
72 Ga0070667_100175713 3300005367 Bacteria 1892
73 Ga0070667_100203449 3300005367 Bacteria 1757
74 Ga0070709_10341500 3300005434 Bacteria 1104
75 Ga0070701_10043807 3300005438 Bacteria 2291
76 Ga0070663_100000032 3300005455 Bacteria 72041
77 Ga0070663_100125237 3300005455 Bacteria 1946
78 Ga0070662_100214984 3300005457 Bacteria 1531
79 Ga0070681_10036489 3300005458 Bacteria 4936
80 Ga0068867_100010240 3300005459 Bacteria 6614
81 Ga0070679_100236893 3300005530 Bacteria 1784
82 Ga0070679_100338094 3300005530 Bacteria 1454
83 Ga0070679_100350210 3300005530 Bacteria 1425
84 Ga0070684_100088823 3300005535 Bacteria 2746
85 Ga0068853_100000578 3300005539 Bacteria 25023
86 Ga0068853_100002169 3300005539 Bacteria 14615
87 Ga0068853_100016586 3300005539 Bacteria 6065
88 Ga0068853_100062688 3300005539 Bacteria 3218
89 Ga0068853_100121937 3300005539 Bacteria 2326
90 Ga0068853_100136224 3300005539 Bacteria 2201
91 Ga0070672_100009029 3300005543 Bacteria 6853
92 Ga0070672_100038309 3300005543 Bacteria 3662
93 Ga0070686_100581910 3300005544 Bacteria 880
94 Ga0070693_100018332 3300005547 Bacteria 3654
95 Ga0070693_100042646 3300005547 Bacteria 2557
96 Ga0070665_100000053 3300005548 Bacteria 244523
97 Ga0070665_100006542 3300005548 Bacteria 11840
98 Ga0070665_100077369 3300005548 Bacteria 3333
99 Ga0070665_100363370 3300005548 Bacteria 1454
100 Ga0070665_100562364 3300005548 Bacteria 1153
101 Ga0068855_100001236 3300005563 Bacteria 31694
102 Ga0068855_100069561 3300005563 Bacteria 4096
103 Ga0068855_100118404 3300005563 Bacteria 3033
104 Ga0068855_100404007 3300005563 Bacteria 1496
105 Ga0068855_100915226 3300005563 Bacteria 926
106 Ga0070664_100370383 3300005564 Bacteria 1306
107 Ga0068857_100158515 3300005577 Bacteria 2053
108 Ga0068857_100242262 3300005577 Bacteria 1651
109 Ga0068854_100017640 3300005578 Bacteria 4779
110 Ga0068856_100019245 3300005614 Bacteria 6627
111 Ga0068856_100080678 3300005614 Bacteria 3227
112 Ga0068856_100080681 3300005614 Bacteria 3227
113 Ga0068856_100293279 3300005614 Bacteria 1643
114 Ga0068852_100000604 3300005616 Bacteria 23570
115 Ga0068852_100024631 3300005616 Bacteria 4867
116 Ga0068852_100066615 3300005616 Bacteria 3145
117 Ga0068852_100306075 3300005616 Bacteria 1540
118 Ga0068859_100000070 3300005617 Bacteria 94311
119 Ga0068859_100175296 3300005617 Bacteria 2226
120 Ga0068864_100013257 3300005618 Bacteria 6828
121 Ga0068851_10131766 3300005834 Bacteria 1353
122 Ga0068863_100003508 3300005841 Bacteria 15478
123 Ga0068863_100014341 3300005841 Bacteria 7632
124 Ga0068863_100019413 3300005841 Bacteria 6501
125 Ga0068863_100071823 3300005841 Bacteria 3274
126 Ga0068863_100611658 3300005841 Bacteria 1079
127 Ga0068863_100789514 3300005841 Bacteria 947
128 Ga0068858_100039469 3300005842 Bacteria 4378
129 Ga0068858_100100298 3300005842 Bacteria 2700
130 Ga0068858_100273067 3300005842 Bacteria 1609
131 Ga0068860_100753571 3300005843 Bacteria 985
132 Ga0068862_100000041 3300005844 Bacteria 166801
133 Ga0081455_10462099 3300005937 Bacteria 864
134 Ga0070717_10038092 3300006028 Bacteria 3907
135 Ga0075364_10001168 3300006051 Bacteria 14075
136 Ga0075364_10050400 3300006051 Bacteria 2717
137 Ga0075364_10406993 3300006051 Bacteria 928
138 Ga0097621_100027840 3300006237 Bacteria 4449
139 Ga0097621_100050252 3300006237 Bacteria 3390
140 Ga0097621_100270841 3300006237 Bacteria 1492
141 Ga0097621_100272501 3300006237 Bacteria 1487
142 Ga0068865_100008851 3300006881 Bacteria 6226
143 Ga0068865_100016541 3300006881 Bacteria 4722
144 Ga0097620_100000070 3300006931 Bacteria 94311
145 Ga0097620_100175296 3300006931 Bacteria 2226
146 Ga0105251_10000008 3300009011 Bacteria 213669
147 Ga0105251_10019337 3300009011 Bacteria 3601
148 Ga0105240_10501134 3300009093 Bacteria 1350
149 Ga0105243_10224988 3300009148 Bacteria 1661
150 Ga0105241_10013791 3300009174 Bacteria 5919
151 Ga0105241_10140953 3300009174 Bacteria 1963
152 Ga0105241_10640139 3300009174 Bacteria 965
153 Ga0105248_10000248 3300009177 Bacteria 62700
154 Ga0105248_10225916 3300009177 Bacteria 2107
155 Ga0105237_10054199 3300009545 Bacteria 4018
156 Ga0105237_10166124 3300009545 Bacteria 2206
157 Ga0105237_10233916 3300009545 Bacteria 1839
158 Ga0105238_10011499 3300009551 Bacteria 8917
159 Ga0105238_10034369 3300009551 Bacteria 5158
160 Ga0105238_10089269 3300009551 Bacteria 3069
161 Ga0105249_10000471 3300009553 Bacteria 37477
162 Ga0105249_10222541 3300009553 Bacteria 1858
163 Ga0105239_10001467 3300010375 Bacteria 31354
164 Ga0105239_10001780 3300010375 Bacteria 28338
165 Ga0105239_10007054 3300010375 Bacteria 12931
166 Ga0105239_10028873 3300010375 Bacteria 6098
167 Ga0105239_10080575 3300010375 Bacteria 3582
168 Ga0105239_10396790 3300010375 Bacteria 1561
169 Ga0105239_11210160 3300010375 Bacteria 871
170 Ga0157327_1015868 3300012512 Bacteria 789
171 Ga0157373_10026274 3300013100 Bacteria 4207
172 Ga0157370_10005233 3300013104 Bacteria 14593
173 Ga0157370_10008733 3300013104 Bacteria 10899
174 Ga0157370_10085514 3300013104 Bacteria 2963
175 Ga0157370_10151912 3300013104 Bacteria 2155
176 Ga0157370_10227362 3300013104 Bacteria 1727
177 Ga0157369_10013085 3300013105 Bacteria 9392
178 Ga0157369_10021113 3300013105 Bacteria 7279
179 Ga0157369_10087264 3300013105 Bacteria 3332
180 Ga0157374_10141397 3300013296 Bacteria 2337
181 Ga0157374_10220845 3300013296 Bacteria 1859
182 Ga0157378_10000052 3300013297 Bacteria 100769
183 Ga0157378_10065566 3300013297 Bacteria 3250
184 Ga0163162_10000061 3300013306 Bacteria 106351
185 Ga0163162_10155248 3300013306 Bacteria 2408
186 Ga0163162_10453125 3300013306 Bacteria 1415
187 Ga0163162_10612768 3300013306 Bacteria 1214
188 Ga0157372_10008531 3300013307 Bacteria 10880
189 Ga0157372_10409140 3300013307 Bacteria 1581
190 Ga0157375_10023874 3300013308 Bacteria 5649
191 Ga0157375_10125738 3300013308 Bacteria 2678
192 Ga0157375_10179802 3300013308 Bacteria 2266
193 Ga0163163_10000166 3300014325 Bacteria 69030
194 Ga0163163_10005131 3300014325 Bacteria 11290
195 Ga0163163_10008166 3300014325 Bacteria 9283
196 Ga0157380_10244117 3300014326 Bacteria 1621
197 Ga0182008_10000913 3300014497 Bacteria 20555
198 Ga0157379_10004862 3300014968 Bacteria 11538
199 Ga0157379_10154679 3300014968 Bacteria 2069
200 Ga0157376_10037455 3300014969 Bacteria 3938
201 Ga0157376_10181048 3300014969 Bacteria 1926
202 Ga0182006_1014002 3300015261 Bacteria 3463
203 Ga0182006_1035742 3300015261 Bacteria 1978
204 Ga0182006_1107513 3300015261 Bacteria 982
205 Ga0183360_10004 3300015689 Bacteria 289992
206 Ga0163161_10001958 3300017792 Bacteria 14979
207 Ga0163161_10035692 3300017792 Bacteria 3559
208 Ga0213876_10255700 3300021384 Bacteria 931
209 Ga0207425_1000029 3300025245 Bacteria 268521
210 Ga0209129_1000073 3300025258 Bacteria 207709
211 Ga0209565_1000002 3300025263 Bacteria 1423083
212 Ga0209565_1000113 3300025263 Bacteria 116343
213 Ga0209673_1000002 3300025273 Bacteria 1423083
214 Ga0209673_1000369 3300025273 Bacteria 81061
215 Ga0209673_1023345 3300025273 Bacteria 2109
216 Ga0209130_1030023 3300025284 Bacteria 1127
217 Ga0209130_1039891 3300025284 Bacteria 912
218 Ga0209675_1000002 3300025291 Bacteria 1423083
219 Ga0209675_1000007 3300025291 Bacteria 683430
220 Ga0209675_1022095 3300025291 Bacteria 1679
221 Ga0209676_1000018 3300025292 Bacteria 631385
222 Ga0209676_1001361 3300025292 Bacteria 24039
223 Ga0209676_1001572 3300025292 Bacteria 20396
224 Ga0209676_1007516 3300025292 Bacteria 5088
225 Ga0209676_1009869 3300025292 Bacteria 4055
226 Ga0209676_1051041 3300025292 Bacteria 1087
227 Ga0209025_1000076 3300025294 Bacteria 273934
228 Ga0209025_1000134 3300025294 Bacteria 194505
229 Ga0209025_1001794 3300025294 Bacteria 25490
230 Ga0209025_1004726 3300025294 Bacteria 11609
231 Ga0209564_1000004 3300025295 Bacteria 1424639
232 Ga0209564_1000333 3300025295 Bacteria 91663
233 Ga0209564_1020240 3300025295 Bacteria 2446
234 Ga0209758_1000112 3300025297 Bacteria 207640
235 Ga0209050_1000396 3300025298 Bacteria 81559
236 Ga0209050_1001391 3300025298 Bacteria 26316
237 Ga0209050_1001430 3300025298 Bacteria 25721
238 Ga0209050_1038936 3300025298 Bacteria 1347
239 Ga0209050_1046199 3300025298 Bacteria 1146
240 Ga0209256_1000004 3300025299 Bacteria 1424643
241 Ga0209256_1002151 3300025299 Bacteria 17009
242 Ga0209256_1002538 3300025299 Bacteria 14618
243 Ga0209256_1005969 3300025299 Bacteria 6695
244 Ga0209256_1006907 3300025299 Bacteria 5810
245 Ga0209256_1009592 3300025299 Bacteria 4213
246 Ga0209051_1000449 3300025303 Bacteria 54625
247 Ga0209051_1032865 3300025303 Bacteria 1972
248 Ga0209257_1000035 3300025304 Bacteria 631463
249 Ga0209257_1000078 3300025304 Bacteria 317483
250 Ga0209257_1000150 3300025304 Bacteria 191487
251 Ga0209257_1000861 3300025304 Bacteria 43224
252 Ga0209257_1001769 3300025304 Bacteria 23916
253 Ga0209257_1002921 3300025304 Bacteria 15747
254 Ga0209257_1004367 3300025304 Bacteria 11008
255 Ga0209257_1006408 3300025304 Bacteria 7597
256 Ga0209257_1008020 3300025304 Bacteria 6160
257 Ga0207656_10137475 3300025321 Bacteria 1149
258 Ga0207713_1000170 3300025735 Bacteria 94864
259 Ga0207713_1070744 3300025735 Bacteria 1289
260 Ga0207692_10172743 3300025898 Bacteria 1253
261 Ga0207680_10000676 3300025903 Bacteria 16108
262 Ga0207680_10054437 3300025903 Bacteria 2407
263 Ga0207680_10146267 3300025903 Bacteria 1571
264 Ga0207647_10001196 3300025904 Bacteria 19992
265 Ga0207647_10165850 3300025904 Bacteria 1287
266 Ga0207645_10090284 3300025907 Bacteria 1970
267 Ga0207643_10218073 3300025908 Bacteria 1167
268 Ga0207705_10276548 3300025909 Bacteria 1285
269 Ga0207654_10001933 3300025911 Bacteria 10735
270 Ga0207654_10011118 3300025911 Bacteria 4581
271 Ga0207654_10082581 3300025911 Bacteria 1938
272 Ga0207707_10081643 3300025912 Bacteria 2822
273 Ga0207695_10000271 3300025913 Bacteria 129900
274 Ga0207671_10008442 3300025914 Bacteria 8735
275 Ga0207671_10018141 3300025914 Bacteria 5407
276 Ga0207671_10133090 3300025914 Bacteria 1910
277 Ga0207671_10138065 3300025914 Bacteria 1876
278 Ga0207693_10389321 3300025915 Bacteria 1090
279 Ga0207660_10430079 3300025917 Bacteria 1066
280 Ga0207657_10013571 3300025919 Bacteria 7992
281 Ga0207657_10150759 3300025919 Bacteria 1894
282 Ga0207657_10182101 3300025919 Bacteria 1698
283 Ga0207649_10006390 3300025920 Bacteria 6402
284 Ga0207649_10042889 3300025920 Bacteria 2762
285 Ga0207681_10065182 3300025923 Bacteria 2517
286 Ga0207681_10480473 3300025923 Bacteria 1015
287 Ga0207694_10252016 3300025924 Bacteria 1445
288 Ga0207650_10000609 3300025925 Bacteria 28609
289 Ga0207650_10015567 3300025925 Bacteria 5298
290 Ga0207650_10104689 3300025925 Bacteria 2183
291 Ga0207650_10180102 3300025925 Bacteria 1684
292 Ga0207659_10164930 3300025926 Bacteria 1743
293 Ga0207644_10025895 3300025931 Bacteria 4036
294 Ga0207644_10181693 3300025931 Bacteria 1649
295 Ga0207644_10269409 3300025931 Bacteria 1364
296 Ga0207690_10115038 3300025932 Bacteria 1943
297 Ga0207706_10029354 3300025933 Bacteria 4909
298 Ga0207706_10609788 3300025933 Bacteria 937
299 Ga0207686_10551529 3300025934 Bacteria 901
300 Ga0207709_10004956 3300025935 Bacteria 7620
301 Ga0207670_10265562 3300025936 Bacteria 1332
302 Ga0207669_10325524 3300025937 Bacteria 1178
303 Ga0207704_10032344 3300025938 Bacteria 2959
304 Ga0207704_10059125 3300025938 Bacteria 2364
305 Ga0207691_10012595 3300025940 Bacteria 8107
306 Ga0207691_10019964 3300025940 Bacteria 6339
307 Ga0207711_10002210 3300025941 Bacteria 17471
308 Ga0207689_10043389 3300025942 Bacteria 3718
309 Ga0207689_10197427 3300025942 Bacteria 1661
310 Ga0207661_10084178 3300025944 Bacteria 2633
311 Ga0207667_10006642 3300025949 Bacteria 13979
312 Ga0207667_10009259 3300025949 Bacteria 11628
313 Ga0207667_10061270 3300025949 Bacteria 3936
314 Ga0207667_10272394 3300025949 Bacteria 1730
315 Ga0207667_10759167 3300025949 Bacteria 969
316 Ga0207667_11008976 3300025949 Bacteria 819
317 Ga0207651_10151481 3300025960 Bacteria 1806
318 Ga0207712_10000056 3300025961 Bacteria 143677
319 Ga0207712_10243910 3300025961 Bacteria 1449
320 Ga0207668_10135154 3300025972 Bacteria 1888
321 Ga0207668_10222264 3300025972 Bacteria 1517
322 Ga0207640_10017451 3300025981 Bacteria 4200
323 Ga0207640_10508797 3300025981 Bacteria 1004
324 Ga0207658_10000020 3300025986 Bacteria 202984
325 Ga0207658_10003800 3300025986 Bacteria 10633
326 Ga0207658_10049334 3300025986 Bacteria 3093
327 Ga0207658_10322030 3300025986 Bacteria 1338
328 Ga0207658_10679911 3300025986 Bacteria 929
329 Ga0207703_10322997 3300026035 Bacteria 1414
330 Ga0207703_10521670 3300026035 Bacteria 1117
331 Ga0207639_10001658 3300026041 Bacteria 15005
332 Ga0207639_10002592 3300026041 Bacteria 12131
333 Ga0207639_10004818 3300026041 Bacteria 9101
334 Ga0207639_10005192 3300026041 Bacteria 8786
335 Ga0207639_10010298 3300026041 Bacteria 6471
336 Ga0207639_10011899 3300026041 Bacteria 6053
337 Ga0207639_10057786 3300026041 Bacteria 2981
338 Ga0207639_10099933 3300026041 Bacteria 2342
339 Ga0207678_10000010 3300026067 Bacteria 149258
340 Ga0207702_10002211 3300026078 Bacteria 18639
341 Ga0207702_10006391 3300026078 Bacteria 10169
342 Ga0207641_10006298 3300026088 Bacteria 10033
343 Ga0207641_10018733 3300026088 Bacteria 5676
344 Ga0207641_10023027 3300026088 Bacteria 5131
345 Ga0207648_10002984 3300026089 Bacteria 17884
346 Ga0207676_10032827 3300026095 Bacteria 3916
347 Ga0207676_10556158 3300026095 Bacteria 1097
348 Ga0207674_10072246 3300026116 Bacteria 3466
349 Ga0207674_10231187 3300026116 Bacteria 1797
350 Ga0207675_100627883 3300026118 Bacteria 1079
351 Ga0207698_10043287 3300026142 Bacteria 3372
352 Ga0207698_10158227 3300026142 Bacteria 1977
353 Ga0207698_10169888 3300026142 Bacteria 1918
354 Ga0207698_10332243 3300026142 Bacteria 1428
355 Ga0207698_10441865 3300026142 Bacteria 1253
356 Ga0207698_10614220 3300026142 Bacteria 1073
357 Ga0209371_1000235 3300027312 Bacteria 69492
358 Ga0209967_1012379 3300027364 Bacteria 1205
359 Ga0209984_1001378 3300027424 Bacteria 2631
360 Ga0210000_1011804 3300027462 Bacteria 1296
361 Ga0209999_1004979 3300027543 Bacteria 2392
362 Ga0209982_1002346 3300027552 Bacteria 2661
363 Ga0209983_1000709 3300027665 Bacteria 7199
364 Ga0209971_1001818 3300027682 Bacteria 5224
365 Ga0209974_10005300 3300027876 Bacteria 4546
366 Ga0268266_10000001 3300028379 Bacteria 4040580
367 Ga0268266_10024141 3300028379 Bacteria 5173
368 Ga0268266_10096108 3300028379 Bacteria 2603
369 Ga0268266_10248270 3300028379 Bacteria 1645
370 Ga0268266_10278713 3300028379 Bacteria 1554
371 Ga0268266_10437231 3300028379 Bacteria 1242
372 Ga0268266_10459412 3300028379 Bacteria 1211
373 Ga0268265_10000137 3300028380 Bacteria 93389
374 Ga0268264_10060987 3300028381 Bacteria 3162
375 Ga0268264_10371381 3300028381 Bacteria 1367
376 Ga0268256_1000196 3300030500 Bacteria 69428
377 Ga0314311_1005669 3300030733 Bacteria 2954
378 Ga0314311_1183412 3300030733 Bacteria 3758
379 Ga0316180_1048768 3300030736 Bacteria 1100
380 Ga0316183_1047328 3300030742 Bacteria 4007
381 Ga0316182_1226196 3300030745 Bacteria 2334
382 Ga0307513_10018587 3300031456 Bacteria 8299
383 Ga0307408_100056242 3300031548 Bacteria 2852
384 Ga0307408_100757408 3300031548 Bacteria 878
385 Ga0307516_10025758 3300031730 Bacteria 5984
386 Ga0307516_10159177 3300031730 Bacteria 2010
387 Ga0307516_10169553 3300031730 Bacteria 1924
388 Ga0307405_10128201 3300031731 Bacteria 1748
389 Ga0307413_10087760 3300031824 Bacteria 2016
390 Ga0307406_10014708 3300031901 Bacteria 4507
391 Ga0307406_10357102 3300031901 Bacteria 1144
392 Ga0307407_10040952 3300031903 Bacteria 2587
393 Ga0307412_10037333 3300031911 Bacteria 3121
394 Ga0307412_10070648 3300031911 Bacteria 2381
395 Ga0307416_100004229 3300032002 Bacteria 8619
396 Ga0307416_100206007 3300032002 Bacteria 1871
397 Ga0307416_100250679 3300032002 Bacteria 1723
398 Ga0307414_10000159 3300032004 Bacteria 45131
399 Ga0307414_10000490 3300032004 Bacteria 20605
400 Ga0307414_10016037 3300032004 Bacteria 4542
401 Ga0307414_10059038 3300032004 Bacteria 2706
402 Ga0307414_10119791 3300032004 Bacteria 2021
403 Ga0307414_10226360 3300032004 Bacteria 1539
404 Ga0307414_10258799 3300032004 Bacteria 1451
405 Ga0307414_10505221 3300032004 Bacteria 1070
406 Ga0307414_10599618 3300032004 Bacteria 987
407 Ga0307411_10041362 3300032005 Bacteria 2932
408 Ga0307411_10063599 3300032005 Bacteria 2466
409 Ga0307411_10204749 3300032005 Bacteria 1518
410 Ga0307411_10242391 3300032005 Bacteria 1412
411 Ga0307411_10257994 3300032005 Bacteria 1375
412 Ga0307415_100340659 3300032126 Bacteria 1258
413 Ga0307507_10077351 3300033179 Bacteria 2960
414 Ga0395899_0153258 3300037312 Bacteria 1632
415 Ga0395899_0234970 3300037312 Bacteria 1264
416 Ga0395900_0051479 3300037418 Bacteria 4242
417 Ga0395900_0156442 3300037418 Bacteria 2328
418 Ga0395905_0001151 3300037471 Bacteria 33114
419 Ga0395905_0092352 3300037471 Bacteria 2838
420 Ga0395905_0158891 3300037471 Bacteria 2125
421 Ga0395905_0667218 3300037471 Bacteria 942
422 Ga0237819_00408 3300038705 Bacteria 14905
423 Ga0237816_02319 3300039145 Bacteria 1467
424 Ga0439436_0001101 3300041404 Bacteria 7628
425 Ga0439436_0038342 3300041404 Bacteria 1378
426 Ga0439436_0086789 3300041404 Bacteria 871
427 Ga0439439_0007220 3300041406 Bacteria 2593
428 Ga0439439_0060223 3300041406 Bacteria 1007
429 Ga0439465_0038820 3300041413 Bacteria 1535
430 Ga0451791_0128905 3300041451 Bacteria 2050
431 Ga0451791_0620911 3300041451 Bacteria 1176
432 Ga0451791_0870286 3300041451 Bacteria 1567
433 Ga0451791_1795432 3300041451 Bacteria 5383
434 Ga0451793_0075781 3300041452 Bacteria 2398
435 Ga0451793_1030055 3300041452 Bacteria 2337
436 Ga0451793_1174458 3300041452 Bacteria 4482
437 Ga0451793_1737054 3300041452 Bacteria 1499
438 Ga0451797_0255695 3300041453 Bacteria 1010
439 Ga0451797_0356747 3300041453 Bacteria 1207
440 Ga0451795_1325393 3300041456 Bacteria 965
441 Ga0451800_0052513 3300041459 Bacteria 828
442 Ga0451800_0176271 3300041459 Bacteria 6708
443 Ga0451802_1780811 3300041460 Bacteria 3457
444 Ga0451806_243563 3300041462 Bacteria 6519
445 Ga0451804_0548075 3300041463 Bacteria 3037
446 Ga0451807_0148046 3300041486 Bacteria 1197
447 Ga0451807_1481108 3300041486 Bacteria 4891
448 Ga0451833_1391529 3300041491 Bacteria 1332
449 Ga0451837_0148912 3300041494 Bacteria 2380
450 Ga0451837_1187473 3300041494 Bacteria 2013
451 Ga0451839_0733957 3300041496 Bacteria 1220
452 Ga0451843_1336202 3300041509 Bacteria 1298
453 Ga0451843_1341863 3300041509 Bacteria 1050
454 Ga0451853_3320709 3300041512 Bacteria 1143
455 Ga0439445_0001895 3300042004 Bacteria 4612
456 Ga0439432_002495 3300042006 Bacteria 6931
457 Ga0439432_012529 3300042006 Bacteria 2899
458 Ga0439449_0000005 3300042007 Bacteria 81904
459 Ga0439449_0003367 3300042007 Bacteria 6228
460 Ga0439449_0013350 3300042007 Bacteria 3090
461 Ga0439449_0018213 3300042007 Bacteria 2635
462 Ga0439449_0035650 3300042007 Bacteria 1851
463 Ga0439449_0054170 3300042007 Bacteria 1482
464 Ga0439452_054468 3300042010 Bacteria 908
465 Ga0439457_026647 3300042014 Bacteria 1280
466 Ga0466972_0000334 3300044658 Bacteria 26111
467 Ga0466970_0007051 3300044765 Bacteria 5621
468 Ga0495592_0314056 3300046454 Bacteria 1015
469 Ga0495629_0176417 3300046459 Bacteria 1482
470 Ga0495638_0002595 3300046460 Bacteria 14586
471 Ga0495638_0073120 3300046460 Bacteria 2093
472 Ga0495605_0072431 3300046474 Bacteria 1625
473 Ga0495607_0046027 3300046501 Bacteria 2564
474 Ga0495606_0054020 3300046507 Bacteria 2603
475 Ga0495610_0003711 3300046512 Bacteria 11700
476 Ga0495610_0061976 3300046512 Bacteria 1775
477 Ga0495631_0008855 3300046518 Bacteria 5052
478 Ga0495643_0001375 3300046522 Bacteria 22762
479 Ga0495663_0029743 3300046525 Bacteria 1614
480 Ga0495663_0089770 3300046525 Bacteria 1000
481 Ga0495598_0015241 3300046537 Bacteria 1937
482 Ga0495621_0000496 3300046539 Bacteria 9722
483 Ga0495621_0061477 3300046539 Bacteria 1364
484 Ga0495633_0012995 3300046558 Bacteria 4405
485 Ga0495633_0028608 3300046558 Bacteria 2714
486 Ga0495625_0079320 3300046660 Bacteria 2289
487 Ga0495659_0051771 3300046664 Bacteria 1496
488 Ga0495671_0010287 3300046692 Bacteria 5194
489 Ga0495636_0000147 3300047318 Bacteria 28119
490 Ga0495636_0016257 3300047318 Bacteria 2971
491 Ga0495672_0001550 3300047320 Bacteria 22485
492 Ga0495680_0214891 3300047322 Bacteria 1375
493 Ga0495686_0020416 3300047472 Bacteria 4417
494 Ga0495686_0039504 3300047472 Bacteria 3013
495 Ga0496101_0233150 3300048904 Bacteria 1431
496 Ga0496102_0293251 3300048905 Bacteria 1533
497 Ga0496108_0217980 3300048911 Bacteria 1658
498 Ga0496108_0446075 3300048911 Bacteria 1130
499 Ga0496115_0000002 3300048918 Bacteria 365286
500 Ga0496116_0039520 3300048919 Bacteria 3261
501 Ga0496116_0153685 3300048919 Bacteria 1274
502 Ga0496117_0002512 3300048920 Bacteria 22989
503 Ga0496117_0002847 3300048920 Bacteria 21034
504 Ga0496117_0003923 3300048920 Bacteria 16846
505 Ga0496117_0033222 3300048920 Bacteria 3904
506 Ga0496117_0085654 3300048920 Bacteria 2050
507 Ga0496118_0000065 3300048921 Bacteria 211750
508 Ga0496118_0000183 3300048921 Bacteria 110206
509 Ga0496118_0003155 3300048921 Bacteria 21078
510 Ga0496118_0004179 3300048921 Bacteria 17387
511 Ga0496118_0027139 3300048921 Bacteria 4854
512 Ga0496118_0111948 3300048921 Bacteria 1808
513 Ga0496118_0181823 3300048921 Bacteria 1269
514 Ga0496119_0000787 3300048922 Bacteria 42365
515 Ga0496119_0005545 3300048922 Bacteria 12020
516 Ga0496120_0000776 3300048923 Bacteria 46146
517 Ga0496120_0001660 3300048923 Bacteria 25701
518 Ga0496121_0009225 3300048924 Bacteria 11395
519 Ga0496121_0042488 3300048924 Bacteria 3953
520 Ga0496121_0095925 3300048924 Bacteria 2303
521 Ga0496122_0000037 3300048925 Bacteria 304495
522 Ga0496122_0000355 3300048925 Bacteria 98786
523 Ga0496122_0000361 3300048925 Bacteria 97861
524 Ga0496122_0036940 3300048925 Bacteria 3941
525 Ga0496122_0080025 3300048925 Bacteria 2280
526 Ga0496122_0143733 3300048925 Bacteria 1487
527 Ga0496123_0000167 3300048926 Bacteria 131151
528 Ga0496123_0001332 3300048926 Bacteria 34880
529 Ga0496123_0002053 3300048926 Bacteria 25986
530 Ga0496123_0006515 3300048926 Bacteria 11286
531 Ga0496123_0051202 3300048926 Bacteria 2751
532 Ga0496123_0128526 3300048926 Bacteria 1409
533 Ga0496123_0200952 3300048926 Bacteria 1021
534 Ga0496124_0000018 3300048927 Bacteria 442940
535 Ga0496124_0002453 3300048927 Bacteria 24263
536 Ga0496124_0003077 3300048927 Bacteria 20780
537 Ga0496124_0031164 3300048927 Bacteria 4723
538 Ga0496124_0057662 3300048927 Bacteria 3271
539 Ga0496124_0064200 3300048927 Bacteria 3066
540 Ga0496124_0118670 3300048927 Bacteria 2117
541 Ga0496125_0000486 3300048928 Bacteria 69727
542 Ga0496125_0028711 3300048928 Bacteria 5016
543 Ga0496125_0030723 3300048928 Bacteria 4799
544 Ga0496125_0047889 3300048928 Bacteria 3569
545 Ga0496125_0049149 3300048928 Bacteria 3508
546 Ga0496125_0356871 3300048928 Bacteria 871
547 Ga0496126_0000052 3300048929 Bacteria 312383
548 Ga0496126_0002494 3300048929 Bacteria 24732
549 Ga0496126_0119312 3300048929 Bacteria 2289
550 Ga0501031_0005216 3300049568 Bacteria 8469
551 Ga0501031_0019030 3300049568 Bacteria 4471
552 Ga0501031_0037656 3300049568 Bacteria 3157
553 Ga0501032_0000210 3300049569 Bacteria 48794
554 Ga0501032_0017490 3300049569 Bacteria 5034
555 Ga0501032_0041805 3300049569 Bacteria 3111
556 Ga0501032_0124583 3300049569 Bacteria 1702
557 Ga0501032_0270441 3300049569 Bacteria 1101
558 Ga0501033_0000847 3300049570 Bacteria 27913
559 Ga0501033_0002201 3300049570 Bacteria 16827
560 Ga0501033_0002803 3300049570 Bacteria 14585
561 Ga0501034_0000980 3300049571 Bacteria 41015
562 Ga0501034_0002412 3300049571 Bacteria 22627
563 Ga0501034_0006726 3300049571 Bacteria 12316
564 Ga0501034_0020750 3300049571 Bacteria 6705
565 Ga0501034_0028818 3300049571 Bacteria 5648
566 Ga0501034_0031232 3300049571 Bacteria 5411
567 Ga0501034_0038655 3300049571 Bacteria 4832
568 Ga0501034_0131898 3300049571 Bacteria 2481
569 Ga0501034_0285713 3300049571 Bacteria 1589
570 Ga0501034_0382400 3300049571 Bacteria 1332
571 Ga0501036_0002348 3300049572 Bacteria 14795
572 Ga0501036_0004079 3300049572 Bacteria 11751
573 Ga0501036_0004973 3300049572 Bacteria 10748
574 Ga0501036_0008356 3300049572 Bacteria 8483
575 Ga0501036_0164595 3300049572 Bacteria 1869
576 Ga0501037_0006826 3300049573 Bacteria 8341
577 Ga0501037_0015960 3300049573 Bacteria 5528
578 Ga0501037_0024190 3300049573 Bacteria 4491
579 Ga0501038_0002683 3300049574 Bacteria 16602
580 Ga0501038_0003333 3300049574 Bacteria 14977
581 Ga0501038_0017012 3300049574 Bacteria 6578
582 Ga0501038_0034942 3300049574 Bacteria 4417
583 Ga0501038_0080555 3300049574 Bacteria 2745
584 Ga0501038_0095997 3300049574 Bacteria 2475
585 Ga0501039_0051215 3300049575 Bacteria 3195
586 Ga0501040_0015264 3300049576 Bacteria 5077
587 Ga0501042_0021090 3300049578 Bacteria 4537
588 Ga0501042_0168165 3300049578 Bacteria 1582
589 Ga0501043_0001996 3300049579 Bacteria 17412
590 Ga0501043_0002614 3300049579 Bacteria 15190
591 Ga0501043_0061548 3300049579 Bacteria 2948
592 Ga0501043_0070939 3300049579 Bacteria 2736
593 Ga0501043_0088867 3300049579 Bacteria 2428
594 Ga0501043_0106581 3300049579 Bacteria 2201
595 Ga0501043_0463120 3300049579 Bacteria 951
596 Ga0501046_0000871 3300049580 Bacteria 29395
597 Ga0501046_0009063 3300049580 Bacteria 8627
598 Ga0501046_0121760 3300049580 Bacteria 1984
599 Ga0501046_0194316 3300049580 Bacteria 1512
600 Ga0501046_0314740 3300049580 Bacteria 1141
601 Ga0501046_0413873 3300049580 Bacteria 972
602 Ga0501047_0005436 3300049581 Bacteria 11984
603 Ga0501047_0007253 3300049581 Bacteria 10421
604 Ga0501047_0030303 3300049581 Bacteria 5216
605 Ga0501047_0039255 3300049581 Bacteria 4580
606 Ga0501047_0054618 3300049581 Bacteria 3863
607 Ga0501047_0426413 3300049581 Bacteria 1157
608 Ga0501048_0003611 3300049582 Bacteria 11784
609 Ga0501048_0309593 3300049582 Bacteria 1124
610 Ga0501067_0000786 3300049583 Bacteria 17094
611 Ga0501067_0009081 3300049583 Bacteria 5505
612 Ga0501068_0079848 3300049584 Bacteria 2006
613 Ga0501069_0002420 3300049585 Bacteria 9490
614 Ga0501069_0003626 3300049585 Bacteria 7948
615 Ga0501069_0266661 3300049585 Bacteria 1000
616 Ga0501070_0007151 3300049586 Bacteria 9485
617 Ga0501070_0039775 3300049586 Bacteria 3921
618 Ga0501070_0040947 3300049586 Bacteria 3860
619 Ga0501070_0060336 3300049586 Bacteria 3143
620 Ga0501070_0092389 3300049586 Bacteria 2504
621 Ga0501070_0100374 3300049586 Bacteria 2394
622 Ga0501070_0301078 3300049586 Bacteria 1306
623 Ga0501071_0018515 3300049587 Bacteria 4823
624 Ga0501072_0001140 3300049588 Bacteria 19734
625 Ga0501072_0346866 3300049588 Bacteria 1179
626 Ga0501073_0002336 3300049589 Bacteria 14198
627 Ga0501073_0007516 3300049589 Bacteria 8095
628 Ga0501073_0008635 3300049589 Bacteria 7547
629 Ga0501073_0041334 3300049589 Bacteria 3257
630 Ga0501073_0382545 3300049589 Bacteria 972
631 Ga0501074_0002549 3300049590 Bacteria 12713
632 Ga0501074_0011395 3300049590 Bacteria 6464
633 Ga0501074_0075819 3300049590 Bacteria 2414
634 Ga0501074_0076261 3300049590 Bacteria 2406
635 Ga0501074_0231646 3300049590 Bacteria 1315
636 Ga0501074_0266826 3300049590 Bacteria 1217
637 Ga0501076_0074408 3300049592 Bacteria 2721
638 Ga0501076_0694092 3300049592 Bacteria 840
639 Ga0501202_008710 3300049652 Bacteria 1854
640 Ga0501202_053011 3300049652 Bacteria 902
641 Ga0501225_0002360 3300049705 Bacteria 5817
642 Ga0501079_0054572 3300049741 Bacteria 3082
643 Ga0501080_0001127 3300049742 Bacteria 21983
644 Ga0501080_0022902 3300049742 Bacteria 5790
645 Ga0501080_0052468 3300049742 Bacteria 3795
646 Ga0501080_0192926 3300049742 Bacteria 1872
647 Ga0501080_0338260 3300049742 Bacteria 1360
648 Ga0501081_0017691 3300049743 Bacteria 4723
649 Ga0501083_0009033 3300049744 Bacteria 7035
650 Ga0501083_0056170 3300049744 Bacteria 2638
651 Ga0501083_0144523 3300049744 Bacteria 1557
652 Ga0501265_001084 3300049762 Bacteria 3064
653 Ga0501275_000135 3300049772 Bacteria 8249
654 Ga0501035_0001149 3300049822 Bacteria 27646
655 Ga0501035_0010515 3300049822 Bacteria 8575
656 Ga0501035_0149214 3300049822 Bacteria 2029
657 Ga0501044_0003431 3300049823 Bacteria 17868
658 Ga0501044_0034792 3300049823 Bacteria 5280
659 Ga0501044_0228605 3300049823 Bacteria 1808
660 Ga0501044_0269086 3300049823 Bacteria 1640
661 Ga0501044_0367971 3300049823 Bacteria 1354
662 Ga0501044_0371265 3300049823 Bacteria 1347
663 Ga0501045_0009388 3300049824 Bacteria 6840
664 Ga0501045_0245086 3300049824 Bacteria 1334
665 nmdc:mga00v17_108907_c1 3300050491 Bacteria 1756
666 nmdc:mga00v17_200_c1 3300050491 Bacteria 36047
667 Ga0500643_003586 3300053087 Bacteria 7386
668 Ga0500651_0000297 3300053093 Bacteria 28799
669 Ga0500651_0004553 3300053093 Bacteria 7782
670 Ga0500597_000205 3300053120 Bacteria 12176
671 Ga0500568_0003667 3300053139 Bacteria 8441
672 Ga0500634_0000582 3300053161 Bacteria 12119
673 Ga0501084_0028932 3300054114 Bacteria 4632
674 Ga0501084_0036845 3300054114 Bacteria 4087
675 Ga0501082_0000728 3300060353 Bacteria 28982
676 Ga0501082_0043533 3300060353 Bacteria 3871
677 Ga0501082_0114854 3300060353 Bacteria 2331
678 Ga0501082_0129723 3300060353 Bacteria 2187

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042010 Ga0439452_054468 Ga0439452_054468_220_891 219
2 3300041406 Ga0439439_0007220 Ga0439439_0007220_199_900 223
3 3300042014 Ga0439457_026647 Ga0439457_026647_92_793 223
4 3300042007 Ga0439449_0013350 Ga0439449_0013350_1190_1891 231
5 3300031824 Ga0307413_10087760 Ga0307413_100877601 232
6 3300032004 Ga0307414_10000159 Ga0307414_1000015918 235
7 3300041452 Ga0451793_1030055 Ga0451793_1030055_736_1452 235
8 3300041453 Ga0451797_0255695 Ga0451797_0255695_119_835 235
9 3300003794 Ga0055531_10001754 Ga0055531_100017545 236
10 3300021384 Ga0213876_10255700 Ga0213876_102557002 236
11 3300025304 Ga0209257_1000078 Ga0209257_100007845 236
12 3300028379 Ga0268266_10096108 Ga0268266_100961083 236
13 3300037471 Ga0395905_0667218 Ga0395905_0667218_13_738 236
14 3300041451 Ga0451791_0870286 Ga0451791_0870286_494_1288 236
15 3300041451 Ga0451791_1795432 Ga0451791_1795432_3308_4105 236
16 3300041452 Ga0451793_1737054 Ga0451793_1737054_355_1149 236
17 3300041460 Ga0451802_1780811 Ga0451802_1780811_461_1255 236
18 3300041512 Ga0451853_3320709 Ga0451853_3320709_264_1058 236
19 3300047318 Ga0495636_0016257 Ga0495636_0016257_356_1078 236
20 iso_pu_bacteria 2576861471 2578456407 236
21 iso_pu_bacteria 2747842501 2748019912 236
22 iso_pu_bacteria 2818991457 2819661826 236
23 iso_pu_bacteria 2842757796 2842761238 236
24 iso_pu_bacteria 2842780639 2842781495 236
25 iso_pu_bacteria 2852649853 2852651655 236
26 iso_pu_bacteria 2852684882 2852688490 236
27 iso_pu_bacteria 2919130084 2919133873 236
28 iso_pu_bacteria 2929195423 2929199837 236
29 iso_pu_bacteria 2939589442 2939590351 236
30 iso_pu_bacteria 2939622612 2939626563 236
31 iso_pu_bacteria 2974307012 2974307069 236
32 iso_pu_bacteria 2977247770 2977247813 236
33 iso_pu_bacteria 2984514374 2984517730 236
34 iso_pu_bacteria 2987605356 2987606912 236
35 iso_pu_bacteria 8021622325 8021622975 236
36 iso_pu_bacteria 8021626552 8021629091 236
37 iso_pu_bacteria 8021648035 8021651201 236
38 3300002773 JGI25152J39213_1000038 JGI25152J39213_100003813 237
39 3300002774 JGI25150J39212_1000853 JGI25150J39212_10008532 237
40 3300003187 JGI25151J46595_10000088 JGI25151J46595_1000008836 237
41 3300003187 JGI25151J46595_10000150 JGI25151J46595_1000015063 237
42 3300003187 JGI25151J46595_10017285 JGI25151J46595_100172852 237
43 3300003215 JGI25153J46596_10000114 JGI25153J46596_1000011413 237
44 3300003771 Ga0055526_1000004 Ga0055526_1000004259 237
45 3300003771 Ga0055526_1000814 Ga0055526_10008148 237
46 3300003771 Ga0055526_1026191 Ga0055526_10261912 237
47 3300003773 Ga0055537_1000242 Ga0055537_10002424 237
48 3300003773 Ga0055537_1000989 Ga0055537_10009897 237
49 3300003775 Ga0055524_1000004 Ga0055524_1000004259 237
50 3300003775 Ga0055524_1021838 Ga0055524_10218382 237
51 3300003775 Ga0055524_1032910 Ga0055524_10329102 237
52 3300003775 Ga0055524_1032988 Ga0055524_10329882 237
53 3300003781 Ga0055536_1008305 Ga0055536_10083053 237
54 3300003781 Ga0055536_1009780 Ga0055536_10097803 237
55 3300003781 Ga0055536_1056115 Ga0055536_10561151 237
56 3300003784 Ga0055534_1000011 Ga0055534_100001149 237
57 3300003784 Ga0055534_1000307 Ga0055534_100030718 237
58 3300003790 Ga0055528_1000015 Ga0055528_100001549 237
59 3300003790 Ga0055528_1000402 Ga0055528_100040219 237
60 3300003791 Ga0055530_10000735 Ga0055530_1000073526 237
61 3300003791 Ga0055530_10001883 Ga0055530_100018833 237
62 3300003791 Ga0055530_10001945 Ga0055530_100019459 237
63 3300003794 Ga0055531_10005310 Ga0055531_100053105 237
64 3300003794 Ga0055531_10010821 Ga0055531_100108213 237
65 3300003794 Ga0055531_10011663 Ga0055531_100116633 237
66 3300003794 Ga0055531_10012552 Ga0055531_100125521 237
67 3300003794 Ga0055531_10015883 Ga0055531_100158833 237
68 3300003794 Ga0055531_10024977 Ga0055531_100249773 237
69 3300003856 Ga0058692_1000081 Ga0058692_100008143 237
70 3300005288 Ga0065714_10010475 Ga0065714_100104756 237
71 3300005289 Ga0065704_10073328 Ga0065704_100733287 237
72 3300005293 Ga0065715_10391905 Ga0065715_103919051 237
73 3300005331 Ga0070670_100003557 Ga0070670_1000035572 237
74 3300005331 Ga0070670_100081203 Ga0070670_1000812033 237
75 3300005331 Ga0070670_100194358 Ga0070670_1001943581 237
76 3300005335 Ga0070666_10000953 Ga0070666_100009539 237
77 3300005335 Ga0070666_10119214 Ga0070666_101192141 237
78 3300005335 Ga0070666_10221736 Ga0070666_102217363 237
79 3300005337 Ga0070682_100077670 Ga0070682_1000776703 237
80 3300005339 Ga0070660_100061822 Ga0070660_1000618222 237
81 3300005339 Ga0070660_100281257 Ga0070660_1002812572 237
82 3300005344 Ga0070661_100002100 Ga0070661_10000210017 237
83 3300005344 Ga0070661_100069955 Ga0070661_1000699553 237
84 3300005344 Ga0070661_100230344 Ga0070661_1002303441 237
85 3300005344 Ga0070661_100454405 Ga0070661_1004544051 237
86 3300005347 Ga0070668_100020594 Ga0070668_1000205945 237
87 3300005354 Ga0070675_100242239 Ga0070675_1002422392 237
88 3300005355 Ga0070671_100092317 Ga0070671_1000923172 237
89 3300005365 Ga0070688_100179863 Ga0070688_1001798632 237
90 3300005366 Ga0070659_100006373 Ga0070659_1000063739 237
91 3300005366 Ga0070659_100538480 Ga0070659_1005384801 237
92 3300005367 Ga0070667_100000093 Ga0070667_10000009356 237
93 3300005367 Ga0070667_100005913 Ga0070667_1000059139 237
94 3300005367 Ga0070667_100016216 Ga0070667_1000162168 237
95 3300005367 Ga0070667_100175713 Ga0070667_1001757132 237
96 3300005367 Ga0070667_100203449 Ga0070667_1002034493 237
97 3300005434 Ga0070709_10341500 Ga0070709_103415001 237
98 3300005455 Ga0070663_100000032 Ga0070663_10000003223 237
99 3300005455 Ga0070663_100125237 Ga0070663_1001252371 237
100 3300005457 Ga0070662_100214984 Ga0070662_1002149841 237
101 3300005458 Ga0070681_10036489 Ga0070681_100364895 237
102 3300005459 Ga0068867_100010240 Ga0068867_1000102409 237
103 3300005530 Ga0070679_100236893 Ga0070679_1002368932 237
104 3300005530 Ga0070679_100338094 Ga0070679_1003380942 237
105 3300005530 Ga0070679_100350210 Ga0070679_1003502101 237
106 3300005535 Ga0070684_100088823 Ga0070684_1000888234 237
107 3300005539 Ga0068853_100000578 Ga0068853_10000057821 237
108 3300005539 Ga0068853_100002169 Ga0068853_10000216915 237
109 3300005539 Ga0068853_100016586 Ga0068853_1000165867 237
110 3300005539 Ga0068853_100062688 Ga0068853_1000626884 237
111 3300005539 Ga0068853_100121937 Ga0068853_1001219373 237
112 3300005539 Ga0068853_100136224 Ga0068853_1001362243 237
113 3300005543 Ga0070672_100038309 Ga0070672_1000383091 237
114 3300005544 Ga0070686_100581910 Ga0070686_1005819101 237
115 3300005547 Ga0070693_100018332 Ga0070693_1000183325 237
116 3300005547 Ga0070693_100042646 Ga0070693_1000426462 237
117 3300005548 Ga0070665_100000053 Ga0070665_100000053184 237
118 3300005548 Ga0070665_100006542 Ga0070665_10000654213 237
119 3300005548 Ga0070665_100077369 Ga0070665_1000773694 237
120 3300005548 Ga0070665_100363370 Ga0070665_1003633702 237
121 3300005563 Ga0068855_100001236 Ga0068855_10000123615 237
122 3300005563 Ga0068855_100069561 Ga0068855_1000695615 237
123 3300005563 Ga0068855_100118404 Ga0068855_1001184044 237
124 3300005563 Ga0068855_100404007 Ga0068855_1004040072 237
125 3300005577 Ga0068857_100158515 Ga0068857_1001585152 237
126 3300005577 Ga0068857_100242262 Ga0068857_1002422622 237
127 3300005578 Ga0068854_100017640 Ga0068854_1000176406 237
128 3300005614 Ga0068856_100019245 Ga0068856_1000192452 237
129 3300005614 Ga0068856_100080678 Ga0068856_1000806783 237
130 3300005614 Ga0068856_100080681 Ga0068856_1000806814 237
131 3300005614 Ga0068856_100293279 Ga0068856_1002932791 237
132 3300005616 Ga0068852_100024631 Ga0068852_1000246313 237
133 3300005616 Ga0068852_100066615 Ga0068852_1000666154 237
134 3300005616 Ga0068852_100306075 Ga0068852_1003060752 237
135 3300005617 Ga0068859_100000070 Ga0068859_10000007042 237
136 3300005617 Ga0068859_100175296 Ga0068859_1001752961 237
137 3300005618 Ga0068864_100013257 Ga0068864_1000132576 237
138 3300005834 Ga0068851_10131766 Ga0068851_101317661 237
139 3300005841 Ga0068863_100003508 Ga0068863_1000035087 237
140 3300005841 Ga0068863_100014341 Ga0068863_1000143412 237
141 3300005841 Ga0068863_100019413 Ga0068863_1000194136 237
142 3300005841 Ga0068863_100071823 Ga0068863_1000718234 237
143 3300005841 Ga0068863_100611658 Ga0068863_1006116582 237
144 3300005841 Ga0068863_100789514 Ga0068863_1007895141 237
145 3300005842 Ga0068858_100039469 Ga0068858_1000394695 237
146 3300005842 Ga0068858_100100298 Ga0068858_1001002982 237
147 3300005842 Ga0068858_100273067 Ga0068858_1002730672 237
148 3300005843 Ga0068860_100753571 Ga0068860_1007535712 237
149 3300005844 Ga0068862_100000041 Ga0068862_10000004143 237
150 3300005937 Ga0081455_10462099 Ga0081455_104620991 237
151 3300006028 Ga0070717_10038092 Ga0070717_100380924 237
152 3300006051 Ga0075364_10001168 Ga0075364_100011683 237
153 3300006051 Ga0075364_10050400 Ga0075364_100504003 237
154 3300006051 Ga0075364_10406993 Ga0075364_104069932 237
155 3300006237 Ga0097621_100027840 Ga0097621_1000278403 237
156 3300006237 Ga0097621_100050252 Ga0097621_1000502522 237
157 3300006237 Ga0097621_100270841 Ga0097621_1002708412 237
158 3300006237 Ga0097621_100272501 Ga0097621_1002725012 237
159 3300006881 Ga0068865_100008851 Ga0068865_1000088514 237
160 3300006881 Ga0068865_100016541 Ga0068865_1000165412 237
161 3300006931 Ga0097620_100000070 Ga0097620_10000007042 237
162 3300006931 Ga0097620_100175296 Ga0097620_1001752961 237
163 3300009011 Ga0105251_10000008 Ga0105251_1000000888 237
164 3300009011 Ga0105251_10019337 Ga0105251_100193374 237
165 3300009093 Ga0105240_10501134 Ga0105240_105011342 237
166 3300009174 Ga0105241_10013791 Ga0105241_100137916 237
167 3300009174 Ga0105241_10140953 Ga0105241_101409533 237
168 3300009174 Ga0105241_10640139 Ga0105241_106401391 237
169 3300009177 Ga0105248_10000248 Ga0105248_1000024842 237
170 3300009177 Ga0105248_10225916 Ga0105248_102259164 237
171 3300009545 Ga0105237_10054199 Ga0105237_100541995 237
172 3300009545 Ga0105237_10166124 Ga0105237_101661242 237
173 3300009545 Ga0105237_10233916 Ga0105237_102339163 237
174 3300009551 Ga0105238_10011499 Ga0105238_100114996 237
175 3300009551 Ga0105238_10034369 Ga0105238_100343696 237
176 3300009551 Ga0105238_10089269 Ga0105238_100892693 237
177 3300009553 Ga0105249_10000471 Ga0105249_1000047127 237
178 3300009553 Ga0105249_10222541 Ga0105249_102225413 237
179 3300010375 Ga0105239_10001467 Ga0105239_100014672 237
180 3300010375 Ga0105239_10001780 Ga0105239_1000178016 237
181 3300010375 Ga0105239_10007054 Ga0105239_100070542 237
182 3300010375 Ga0105239_10028873 Ga0105239_100288734 237
183 3300010375 Ga0105239_10080575 Ga0105239_100805755 237
184 3300010375 Ga0105239_10396790 Ga0105239_103967902 237
185 3300010375 Ga0105239_11210160 Ga0105239_112101601 237
186 3300012512 Ga0157327_1015868 Ga0157327_10158681 237
187 3300013100 Ga0157373_10026274 Ga0157373_100262743 237
188 3300013104 Ga0157370_10005233 Ga0157370_100052336 237
189 3300013104 Ga0157370_10008733 Ga0157370_100087338 237
190 3300013104 Ga0157370_10085514 Ga0157370_100855142 237
191 3300013104 Ga0157370_10227362 Ga0157370_102273622 237
192 3300013105 Ga0157369_10013085 Ga0157369_100130854 237
193 3300013105 Ga0157369_10021113 Ga0157369_100211133 237
194 3300013296 Ga0157374_10141397 Ga0157374_101413974 237
195 3300013296 Ga0157374_10220845 Ga0157374_102208451 237
196 3300013297 Ga0157378_10000052 Ga0157378_1000005249 237
197 3300013297 Ga0157378_10065566 Ga0157378_100655662 237
198 3300013306 Ga0163162_10000061 Ga0163162_1000006179 237
199 3300013306 Ga0163162_10155248 Ga0163162_101552484 237
200 3300013306 Ga0163162_10453125 Ga0163162_104531252 237
201 3300013306 Ga0163162_10612768 Ga0163162_106127681 237
202 3300013307 Ga0157372_10008531 Ga0157372_100085315 237
203 3300013307 Ga0157372_10409140 Ga0157372_104091402 237
204 3300013308 Ga0157375_10023874 Ga0157375_100238745 237
205 3300013308 Ga0157375_10179802 Ga0157375_101798022 237
206 3300014325 Ga0163163_10000166 Ga0163163_1000016615 237
207 3300014325 Ga0163163_10005131 Ga0163163_1000513110 237
208 3300014325 Ga0163163_10008166 Ga0163163_100081666 237
209 3300014326 Ga0157380_10244117 Ga0157380_102441172 237
210 3300014497 Ga0182008_10000913 Ga0182008_1000091313 237
211 3300014968 Ga0157379_10004862 Ga0157379_1000486212 237
212 3300014968 Ga0157379_10154679 Ga0157379_101546792 237
213 3300014969 Ga0157376_10037455 Ga0157376_100374555 237
214 3300014969 Ga0157376_10181048 Ga0157376_101810481 237
215 3300015261 Ga0182006_1014002 Ga0182006_10140022 237
216 3300015261 Ga0182006_1035742 Ga0182006_10357422 237
217 3300015261 Ga0182006_1107513 Ga0182006_11075132 237
218 3300015689 Ga0183360_10004 Ga0183360_10004147 237
219 3300017792 Ga0163161_10001958 Ga0163161_1000195810 237
220 3300017792 Ga0163161_10035692 Ga0163161_100356925 237
221 3300025245 Ga0207425_1000029 Ga0207425_1000029173 237
222 3300025258 Ga0209129_1000073 Ga0209129_100007362 237
223 3300025263 Ga0209565_1000002 Ga0209565_10000021126 237
224 3300025263 Ga0209565_1000113 Ga0209565_100011354 237
225 3300025273 Ga0209673_1000002 Ga0209673_10000021126 237
226 3300025273 Ga0209673_1000369 Ga0209673_100036934 237
227 3300025273 Ga0209673_1023345 Ga0209673_10233452 237
228 3300025284 Ga0209130_1030023 Ga0209130_10300232 237
229 3300025284 Ga0209130_1039891 Ga0209130_10398911 237
230 3300025291 Ga0209675_1000002 Ga0209675_10000021126 237
231 3300025291 Ga0209675_1000007 Ga0209675_100000748 237
232 3300025291 Ga0209675_1022095 Ga0209675_10220952 237
233 3300025292 Ga0209676_1000018 Ga0209676_1000018498 237
234 3300025292 Ga0209676_1001361 Ga0209676_100136111 237
235 3300025292 Ga0209676_1001572 Ga0209676_100157210 237
236 3300025292 Ga0209676_1007516 Ga0209676_10075163 237
237 3300025292 Ga0209676_1009869 Ga0209676_10098694 237
238 3300025292 Ga0209676_1051041 Ga0209676_10510412 237
239 3300025294 Ga0209025_1000076 Ga0209025_1000076177 237
240 3300025294 Ga0209025_1000134 Ga0209025_100013451 237
241 3300025294 Ga0209025_1001794 Ga0209025_10017946 237
242 3300025295 Ga0209564_1000004 Ga0209564_10000041127 237
243 3300025295 Ga0209564_1000333 Ga0209564_100033347 237
244 3300025295 Ga0209564_1020240 Ga0209564_10202402 237
245 3300025297 Ga0209758_1000112 Ga0209758_1000112113 237
246 3300025298 Ga0209050_1000396 Ga0209050_100039642 237
247 3300025298 Ga0209050_1001391 Ga0209050_10013913 237
248 3300025298 Ga0209050_1001430 Ga0209050_10014309 237
249 3300025298 Ga0209050_1038936 Ga0209050_10389362 237
250 3300025298 Ga0209050_1046199 Ga0209050_10461992 237
251 3300025299 Ga0209256_1000004 Ga0209256_10000041127 237
252 3300025299 Ga0209256_1002151 Ga0209256_10021512 237
253 3300025299 Ga0209256_1002538 Ga0209256_10025382 237
254 3300025299 Ga0209256_1005969 Ga0209256_10059693 237
255 3300025299 Ga0209256_1006907 Ga0209256_10069074 237
256 3300025299 Ga0209256_1009592 Ga0209256_10095924 237
257 3300025303 Ga0209051_1000449 Ga0209051_100044918 237
258 3300025303 Ga0209051_1032865 Ga0209051_10328652 237
259 3300025304 Ga0209257_1000035 Ga0209257_1000035498 237
260 3300025304 Ga0209257_1000150 Ga0209257_100015077 237
261 3300025304 Ga0209257_1000861 Ga0209257_10008618 237
262 3300025304 Ga0209257_1001769 Ga0209257_100176915 237
263 3300025304 Ga0209257_1002921 Ga0209257_100292118 237
264 3300025304 Ga0209257_1004367 Ga0209257_10043679 237
265 3300025304 Ga0209257_1006408 Ga0209257_10064084 237
266 3300025304 Ga0209257_1008020 Ga0209257_10080205 237
267 3300025321 Ga0207656_10137475 Ga0207656_101374752 237
268 3300025735 Ga0207713_1000170 Ga0207713_100017043 237
269 3300025735 Ga0207713_1070744 Ga0207713_10707442 237
270 3300025898 Ga0207692_10172743 Ga0207692_101727432 237
271 3300025903 Ga0207680_10000676 Ga0207680_1000067610 237
272 3300025903 Ga0207680_10054437 Ga0207680_100544373 237
273 3300025903 Ga0207680_10146267 Ga0207680_101462672 237
274 3300025904 Ga0207647_10001196 Ga0207647_1000119617 237
275 3300025904 Ga0207647_10165850 Ga0207647_101658502 237
276 3300025907 Ga0207645_10090284 Ga0207645_100902842 237
277 3300025908 Ga0207643_10218073 Ga0207643_102180732 237
278 3300025909 Ga0207705_10276548 Ga0207705_102765482 237
279 3300025911 Ga0207654_10001933 Ga0207654_1000193312 237
280 3300025911 Ga0207654_10011118 Ga0207654_100111185 237
281 3300025911 Ga0207654_10082581 Ga0207654_100825812 237
282 3300025912 Ga0207707_10081643 Ga0207707_100816432 237
283 3300025913 Ga0207695_10000271 Ga0207695_1000027182 237
284 3300025914 Ga0207671_10008442 Ga0207671_100084421 237
285 3300025914 Ga0207671_10018141 Ga0207671_100181414 237
286 3300025914 Ga0207671_10133090 Ga0207671_101330902 237
287 3300025914 Ga0207671_10138065 Ga0207671_101380652 237
288 3300025915 Ga0207693_10389321 Ga0207693_103893211 237
289 3300025919 Ga0207657_10013571 Ga0207657_100135712 237
290 3300025919 Ga0207657_10150759 Ga0207657_101507594 237
291 3300025920 Ga0207649_10006390 Ga0207649_100063907 237
292 3300025920 Ga0207649_10042889 Ga0207649_100428894 237
293 3300025923 Ga0207681_10480473 Ga0207681_104804732 237
294 3300025924 Ga0207694_10252016 Ga0207694_102520161 237
295 3300025925 Ga0207650_10000609 Ga0207650_1000060914 237
296 3300025925 Ga0207650_10104689 Ga0207650_101046893 237
297 3300025925 Ga0207650_10180102 Ga0207650_101801023 237
298 3300025931 Ga0207644_10025895 Ga0207644_100258955 237
299 3300025931 Ga0207644_10269409 Ga0207644_102694091 237
300 3300025932 Ga0207690_10115038 Ga0207690_101150382 237
301 3300025933 Ga0207706_10029354 Ga0207706_100293544 237
302 3300025934 Ga0207686_10551529 Ga0207686_105515292 237
303 3300025935 Ga0207709_10004956 Ga0207709_100049567 237
304 3300025936 Ga0207670_10265562 Ga0207670_102655622 237
305 3300025938 Ga0207704_10032344 Ga0207704_100323444 237
306 3300025938 Ga0207704_10059125 Ga0207704_100591252 237
307 3300025940 Ga0207691_10019964 Ga0207691_100199643 237
308 3300025941 Ga0207711_10002210 Ga0207711_1000221011 237
309 3300025942 Ga0207689_10043389 Ga0207689_100433894 237
310 3300025942 Ga0207689_10197427 Ga0207689_101974274 237
311 3300025944 Ga0207661_10084178 Ga0207661_100841784 237
312 3300025949 Ga0207667_10006642 Ga0207667_100066422 237
313 3300025949 Ga0207667_10009259 Ga0207667_100092599 237
314 3300025949 Ga0207667_10061270 Ga0207667_100612702 237
315 3300025949 Ga0207667_10272394 Ga0207667_102723942 237
316 3300025949 Ga0207667_10759167 Ga0207667_107591671 237
317 3300025960 Ga0207651_10151481 Ga0207651_101514812 237
318 3300025961 Ga0207712_10000056 Ga0207712_1000005620 237
319 3300025961 Ga0207712_10243910 Ga0207712_102439101 237
320 3300025972 Ga0207668_10135154 Ga0207668_101351542 237
321 3300025972 Ga0207668_10222264 Ga0207668_102222641 237
322 3300025981 Ga0207640_10017451 Ga0207640_100174514 237
323 3300025981 Ga0207640_10508797 Ga0207640_105087972 237
324 3300025986 Ga0207658_10000020 Ga0207658_100000208 237
325 3300025986 Ga0207658_10003800 Ga0207658_100038001 237
326 3300025986 Ga0207658_10049334 Ga0207658_100493343 237
327 3300025986 Ga0207658_10322030 Ga0207658_103220302 237
328 3300025986 Ga0207658_10679911 Ga0207658_106799111 237
329 3300026035 Ga0207703_10322997 Ga0207703_103229972 237
330 3300026035 Ga0207703_10521670 Ga0207703_105216701 237
331 3300026041 Ga0207639_10001658 Ga0207639_1000165816 237
332 3300026041 Ga0207639_10002592 Ga0207639_100025927 237
333 3300026041 Ga0207639_10004818 Ga0207639_100048182 237
334 3300026041 Ga0207639_10005192 Ga0207639_100051922 237
335 3300026041 Ga0207639_10010298 Ga0207639_100102984 237
336 3300026041 Ga0207639_10011899 Ga0207639_100118992 237
337 3300026041 Ga0207639_10057786 Ga0207639_100577864 237
338 3300026041 Ga0207639_10099933 Ga0207639_100999333 237
339 3300026067 Ga0207678_10000010 Ga0207678_1000001023 237
340 3300026078 Ga0207702_10002211 Ga0207702_100022118 237
341 3300026078 Ga0207702_10006391 Ga0207702_1000639112 237
342 3300026088 Ga0207641_10006298 Ga0207641_100062982 237
343 3300026088 Ga0207641_10018733 Ga0207641_100187337 237
344 3300026088 Ga0207641_10023027 Ga0207641_100230273 237
345 3300026089 Ga0207648_10002984 Ga0207648_1000298412 237
346 3300026095 Ga0207676_10032827 Ga0207676_100328275 237
347 3300026095 Ga0207676_10556158 Ga0207676_105561581 237
348 3300026116 Ga0207674_10072246 Ga0207674_100722463 237
349 3300026116 Ga0207674_10231187 Ga0207674_102311872 237
350 3300026118 Ga0207675_100627883 Ga0207675_1006278831 237
351 3300026142 Ga0207698_10158227 Ga0207698_101582272 237
352 3300026142 Ga0207698_10169888 Ga0207698_101698882 237
353 3300026142 Ga0207698_10332243 Ga0207698_103322432 237
354 3300026142 Ga0207698_10614220 Ga0207698_106142201 237
355 3300027312 Ga0209371_1000235 Ga0209371_100023543 237
356 3300028379 Ga0268266_10000001 Ga0268266_10000001181 237
357 3300028379 Ga0268266_10024141 Ga0268266_100241413 237
358 3300028379 Ga0268266_10248270 Ga0268266_102482702 237
359 3300028379 Ga0268266_10278713 Ga0268266_102787131 237
360 3300028379 Ga0268266_10437231 Ga0268266_104372312 237
361 3300028379 Ga0268266_10459412 Ga0268266_104594122 237
362 3300028380 Ga0268265_10000137 Ga0268265_1000013737 237
363 3300028381 Ga0268264_10060987 Ga0268264_100609874 237
364 3300028381 Ga0268264_10371381 Ga0268264_103713813 237
365 3300030500 Ga0268256_1000196 Ga0268256_100019620 237
366 3300030733 Ga0314311_1183412 Ga0314311_11834123 237
367 3300030736 Ga0316180_1048768 Ga0316180_10487682 237
368 3300030742 Ga0316183_1047328 Ga0316183_10473285 237
369 3300030745 Ga0316182_1226196 Ga0316182_12261962 237
370 3300031548 Ga0307408_100056242 Ga0307408_1000562421 237
371 3300031548 Ga0307408_100757408 Ga0307408_1007574081 237
372 3300031730 Ga0307516_10159177 Ga0307516_101591772 237
373 3300031730 Ga0307516_10169553 Ga0307516_101695531 237
374 3300031731 Ga0307405_10128201 Ga0307405_101282012 237
375 3300031901 Ga0307406_10014708 Ga0307406_100147084 237
376 3300031901 Ga0307406_10357102 Ga0307406_103571022 237
377 3300031903 Ga0307407_10040952 Ga0307407_100409522 237
378 3300031911 Ga0307412_10070648 Ga0307412_100706482 237
379 3300032002 Ga0307416_100206007 Ga0307416_1002060072 237
380 3300032002 Ga0307416_100250679 Ga0307416_1002506792 237
381 3300032004 Ga0307414_10059038 Ga0307414_100590382 237
382 3300032004 Ga0307414_10119791 Ga0307414_101197912 237
383 3300032004 Ga0307414_10226360 Ga0307414_102263602 237
384 3300032004 Ga0307414_10258799 Ga0307414_102587992 237
385 3300032004 Ga0307414_10505221 Ga0307414_105052212 237
386 3300032005 Ga0307411_10063599 Ga0307411_100635993 237
387 3300032005 Ga0307411_10204749 Ga0307411_102047492 237
388 3300032005 Ga0307411_10242391 Ga0307411_102423912 237
389 3300032005 Ga0307411_10257994 Ga0307411_102579943 237
390 3300032126 Ga0307415_100340659 Ga0307415_1003406591 237
391 3300037471 Ga0395905_0092352 Ga0395905_0092352_1290_2012 237
392 3300037471 Ga0395905_0158891 Ga0395905_0158891_360_1082 237
393 3300038705 Ga0237819_00408 Ga0237819_00408_10654_11376 237
394 3300039145 Ga0237816_02319 Ga0237816_02319_328_1056 237
395 3300041404 Ga0439436_0001101 Ga0439436_0001101_3836_4582 237
396 3300041404 Ga0439436_0038342 Ga0439436_0038342_110_835 237
397 3300041413 Ga0439465_0038820 Ga0439465_0038820_429_1154 237
398 3300041451 Ga0451791_0128905 Ga0451791_0128905_32_754 237
399 3300041451 Ga0451791_0620911 Ga0451791_0620911_11_727 237
400 3300041452 Ga0451793_0075781 Ga0451793_0075781_1470_2186 237
401 3300041452 Ga0451793_1174458 Ga0451793_1174458_812_1609 237
402 3300041456 Ga0451795_1325393 Ga0451795_1325393_27_743 237
403 3300041459 Ga0451800_0052513 Ga0451800_0052513_49_771 237
404 3300041459 Ga0451800_0176271 Ga0451800_0176271_1769_2566 237
405 3300041462 Ga0451806_243563 Ga0451806_243563_2953_3750 237
406 3300041463 Ga0451804_0548075 Ga0451804_0548075_1127_1924 237
407 3300041486 Ga0451807_0148046 Ga0451807_0148046_141_857 237
408 3300041486 Ga0451807_1481108 Ga0451807_1481108_2729_3526 237
409 3300041491 Ga0451833_1391529 Ga0451833_1391529_30_746 237
410 3300041494 Ga0451837_0148912 Ga0451837_0148912_1647_2363 237
411 3300041496 Ga0451839_0733957 Ga0451839_0733957_318_1034 237
412 3300042004 Ga0439445_0001895 Ga0439445_0001895_524_1264 237
413 3300042006 Ga0439432_002495 Ga0439432_002495_815_1570 237
414 3300042006 Ga0439432_012529 Ga0439432_012529_1663_2385 237
415 3300042007 Ga0439449_0000005 Ga0439449_0000005_5586_6311 237
416 3300042007 Ga0439449_0018213 Ga0439449_0018213_187_942 237
417 3300042007 Ga0439449_0035650 Ga0439449_0035650_946_1701 237
418 3300042007 Ga0439449_0054170 Ga0439449_0054170_485_1231 237
419 3300044658 Ga0466972_0000334 Ga0466972_0000334_2991_3707 237
420 3300044765 Ga0466970_0007051 Ga0466970_0007051_56_772 237
421 3300046454 Ga0495592_0314056 Ga0495592_0314056_280_996 237
422 3300046459 Ga0495629_0176417 Ga0495629_0176417_229_945 237
423 3300046460 Ga0495638_0002595 Ga0495638_0002595_11137_11859 237
424 3300046474 Ga0495605_0072431 Ga0495605_0072431_398_1129 237
425 3300046501 Ga0495607_0046027 Ga0495607_0046027_1648_2379 237
426 3300046507 Ga0495606_0054020 Ga0495606_0054020_740_1471 237
427 3300046512 Ga0495610_0003711 Ga0495610_0003711_10539_11261 237
428 3300046512 Ga0495610_0061976 Ga0495610_0061976_210_941 237
429 3300046518 Ga0495631_0008855 Ga0495631_0008855_2849_3571 237
430 3300046522 Ga0495643_0001375 Ga0495643_0001375_10228_10950 237
431 3300046539 Ga0495621_0000496 Ga0495621_0000496_8470_9195 237
432 3300046558 Ga0495633_0012995 Ga0495633_0012995_3088_3810 237
433 3300046558 Ga0495633_0028608 Ga0495633_0028608_722_1444 237
434 3300046660 Ga0495625_0079320 Ga0495625_0079320_1059_1781 237
435 3300046664 Ga0495659_0051771 Ga0495659_0051771_467_1222 237
436 3300047318 Ga0495636_0000147 Ga0495636_0000147_11742_12497 237
437 3300047320 Ga0495672_0001550 Ga0495672_0001550_11481_12203 237
438 3300047322 Ga0495680_0214891 Ga0495680_0214891_631_1347 237
439 3300047472 Ga0495686_0020416 Ga0495686_0020416_2687_3433 237
440 3300047472 Ga0495686_0039504 Ga0495686_0039504_844_1566 237
441 3300048904 Ga0496101_0233150 Ga0496101_0233150_382_1104 237
442 3300048911 Ga0496108_0217980 Ga0496108_0217980_849_1574 237
443 3300048911 Ga0496108_0446075 Ga0496108_0446075_154_876 237
444 3300048918 Ga0496115_0000002 Ga0496115_0000002_291488_292204 237
445 3300048919 Ga0496116_0039520 Ga0496116_0039520_595_1317 237
446 3300048919 Ga0496116_0153685 Ga0496116_0153685_24_746 237
447 3300048920 Ga0496117_0002512 Ga0496117_0002512_14326_15048 237
448 3300048920 Ga0496117_0002847 Ga0496117_0002847_10815_11537 237
449 3300048920 Ga0496117_0003923 Ga0496117_0003923_13433_14155 237
450 3300048920 Ga0496117_0033222 Ga0496117_0033222_2461_3177 237
451 3300048920 Ga0496117_0085654 Ga0496117_0085654_558_1274 237
452 3300048921 Ga0496118_0000065 Ga0496118_0000065_101251_101967 237
453 3300048921 Ga0496118_0000183 Ga0496118_0000183_31070_31786 237
454 3300048921 Ga0496118_0003155 Ga0496118_0003155_9512_10234 237
455 3300048921 Ga0496118_0004179 Ga0496118_0004179_13433_14155 237
456 3300048921 Ga0496118_0027139 Ga0496118_0027139_2101_2823 237
457 3300048921 Ga0496118_0111948 Ga0496118_0111948_1055_1777 237
458 3300048921 Ga0496118_0181823 Ga0496118_0181823_49_771 237
459 3300048922 Ga0496119_0000787 Ga0496119_0000787_35787_36509 237
460 3300048922 Ga0496119_0005545 Ga0496119_0005545_7931_8653 237
461 3300048923 Ga0496120_0000776 Ga0496120_0000776_9459_10181 237
462 3300048923 Ga0496120_0001660 Ga0496120_0001660_7935_8657 237
463 3300048924 Ga0496121_0009225 Ga0496121_0009225_1747_2469 237
464 3300048924 Ga0496121_0042488 Ga0496121_0042488_398_1144 237
465 3300048924 Ga0496121_0095925 Ga0496121_0095925_689_1405 237
466 3300048925 Ga0496122_0000037 Ga0496122_0000037_54718_55464 237
467 3300048925 Ga0496122_0000355 Ga0496122_0000355_10257_11021 237
468 3300048925 Ga0496122_0000361 Ga0496122_0000361_8135_8857 237
469 3300048925 Ga0496122_0080025 Ga0496122_0080025_65_787 237
470 3300048925 Ga0496122_0143733 Ga0496122_0143733_486_1208 237
471 3300048926 Ga0496123_0000167 Ga0496123_0000167_106578_107324 237
472 3300048926 Ga0496123_0001332 Ga0496123_0001332_23864_24628 237
473 3300048926 Ga0496123_0002053 Ga0496123_0002053_17066_17788 237
474 3300048926 Ga0496123_0051202 Ga0496123_0051202_536_1258 237
475 3300048926 Ga0496123_0128526 Ga0496123_0128526_204_926 237
476 3300048926 Ga0496123_0200952 Ga0496123_0200952_224_946 237
477 3300048927 Ga0496124_0000018 Ga0496124_0000018_295137_295868 237
478 3300048927 Ga0496124_0002453 Ga0496124_0002453_7872_8594 237
479 3300048927 Ga0496124_0003077 Ga0496124_0003077_7932_8654 237
480 3300048927 Ga0496124_0031164 Ga0496124_0031164_1318_2040 237
481 3300048927 Ga0496124_0057662 Ga0496124_0057662_74_796 237
482 3300048927 Ga0496124_0064200 Ga0496124_0064200_1618_2340 237
483 3300048927 Ga0496124_0118670 Ga0496124_0118670_74_796 237
484 3300048928 Ga0496125_0000486 Ga0496125_0000486_66178_66900 237
485 3300048928 Ga0496125_0028711 Ga0496125_0028711_3160_3882 237
486 3300048928 Ga0496125_0030723 Ga0496125_0030723_1421_2143 237
487 3300048928 Ga0496125_0047889 Ga0496125_0047889_1561_2283 237
488 3300048928 Ga0496125_0049149 Ga0496125_0049149_653_1375 237
489 3300048928 Ga0496125_0356871 Ga0496125_0356871_14_730 237
490 3300048929 Ga0496126_0000052 Ga0496126_0000052_238659_239375 237
491 3300048929 Ga0496126_0002494 Ga0496126_0002494_14574_15296 237
492 3300048929 Ga0496126_0119312 Ga0496126_0119312_1110_1826 237
493 3300049568 Ga0501031_0005216 Ga0501031_0005216_4798_5514 237
494 3300049568 Ga0501031_0019030 Ga0501031_0019030_3441_4157 237
495 3300049569 Ga0501032_0000210 Ga0501032_0000210_20511_21227 237
496 3300049569 Ga0501032_0017490 Ga0501032_0017490_3753_4469 237
497 3300049569 Ga0501032_0124583 Ga0501032_0124583_427_1143 237
498 3300049569 Ga0501032_0270441 Ga0501032_0270441_344_1060 237
499 3300049570 Ga0501033_0002201 Ga0501033_0002201_15064_15780 237
500 3300049570 Ga0501033_0002803 Ga0501033_0002803_5293_6009 237
501 3300049571 Ga0501034_0002412 Ga0501034_0002412_9180_9896 237
502 3300049571 Ga0501034_0006726 Ga0501034_0006726_10876_11601 237
503 3300049571 Ga0501034_0020750 Ga0501034_0020750_2253_2969 237
504 3300049571 Ga0501034_0031232 Ga0501034_0031232_2849_3565 237
505 3300049571 Ga0501034_0038655 Ga0501034_0038655_2257_2982 237
506 3300049571 Ga0501034_0131898 Ga0501034_0131898_135_851 237
507 3300049571 Ga0501034_0382400 Ga0501034_0382400_446_1162 237
508 3300049572 Ga0501036_0002348 Ga0501036_0002348_5185_5901 237
509 3300049572 Ga0501036_0004079 Ga0501036_0004079_3056_3772 237
510 3300049572 Ga0501036_0008356 Ga0501036_0008356_7327_8043 237
511 3300049572 Ga0501036_0164595 Ga0501036_0164595_604_1320 237
512 3300049573 Ga0501037_0006826 Ga0501037_0006826_4670_5386 237
513 3300049573 Ga0501037_0015960 Ga0501037_0015960_441_1157 237
514 3300049574 Ga0501038_0002683 Ga0501038_0002683_8660_9376 237
515 3300049574 Ga0501038_0003333 Ga0501038_0003333_14071_14787 237
516 3300049574 Ga0501038_0017012 Ga0501038_0017012_2238_2954 237
517 3300049574 Ga0501038_0080555 Ga0501038_0080555_1228_1944 237
518 3300049575 Ga0501039_0051215 Ga0501039_0051215_2043_2759 237
519 3300049576 Ga0501040_0015264 Ga0501040_0015264_1417_2133 237
520 3300049578 Ga0501042_0021090 Ga0501042_0021090_1753_2469 237
521 3300049578 Ga0501042_0168165 Ga0501042_0168165_458_1174 237
522 3300049579 Ga0501043_0001996 Ga0501043_0001996_15763_16479 237
523 3300049579 Ga0501043_0002614 Ga0501043_0002614_948_1688 237
524 3300049579 Ga0501043_0061548 Ga0501043_0061548_2183_2899 237
525 3300049579 Ga0501043_0070939 Ga0501043_0070939_1048_1764 237
526 3300049579 Ga0501043_0106581 Ga0501043_0106581_537_1253 237
527 3300049579 Ga0501043_0463120 Ga0501043_0463120_213_929 237
528 3300049580 Ga0501046_0000871 Ga0501046_0000871_19874_20590 237
529 3300049580 Ga0501046_0121760 Ga0501046_0121760_441_1157 237
530 3300049580 Ga0501046_0194316 Ga0501046_0194316_247_963 237
531 3300049580 Ga0501046_0314740 Ga0501046_0314740_270_986 237
532 3300049580 Ga0501046_0413873 Ga0501046_0413873_41_757 237
533 3300049581 Ga0501047_0005436 Ga0501047_0005436_9547_10263 237
534 3300049581 Ga0501047_0007253 Ga0501047_0007253_2828_3544 237
535 3300049581 Ga0501047_0030303 Ga0501047_0030303_3753_4469 237
536 3300049581 Ga0501047_0039255 Ga0501047_0039255_739_1464 237
537 3300049581 Ga0501047_0054618 Ga0501047_0054618_1317_2033 237
538 3300049582 Ga0501048_0003611 Ga0501048_0003611_7397_8113 237
539 3300049582 Ga0501048_0309593 Ga0501048_0309593_345_1061 237
540 3300049583 Ga0501067_0000786 Ga0501067_0000786_6225_6941 237
541 3300049583 Ga0501067_0009081 Ga0501067_0009081_3633_4349 237
542 3300049584 Ga0501068_0079848 Ga0501068_0079848_167_883 237
543 3300049585 Ga0501069_0002420 Ga0501069_0002420_4346_5062 237
544 3300049585 Ga0501069_0003626 Ga0501069_0003626_5261_5977 237
545 3300049585 Ga0501069_0266661 Ga0501069_0266661_232_948 237
546 3300049586 Ga0501070_0007151 Ga0501070_0007151_5752_6468 237
547 3300049586 Ga0501070_0039775 Ga0501070_0039775_1573_2289 237
548 3300049586 Ga0501070_0040947 Ga0501070_0040947_2199_2915 237
549 3300049586 Ga0501070_0060336 Ga0501070_0060336_1873_2589 237
550 3300049586 Ga0501070_0092389 Ga0501070_0092389_254_970 237
551 3300049586 Ga0501070_0100374 Ga0501070_0100374_1220_1936 237
552 3300049586 Ga0501070_0301078 Ga0501070_0301078_52_768 237
553 3300049587 Ga0501071_0018515 Ga0501071_0018515_2135_2851 237
554 3300049588 Ga0501072_0001140 Ga0501072_0001140_186_902 237
555 3300049588 Ga0501072_0346866 Ga0501072_0346866_207_923 237
556 3300049589 Ga0501073_0002336 Ga0501073_0002336_1839_2555 237
557 3300049589 Ga0501073_0007516 Ga0501073_0007516_3148_3864 237
558 3300049589 Ga0501073_0008635 Ga0501073_0008635_2313_3029 237
559 3300049589 Ga0501073_0041334 Ga0501073_0041334_94_810 237
560 3300049589 Ga0501073_0382545 Ga0501073_0382545_170_886 237
561 3300049590 Ga0501074_0002549 Ga0501074_0002549_9568_10284 237
562 3300049590 Ga0501074_0011395 Ga0501074_0011395_2764_3480 237
563 3300049590 Ga0501074_0075819 Ga0501074_0075819_413_1129 237
564 3300049590 Ga0501074_0076261 Ga0501074_0076261_1441_2157 237
565 3300049590 Ga0501074_0231646 Ga0501074_0231646_382_1098 237
566 3300049590 Ga0501074_0266826 Ga0501074_0266826_344_1060 237
567 3300049592 Ga0501076_0074408 Ga0501076_0074408_1882_2598 237
568 3300049592 Ga0501076_0694092 Ga0501076_0694092_47_763 237
569 3300049652 Ga0501202_008710 Ga0501202_008710_479_1204 237
570 3300049652 Ga0501202_053011 Ga0501202_053011_159_887 237
571 3300049705 Ga0501225_0002360 Ga0501225_0002360_1083_1823 237
572 3300049741 Ga0501079_0054572 Ga0501079_0054572_934_1650 237
573 3300049742 Ga0501080_0001127 Ga0501080_0001127_4275_4991 237
574 3300049742 Ga0501080_0022902 Ga0501080_0022902_2888_3604 237
575 3300049742 Ga0501080_0052468 Ga0501080_0052468_2397_3113 237
576 3300049742 Ga0501080_0192926 Ga0501080_0192926_818_1534 237
577 3300049742 Ga0501080_0338260 Ga0501080_0338260_147_863 237
578 3300049743 Ga0501081_0017691 Ga0501081_0017691_3959_4675 237
579 3300049744 Ga0501083_0009033 Ga0501083_0009033_5219_5935 237
580 3300049744 Ga0501083_0056170 Ga0501083_0056170_1705_2421 237
581 3300049762 Ga0501265_001084 Ga0501265_001084_1343_2065 237
582 3300049772 Ga0501275_000135 Ga0501275_000135_3438_4160 237
583 3300049822 Ga0501035_0001149 Ga0501035_0001149_18341_19057 237
584 3300049822 Ga0501035_0149214 Ga0501035_0149214_441_1157 237
585 3300049823 Ga0501044_0003431 Ga0501044_0003431_10652_11368 237
586 3300049823 Ga0501044_0034792 Ga0501044_0034792_1539_2255 237
587 3300049823 Ga0501044_0228605 Ga0501044_0228605_555_1271 237
588 3300049823 Ga0501044_0269086 Ga0501044_0269086_369_1085 237
589 3300049824 Ga0501045_0009388 Ga0501045_0009388_2413_3129 237
590 3300049824 Ga0501045_0245086 Ga0501045_0245086_563_1279 237
591 3300050491 nmdc:mga00v17_108907_c1 nmdc:mga00v17_108907_c1_220_942 237
592 3300050491 nmdc:mga00v17_200_c1 nmdc:mga00v17_200_c1_6912_7634 237
593 3300053087 Ga0500643_003586 Ga0500643_003586_4210_4956 237
594 3300053093 Ga0500651_0000297 Ga0500651_0000297_5920_6636 237
595 3300053093 Ga0500651_0004553 Ga0500651_0004553_1406_2122 237
596 3300053120 Ga0500597_000205 Ga0500597_000205_2780_3526 237
597 3300053139 Ga0500568_0003667 Ga0500568_0003667_56_772 237
598 3300053161 Ga0500634_0000582 Ga0500634_0000582_8867_9589 237
599 3300054114 Ga0501084_0028932 Ga0501084_0028932_2999_3715 237
600 3300054114 Ga0501084_0036845 Ga0501084_0036845_2127_2843 237
601 3300060353 Ga0501082_0000728 Ga0501082_0000728_22334_23050 237
602 3300060353 Ga0501082_0043533 Ga0501082_0043533_1659_2375 237
603 3300060353 Ga0501082_0114854 Ga0501082_0114854_1098_1814 237
604 3300060353 Ga0501082_0129723 Ga0501082_0129723_467_1183 237
605 iso_pu_bacteria 2571042365 2572255484 237
606 iso_pu_bacteria 2643221559 2643817962 237
607 iso_pu_bacteria 2643221573 2643880127 237
608 iso_pu_bacteria 2643221586 2643937620 237
609 iso_pu_bacteria 2643221593 2643975247 237
610 iso_pu_bacteria 2643221612 2644078534 237
611 iso_pu_bacteria 2643221695 2644527926 237
612 iso_pu_bacteria 2643221720 2644662324 237
613 iso_pu_bacteria 2643221727 2644693311 237
614 iso_pu_bacteria 2643221728 2644698784 237
615 iso_pu_bacteria 2895498888 2895502010 237
616 iso_pu_bacteria 2895511927 2895517037 237
617 iso_pu_bacteria 2895522137 2895524567 237
618 iso_pu_bacteria 2895525241 2895525876 237
619 iso_pu_bacteria 2941489479 2941492654 237
620 iso_pu_bacteria 2995948881 2995953889 237
621 iso_pu_bacteria 8002869464 8002870511 237
622 3300003371 JGI26145J50221_1001441 JGI26145J50221_10014412 238
623 3300003503 JGI26141J51220_1002698 JGI26141J51220_10026982 238
624 3300005293 Ga0065715_10124790 Ga0065715_101247903 238
625 3300005329 Ga0070683_100471253 Ga0070683_1004712532 238
626 3300005331 Ga0070670_100093679 Ga0070670_1000936792 238
627 3300005344 Ga0070661_100084608 Ga0070661_1000846082 238
628 3300005353 Ga0070669_100012531 Ga0070669_1000125317 238
629 3300005353 Ga0070669_100201861 Ga0070669_1002018611 238
630 3300005355 Ga0070671_100328878 Ga0070671_1003288782 238
631 3300005438 Ga0070701_10043807 Ga0070701_100438072 238
632 3300005543 Ga0070672_100009029 Ga0070672_1000090294 238
633 3300005548 Ga0070665_100562364 Ga0070665_1005623641 238
634 3300005563 Ga0068855_100915226 Ga0068855_1009152262 238
635 3300005616 Ga0068852_100000604 Ga0068852_10000060417 238
636 3300009148 Ga0105243_10224988 Ga0105243_102249882 238
637 3300013308 Ga0157375_10125738 Ga0157375_101257383 238
638 3300025294 Ga0209025_1004726 Ga0209025_10047268 238
639 3300025923 Ga0207681_10065182 Ga0207681_100651824 238
640 3300025925 Ga0207650_10015567 Ga0207650_100155672 238
641 3300025926 Ga0207659_10164930 Ga0207659_101649302 238
642 3300025931 Ga0207644_10181693 Ga0207644_101816932 238
643 3300025933 Ga0207706_10609788 Ga0207706_106097881 238
644 3300025937 Ga0207669_10325524 Ga0207669_103255242 238
645 3300025940 Ga0207691_10012595 Ga0207691_100125952 238
646 3300025949 Ga0207667_11008976 Ga0207667_110089761 238
647 3300026142 Ga0207698_10043287 Ga0207698_100432872 238
648 3300026142 Ga0207698_10441865 Ga0207698_104418652 238
649 3300027364 Ga0209967_1012379 Ga0209967_10123792 238
650 3300027424 Ga0209984_1001378 Ga0209984_10013783 238
651 3300027462 Ga0210000_1011804 Ga0210000_10118042 238
652 3300027543 Ga0209999_1004979 Ga0209999_10049792 238
653 3300027552 Ga0209982_1002346 Ga0209982_10023464 238
654 3300027665 Ga0209983_1000709 Ga0209983_10007095 238
655 3300027682 Ga0209971_1001818 Ga0209971_10018186 238
656 3300027876 Ga0209974_10005300 Ga0209974_100053004 238
657 3300031456 Ga0307513_10018587 Ga0307513_100185874 238
658 3300032004 Ga0307414_10000490 Ga0307414_100004905 238
659 3300033179 Ga0307507_10077351 Ga0307507_100773514 238
660 3300037312 Ga0395899_0153258 Ga0395899_0153258_650_1375 238
661 3300037312 Ga0395899_0234970 Ga0395899_0234970_318_1055 238
662 3300037418 Ga0395900_0051479 Ga0395900_0051479_957_1682 238
663 3300037418 Ga0395900_0156442 Ga0395900_0156442_322_1059 238
664 3300037471 Ga0395905_0001151 Ga0395905_0001151_5345_6070 238
665 3300041406 Ga0439439_0060223 Ga0439439_0060223_79_849 238
666 3300041453 Ga0451797_0356747 Ga0451797_0356747_170_952 238
667 3300041494 Ga0451837_1187473 Ga0451837_1187473_660_1391 238
668 3300041509 Ga0451843_1336202 Ga0451843_1336202_383_1114 238
669 3300042007 Ga0439449_0003367 Ga0439449_0003367_273_1043 238
670 3300046460 Ga0495638_0073120 Ga0495638_0073120_774_1538 238
671 3300046525 Ga0495663_0029743 Ga0495663_0029743_83_823 238
672 3300046525 Ga0495663_0089770 Ga0495663_0089770_83_823 238
673 3300046537 Ga0495598_0015241 Ga0495598_0015241_797_1534 238
674 3300046539 Ga0495621_0061477 Ga0495621_0061477_261_998 238
675 3300046692 Ga0495671_0010287 Ga0495671_0010287_2750_3490 238
676 3300048905 Ga0496102_0293251 Ga0496102_0293251_686_1426 238
677 3300048925 Ga0496122_0036940 Ga0496122_0036940_1452_2183 238
678 3300048926 Ga0496123_0006515 Ga0496123_0006515_5884_6615 238
679 3300049569 Ga0501032_0041805 Ga0501032_0041805_221_961 238
680 3300049574 Ga0501038_0095997 Ga0501038_0095997_166_906 238
681 3300049579 Ga0501043_0088867 Ga0501043_0088867_1163_1903 238
682 3300049581 Ga0501047_0426413 Ga0501047_0426413_141_881 238
683 3300049823 Ga0501044_0367971 Ga0501044_0367971_415_1155 238
684 3300005339 Ga0070660_100662229 Ga0070660_1006622291 239
685 3300005366 Ga0070659_100303267 Ga0070659_1003032672 239
686 3300005564 Ga0070664_100370383 Ga0070664_1003703832 239
687 3300013104 Ga0157370_10151912 Ga0157370_101519122 239
688 3300013105 Ga0157369_10087264 Ga0157369_100872642 239
689 3300025917 Ga0207660_10430079 Ga0207660_104300791 239
690 3300025919 Ga0207657_10182101 Ga0207657_101821011 239
691 3300031730 Ga0307516_10025758 Ga0307516_100257585 239
692 3300031911 Ga0307412_10037333 Ga0307412_100373334 239
693 3300032002 Ga0307416_100004229 Ga0307416_1000042294 239
694 3300041509 Ga0451843_1341863 Ga0451843_1341863_11_733 239
695 3300049571 Ga0501034_0028818 Ga0501034_0028818_3697_4428 239
696 3300049571 Ga0501034_0285713 Ga0501034_0285713_25_747 239
697 3300049572 Ga0501036_0004973 Ga0501036_0004973_656_1387 239
698 3300049573 Ga0501037_0024190 Ga0501037_0024190_162_893 239
699 3300049574 Ga0501038_0034942 Ga0501038_0034942_143_874 239
700 3300049580 Ga0501046_0009063 Ga0501046_0009063_14_736 239
701 3300049744 Ga0501083_0144523 Ga0501083_0144523_11_733 239
702 3300049822 Ga0501035_0010515 Ga0501035_0010515_834_1565 239
703 3300049823 Ga0501044_0371265 Ga0501044_0371265_212_934 239
704 iso_pu_bacteria 2643221579 2643907670 240
705 iso_pu_bacteria 2923516293 2923516528 240
706 3300032005 Ga0307411_10041362 Ga0307411_100413624 241
707 3300030733 Ga0314311_1005669 Ga0314311_10056692 243
708 3300032004 Ga0307414_10599618 Ga0307414_105996182 243
709 3300041404 Ga0439436_0086789 Ga0439436_0086789_44_805 243
710 3300049568 Ga0501031_0037656 Ga0501031_0037656_510_1268 243
711 3300049570 Ga0501033_0000847 Ga0501033_0000847_6887_7633 243
712 iso_pu_bacteria 2643221581 2643914067 243
713 2162886007 SwRhRL2b_contig_670719 SwRhRL2b_0519.00003540 244
714 3300005289 Ga0065704_10070599 Ga0065704_1007059912 244
715 3300032004 Ga0307414_10016037 Ga0307414_100160375 244
716 3300049571 Ga0501034_0000980 Ga0501034_0000980_38992_39750 244
717 iso_pu_bacteria 2643221579 2643909208 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

8

174

0.9

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

5

146

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ekp-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.8485 1 194
5eke-assembly1.cif.gz_A structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8481 1 194
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.8358 2 229
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.8023 1 221
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7832 4 229
ID Description Score Start End Superfamily
af_Q8WSL9_63_329_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8562 2 228 3.90.550.10
af_P77293_1_188_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8553 2 181 3.90.550.10
af_K7MVE2_46_307_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8476 1 210 3.90.550.10
af_O60061_43_318_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8429 2 225 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8299 4 220 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A523V6E2-F1-model_v4 Glycosyltransferase 0.9776 2 112 GO:0005886
GO:0016757
AF-A0A7C4KIH1-F1-model_v4 Glycosyltransferase 0.9567 4 113 GO:0005886
GO:0016757
AF-A0A086CFE5-F1-model_v4 Glycosyl transferase 0.9539 2 107 GO:0005886
GO:0016757
AF-A0A2T2RJQ4-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9453 2 227 GO:0005886
GO:0099621
AF-W2D0Y6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9441 1 113 GO:0005886
GO:0016757

Feature Viewer

pLDDT pTM Quality
80.85 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map