F477106
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 717 | 327 | 678 | 241 |
Family's Representative Sequence
| Representative Sequence | 3300025294|Ga0209025_1004726|Ga0209025_10047268 |
| Length | 244 |
| Sequence | MNNTPQLSVVVPVFNERDNVAPLVHEITAALRGRTDFEIVYIDDQSRDDTLQVLQALKAEVPELRVISHVKQSGQSTAVRNGVKAARGEWIATLDGDGQNDPADIPKLLEKRDATAAGEGIKLFAGWRVNRQDSGSKRWASRWANAIRSRMLRDDTPDTGCGIKLFERAAFLELPYFDHMHRYLPALMQRAGWKTVSVPVNHRPRSAGVSKYNNLNRALVGISDLRGVAWLIKRGKVTAVRELS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 5 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 6 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 7 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 8 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 9 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 10 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 11 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 12 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 13 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 14 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 15 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 16 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 17 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 18 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 19 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 20 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 21 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 22 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 23 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 24 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 25 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 26 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 27 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 28 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 29 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 30 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 31 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 32 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 33 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 34 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 35 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 36 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 37 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 38 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 39 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 40 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 41 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 42 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 43 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 47 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 51 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 54 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 76 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 124 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 202 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 203 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 204 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 212 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 215 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 216 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 217 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 218 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 222 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 223 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 224 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 225 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 226 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 228 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 230 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 236 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 237 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 238 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 239 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 240 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 241 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 242 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 243 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 244 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 271 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 272 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 273 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 274 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 275 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 279 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 280 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 281 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 282 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 306 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 312 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 317 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 320 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 321 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 325 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 326 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 327 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.56 |
| Metatranscriptomes | 0 |
| Isolates | 5.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 12.69 |
| Nodule | 0 |
| Rhizoplane | 3.21 |
| Rhizosphere | 71.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_670719 | 2162886007 | Bacteria | 13757 |
| 2 | JGI25152J39213_1000038 | 3300002773 | Bacteria | 91482 |
| 3 | JGI25150J39212_1000853 | 3300002774 | Bacteria | 10154 |
| 4 | JGI25151J46595_10000088 | 3300003187 | Bacteria | 124209 |
| 5 | JGI25151J46595_10000150 | 3300003187 | Bacteria | 91486 |
| 6 | JGI25151J46595_10017285 | 3300003187 | Bacteria | 3132 |
| 7 | JGI25153J46596_10000114 | 3300003215 | Bacteria | 91486 |
| 8 | JGI26145J50221_1001441 | 3300003371 | Bacteria | 1888 |
| 9 | JGI26141J51220_1002698 | 3300003503 | Bacteria | 1084 |
| 10 | Ga0055526_1000004 | 3300003771 | Bacteria | 355037 |
| 11 | Ga0055526_1000814 | 3300003771 | Bacteria | 23259 |
| 12 | Ga0055526_1026191 | 3300003771 | Bacteria | 1847 |
| 13 | Ga0055537_1000242 | 3300003773 | Bacteria | 40009 |
| 14 | Ga0055537_1000989 | 3300003773 | Bacteria | 12883 |
| 15 | Ga0055524_1000004 | 3300003775 | Bacteria | 354710 |
| 16 | Ga0055524_1021838 | 3300003775 | Bacteria | 2108 |
| 17 | Ga0055524_1032910 | 3300003775 | Bacteria | 1460 |
| 18 | Ga0055524_1032988 | 3300003775 | Bacteria | 1457 |
| 19 | Ga0055536_1008305 | 3300003781 | Bacteria | 4485 |
| 20 | Ga0055536_1009780 | 3300003781 | Bacteria | 3911 |
| 21 | Ga0055536_1056115 | 3300003781 | Bacteria | 838 |
| 22 | Ga0055534_1000011 | 3300003784 | Bacteria | 168909 |
| 23 | Ga0055534_1000307 | 3300003784 | Bacteria | 32970 |
| 24 | Ga0055528_1000015 | 3300003790 | Bacteria | 169011 |
| 25 | Ga0055528_1000402 | 3300003790 | Bacteria | 35107 |
| 26 | Ga0055530_10000735 | 3300003791 | Bacteria | 27312 |
| 27 | Ga0055530_10001883 | 3300003791 | Bacteria | 14399 |
| 28 | Ga0055530_10001945 | 3300003791 | Bacteria | 14107 |
| 29 | Ga0055531_10001754 | 3300003794 | Bacteria | 15455 |
| 30 | Ga0055531_10005310 | 3300003794 | Bacteria | 7562 |
| 31 | Ga0055531_10010821 | 3300003794 | Bacteria | 4485 |
| 32 | Ga0055531_10011663 | 3300003794 | Bacteria | 4211 |
| 33 | Ga0055531_10012552 | 3300003794 | Bacteria | 3975 |
| 34 | Ga0055531_10015883 | 3300003794 | Bacteria | 3285 |
| 35 | Ga0055531_10024977 | 3300003794 | Bacteria | 2186 |
| 36 | Ga0058692_1000081 | 3300003856 | Bacteria | 69376 |
| 37 | Ga0065714_10010475 | 3300005288 | Bacteria | 5834 |
| 38 | Ga0065704_10070599 | 3300005289 | Bacteria | 19419 |
| 39 | Ga0065704_10073328 | 3300005289 | Bacteria | 7305 |
| 40 | Ga0065715_10124790 | 3300005293 | Bacteria | 2145 |
| 41 | Ga0065715_10391905 | 3300005293 | Bacteria | 889 |
| 42 | Ga0070683_100471253 | 3300005329 | Bacteria | 1199 |
| 43 | Ga0070670_100003557 | 3300005331 | Bacteria | 12962 |
| 44 | Ga0070670_100081203 | 3300005331 | Bacteria | 2786 |
| 45 | Ga0070670_100093679 | 3300005331 | Bacteria | 2583 |
| 46 | Ga0070670_100194358 | 3300005331 | Bacteria | 1762 |
| 47 | Ga0070666_10000953 | 3300005335 | Bacteria | 17631 |
| 48 | Ga0070666_10119214 | 3300005335 | Bacteria | 1829 |
| 49 | Ga0070666_10221736 | 3300005335 | Bacteria | 1334 |
| 50 | Ga0070682_100077670 | 3300005337 | Bacteria | 2140 |
| 51 | Ga0070660_100061822 | 3300005339 | Bacteria | 2908 |
| 52 | Ga0070660_100281257 | 3300005339 | Bacteria | 1361 |
| 53 | Ga0070660_100662229 | 3300005339 | Bacteria | 874 |
| 54 | Ga0070661_100002100 | 3300005344 | Bacteria | 13716 |
| 55 | Ga0070661_100069955 | 3300005344 | Bacteria | 2580 |
| 56 | Ga0070661_100084608 | 3300005344 | Bacteria | 2343 |
| 57 | Ga0070661_100230344 | 3300005344 | Bacteria | 1424 |
| 58 | Ga0070661_100454405 | 3300005344 | Bacteria | 1019 |
| 59 | Ga0070668_100020594 | 3300005347 | Bacteria | 4978 |
| 60 | Ga0070669_100012531 | 3300005353 | Bacteria | 6014 |
| 61 | Ga0070669_100201861 | 3300005353 | Bacteria | 1565 |
| 62 | Ga0070675_100242239 | 3300005354 | Bacteria | 1576 |
| 63 | Ga0070671_100092317 | 3300005355 | Bacteria | 2536 |
| 64 | Ga0070671_100328878 | 3300005355 | Bacteria | 1303 |
| 65 | Ga0070688_100179863 | 3300005365 | Bacteria | 1466 |
| 66 | Ga0070659_100006373 | 3300005366 | Bacteria | 8523 |
| 67 | Ga0070659_100303267 | 3300005366 | Bacteria | 1332 |
| 68 | Ga0070659_100538480 | 3300005366 | Bacteria | 999 |
| 69 | Ga0070667_100000093 | 3300005367 | Bacteria | 111322 |
| 70 | Ga0070667_100005913 | 3300005367 | Bacteria | 10188 |
| 71 | Ga0070667_100016216 | 3300005367 | Bacteria | 6165 |
| 72 | Ga0070667_100175713 | 3300005367 | Bacteria | 1892 |
| 73 | Ga0070667_100203449 | 3300005367 | Bacteria | 1757 |
| 74 | Ga0070709_10341500 | 3300005434 | Bacteria | 1104 |
| 75 | Ga0070701_10043807 | 3300005438 | Bacteria | 2291 |
| 76 | Ga0070663_100000032 | 3300005455 | Bacteria | 72041 |
| 77 | Ga0070663_100125237 | 3300005455 | Bacteria | 1946 |
| 78 | Ga0070662_100214984 | 3300005457 | Bacteria | 1531 |
| 79 | Ga0070681_10036489 | 3300005458 | Bacteria | 4936 |
| 80 | Ga0068867_100010240 | 3300005459 | Bacteria | 6614 |
| 81 | Ga0070679_100236893 | 3300005530 | Bacteria | 1784 |
| 82 | Ga0070679_100338094 | 3300005530 | Bacteria | 1454 |
| 83 | Ga0070679_100350210 | 3300005530 | Bacteria | 1425 |
| 84 | Ga0070684_100088823 | 3300005535 | Bacteria | 2746 |
| 85 | Ga0068853_100000578 | 3300005539 | Bacteria | 25023 |
| 86 | Ga0068853_100002169 | 3300005539 | Bacteria | 14615 |
| 87 | Ga0068853_100016586 | 3300005539 | Bacteria | 6065 |
| 88 | Ga0068853_100062688 | 3300005539 | Bacteria | 3218 |
| 89 | Ga0068853_100121937 | 3300005539 | Bacteria | 2326 |
| 90 | Ga0068853_100136224 | 3300005539 | Bacteria | 2201 |
| 91 | Ga0070672_100009029 | 3300005543 | Bacteria | 6853 |
| 92 | Ga0070672_100038309 | 3300005543 | Bacteria | 3662 |
| 93 | Ga0070686_100581910 | 3300005544 | Bacteria | 880 |
| 94 | Ga0070693_100018332 | 3300005547 | Bacteria | 3654 |
| 95 | Ga0070693_100042646 | 3300005547 | Bacteria | 2557 |
| 96 | Ga0070665_100000053 | 3300005548 | Bacteria | 244523 |
| 97 | Ga0070665_100006542 | 3300005548 | Bacteria | 11840 |
| 98 | Ga0070665_100077369 | 3300005548 | Bacteria | 3333 |
| 99 | Ga0070665_100363370 | 3300005548 | Bacteria | 1454 |
| 100 | Ga0070665_100562364 | 3300005548 | Bacteria | 1153 |
| 101 | Ga0068855_100001236 | 3300005563 | Bacteria | 31694 |
| 102 | Ga0068855_100069561 | 3300005563 | Bacteria | 4096 |
| 103 | Ga0068855_100118404 | 3300005563 | Bacteria | 3033 |
| 104 | Ga0068855_100404007 | 3300005563 | Bacteria | 1496 |
| 105 | Ga0068855_100915226 | 3300005563 | Bacteria | 926 |
| 106 | Ga0070664_100370383 | 3300005564 | Bacteria | 1306 |
| 107 | Ga0068857_100158515 | 3300005577 | Bacteria | 2053 |
| 108 | Ga0068857_100242262 | 3300005577 | Bacteria | 1651 |
| 109 | Ga0068854_100017640 | 3300005578 | Bacteria | 4779 |
| 110 | Ga0068856_100019245 | 3300005614 | Bacteria | 6627 |
| 111 | Ga0068856_100080678 | 3300005614 | Bacteria | 3227 |
| 112 | Ga0068856_100080681 | 3300005614 | Bacteria | 3227 |
| 113 | Ga0068856_100293279 | 3300005614 | Bacteria | 1643 |
| 114 | Ga0068852_100000604 | 3300005616 | Bacteria | 23570 |
| 115 | Ga0068852_100024631 | 3300005616 | Bacteria | 4867 |
| 116 | Ga0068852_100066615 | 3300005616 | Bacteria | 3145 |
| 117 | Ga0068852_100306075 | 3300005616 | Bacteria | 1540 |
| 118 | Ga0068859_100000070 | 3300005617 | Bacteria | 94311 |
| 119 | Ga0068859_100175296 | 3300005617 | Bacteria | 2226 |
| 120 | Ga0068864_100013257 | 3300005618 | Bacteria | 6828 |
| 121 | Ga0068851_10131766 | 3300005834 | Bacteria | 1353 |
| 122 | Ga0068863_100003508 | 3300005841 | Bacteria | 15478 |
| 123 | Ga0068863_100014341 | 3300005841 | Bacteria | 7632 |
| 124 | Ga0068863_100019413 | 3300005841 | Bacteria | 6501 |
| 125 | Ga0068863_100071823 | 3300005841 | Bacteria | 3274 |
| 126 | Ga0068863_100611658 | 3300005841 | Bacteria | 1079 |
| 127 | Ga0068863_100789514 | 3300005841 | Bacteria | 947 |
| 128 | Ga0068858_100039469 | 3300005842 | Bacteria | 4378 |
| 129 | Ga0068858_100100298 | 3300005842 | Bacteria | 2700 |
| 130 | Ga0068858_100273067 | 3300005842 | Bacteria | 1609 |
| 131 | Ga0068860_100753571 | 3300005843 | Bacteria | 985 |
| 132 | Ga0068862_100000041 | 3300005844 | Bacteria | 166801 |
| 133 | Ga0081455_10462099 | 3300005937 | Bacteria | 864 |
| 134 | Ga0070717_10038092 | 3300006028 | Bacteria | 3907 |
| 135 | Ga0075364_10001168 | 3300006051 | Bacteria | 14075 |
| 136 | Ga0075364_10050400 | 3300006051 | Bacteria | 2717 |
| 137 | Ga0075364_10406993 | 3300006051 | Bacteria | 928 |
| 138 | Ga0097621_100027840 | 3300006237 | Bacteria | 4449 |
| 139 | Ga0097621_100050252 | 3300006237 | Bacteria | 3390 |
| 140 | Ga0097621_100270841 | 3300006237 | Bacteria | 1492 |
| 141 | Ga0097621_100272501 | 3300006237 | Bacteria | 1487 |
| 142 | Ga0068865_100008851 | 3300006881 | Bacteria | 6226 |
| 143 | Ga0068865_100016541 | 3300006881 | Bacteria | 4722 |
| 144 | Ga0097620_100000070 | 3300006931 | Bacteria | 94311 |
| 145 | Ga0097620_100175296 | 3300006931 | Bacteria | 2226 |
| 146 | Ga0105251_10000008 | 3300009011 | Bacteria | 213669 |
| 147 | Ga0105251_10019337 | 3300009011 | Bacteria | 3601 |
| 148 | Ga0105240_10501134 | 3300009093 | Bacteria | 1350 |
| 149 | Ga0105243_10224988 | 3300009148 | Bacteria | 1661 |
| 150 | Ga0105241_10013791 | 3300009174 | Bacteria | 5919 |
| 151 | Ga0105241_10140953 | 3300009174 | Bacteria | 1963 |
| 152 | Ga0105241_10640139 | 3300009174 | Bacteria | 965 |
| 153 | Ga0105248_10000248 | 3300009177 | Bacteria | 62700 |
| 154 | Ga0105248_10225916 | 3300009177 | Bacteria | 2107 |
| 155 | Ga0105237_10054199 | 3300009545 | Bacteria | 4018 |
| 156 | Ga0105237_10166124 | 3300009545 | Bacteria | 2206 |
| 157 | Ga0105237_10233916 | 3300009545 | Bacteria | 1839 |
| 158 | Ga0105238_10011499 | 3300009551 | Bacteria | 8917 |
| 159 | Ga0105238_10034369 | 3300009551 | Bacteria | 5158 |
| 160 | Ga0105238_10089269 | 3300009551 | Bacteria | 3069 |
| 161 | Ga0105249_10000471 | 3300009553 | Bacteria | 37477 |
| 162 | Ga0105249_10222541 | 3300009553 | Bacteria | 1858 |
| 163 | Ga0105239_10001467 | 3300010375 | Bacteria | 31354 |
| 164 | Ga0105239_10001780 | 3300010375 | Bacteria | 28338 |
| 165 | Ga0105239_10007054 | 3300010375 | Bacteria | 12931 |
| 166 | Ga0105239_10028873 | 3300010375 | Bacteria | 6098 |
| 167 | Ga0105239_10080575 | 3300010375 | Bacteria | 3582 |
| 168 | Ga0105239_10396790 | 3300010375 | Bacteria | 1561 |
| 169 | Ga0105239_11210160 | 3300010375 | Bacteria | 871 |
| 170 | Ga0157327_1015868 | 3300012512 | Bacteria | 789 |
| 171 | Ga0157373_10026274 | 3300013100 | Bacteria | 4207 |
| 172 | Ga0157370_10005233 | 3300013104 | Bacteria | 14593 |
| 173 | Ga0157370_10008733 | 3300013104 | Bacteria | 10899 |
| 174 | Ga0157370_10085514 | 3300013104 | Bacteria | 2963 |
| 175 | Ga0157370_10151912 | 3300013104 | Bacteria | 2155 |
| 176 | Ga0157370_10227362 | 3300013104 | Bacteria | 1727 |
| 177 | Ga0157369_10013085 | 3300013105 | Bacteria | 9392 |
| 178 | Ga0157369_10021113 | 3300013105 | Bacteria | 7279 |
| 179 | Ga0157369_10087264 | 3300013105 | Bacteria | 3332 |
| 180 | Ga0157374_10141397 | 3300013296 | Bacteria | 2337 |
| 181 | Ga0157374_10220845 | 3300013296 | Bacteria | 1859 |
| 182 | Ga0157378_10000052 | 3300013297 | Bacteria | 100769 |
| 183 | Ga0157378_10065566 | 3300013297 | Bacteria | 3250 |
| 184 | Ga0163162_10000061 | 3300013306 | Bacteria | 106351 |
| 185 | Ga0163162_10155248 | 3300013306 | Bacteria | 2408 |
| 186 | Ga0163162_10453125 | 3300013306 | Bacteria | 1415 |
| 187 | Ga0163162_10612768 | 3300013306 | Bacteria | 1214 |
| 188 | Ga0157372_10008531 | 3300013307 | Bacteria | 10880 |
| 189 | Ga0157372_10409140 | 3300013307 | Bacteria | 1581 |
| 190 | Ga0157375_10023874 | 3300013308 | Bacteria | 5649 |
| 191 | Ga0157375_10125738 | 3300013308 | Bacteria | 2678 |
| 192 | Ga0157375_10179802 | 3300013308 | Bacteria | 2266 |
| 193 | Ga0163163_10000166 | 3300014325 | Bacteria | 69030 |
| 194 | Ga0163163_10005131 | 3300014325 | Bacteria | 11290 |
| 195 | Ga0163163_10008166 | 3300014325 | Bacteria | 9283 |
| 196 | Ga0157380_10244117 | 3300014326 | Bacteria | 1621 |
| 197 | Ga0182008_10000913 | 3300014497 | Bacteria | 20555 |
| 198 | Ga0157379_10004862 | 3300014968 | Bacteria | 11538 |
| 199 | Ga0157379_10154679 | 3300014968 | Bacteria | 2069 |
| 200 | Ga0157376_10037455 | 3300014969 | Bacteria | 3938 |
| 201 | Ga0157376_10181048 | 3300014969 | Bacteria | 1926 |
| 202 | Ga0182006_1014002 | 3300015261 | Bacteria | 3463 |
| 203 | Ga0182006_1035742 | 3300015261 | Bacteria | 1978 |
| 204 | Ga0182006_1107513 | 3300015261 | Bacteria | 982 |
| 205 | Ga0183360_10004 | 3300015689 | Bacteria | 289992 |
| 206 | Ga0163161_10001958 | 3300017792 | Bacteria | 14979 |
| 207 | Ga0163161_10035692 | 3300017792 | Bacteria | 3559 |
| 208 | Ga0213876_10255700 | 3300021384 | Bacteria | 931 |
| 209 | Ga0207425_1000029 | 3300025245 | Bacteria | 268521 |
| 210 | Ga0209129_1000073 | 3300025258 | Bacteria | 207709 |
| 211 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 212 | Ga0209565_1000113 | 3300025263 | Bacteria | 116343 |
| 213 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 214 | Ga0209673_1000369 | 3300025273 | Bacteria | 81061 |
| 215 | Ga0209673_1023345 | 3300025273 | Bacteria | 2109 |
| 216 | Ga0209130_1030023 | 3300025284 | Bacteria | 1127 |
| 217 | Ga0209130_1039891 | 3300025284 | Bacteria | 912 |
| 218 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 219 | Ga0209675_1000007 | 3300025291 | Bacteria | 683430 |
| 220 | Ga0209675_1022095 | 3300025291 | Bacteria | 1679 |
| 221 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 222 | Ga0209676_1001361 | 3300025292 | Bacteria | 24039 |
| 223 | Ga0209676_1001572 | 3300025292 | Bacteria | 20396 |
| 224 | Ga0209676_1007516 | 3300025292 | Bacteria | 5088 |
| 225 | Ga0209676_1009869 | 3300025292 | Bacteria | 4055 |
| 226 | Ga0209676_1051041 | 3300025292 | Bacteria | 1087 |
| 227 | Ga0209025_1000076 | 3300025294 | Bacteria | 273934 |
| 228 | Ga0209025_1000134 | 3300025294 | Bacteria | 194505 |
| 229 | Ga0209025_1001794 | 3300025294 | Bacteria | 25490 |
| 230 | Ga0209025_1004726 | 3300025294 | Bacteria | 11609 |
| 231 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 232 | Ga0209564_1000333 | 3300025295 | Bacteria | 91663 |
| 233 | Ga0209564_1020240 | 3300025295 | Bacteria | 2446 |
| 234 | Ga0209758_1000112 | 3300025297 | Bacteria | 207640 |
| 235 | Ga0209050_1000396 | 3300025298 | Bacteria | 81559 |
| 236 | Ga0209050_1001391 | 3300025298 | Bacteria | 26316 |
| 237 | Ga0209050_1001430 | 3300025298 | Bacteria | 25721 |
| 238 | Ga0209050_1038936 | 3300025298 | Bacteria | 1347 |
| 239 | Ga0209050_1046199 | 3300025298 | Bacteria | 1146 |
| 240 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 241 | Ga0209256_1002151 | 3300025299 | Bacteria | 17009 |
| 242 | Ga0209256_1002538 | 3300025299 | Bacteria | 14618 |
| 243 | Ga0209256_1005969 | 3300025299 | Bacteria | 6695 |
| 244 | Ga0209256_1006907 | 3300025299 | Bacteria | 5810 |
| 245 | Ga0209256_1009592 | 3300025299 | Bacteria | 4213 |
| 246 | Ga0209051_1000449 | 3300025303 | Bacteria | 54625 |
| 247 | Ga0209051_1032865 | 3300025303 | Bacteria | 1972 |
| 248 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 249 | Ga0209257_1000078 | 3300025304 | Bacteria | 317483 |
| 250 | Ga0209257_1000150 | 3300025304 | Bacteria | 191487 |
| 251 | Ga0209257_1000861 | 3300025304 | Bacteria | 43224 |
| 252 | Ga0209257_1001769 | 3300025304 | Bacteria | 23916 |
| 253 | Ga0209257_1002921 | 3300025304 | Bacteria | 15747 |
| 254 | Ga0209257_1004367 | 3300025304 | Bacteria | 11008 |
| 255 | Ga0209257_1006408 | 3300025304 | Bacteria | 7597 |
| 256 | Ga0209257_1008020 | 3300025304 | Bacteria | 6160 |
| 257 | Ga0207656_10137475 | 3300025321 | Bacteria | 1149 |
| 258 | Ga0207713_1000170 | 3300025735 | Bacteria | 94864 |
| 259 | Ga0207713_1070744 | 3300025735 | Bacteria | 1289 |
| 260 | Ga0207692_10172743 | 3300025898 | Bacteria | 1253 |
| 261 | Ga0207680_10000676 | 3300025903 | Bacteria | 16108 |
| 262 | Ga0207680_10054437 | 3300025903 | Bacteria | 2407 |
| 263 | Ga0207680_10146267 | 3300025903 | Bacteria | 1571 |
| 264 | Ga0207647_10001196 | 3300025904 | Bacteria | 19992 |
| 265 | Ga0207647_10165850 | 3300025904 | Bacteria | 1287 |
| 266 | Ga0207645_10090284 | 3300025907 | Bacteria | 1970 |
| 267 | Ga0207643_10218073 | 3300025908 | Bacteria | 1167 |
| 268 | Ga0207705_10276548 | 3300025909 | Bacteria | 1285 |
| 269 | Ga0207654_10001933 | 3300025911 | Bacteria | 10735 |
| 270 | Ga0207654_10011118 | 3300025911 | Bacteria | 4581 |
| 271 | Ga0207654_10082581 | 3300025911 | Bacteria | 1938 |
| 272 | Ga0207707_10081643 | 3300025912 | Bacteria | 2822 |
| 273 | Ga0207695_10000271 | 3300025913 | Bacteria | 129900 |
| 274 | Ga0207671_10008442 | 3300025914 | Bacteria | 8735 |
| 275 | Ga0207671_10018141 | 3300025914 | Bacteria | 5407 |
| 276 | Ga0207671_10133090 | 3300025914 | Bacteria | 1910 |
| 277 | Ga0207671_10138065 | 3300025914 | Bacteria | 1876 |
| 278 | Ga0207693_10389321 | 3300025915 | Bacteria | 1090 |
| 279 | Ga0207660_10430079 | 3300025917 | Bacteria | 1066 |
| 280 | Ga0207657_10013571 | 3300025919 | Bacteria | 7992 |
| 281 | Ga0207657_10150759 | 3300025919 | Bacteria | 1894 |
| 282 | Ga0207657_10182101 | 3300025919 | Bacteria | 1698 |
| 283 | Ga0207649_10006390 | 3300025920 | Bacteria | 6402 |
| 284 | Ga0207649_10042889 | 3300025920 | Bacteria | 2762 |
| 285 | Ga0207681_10065182 | 3300025923 | Bacteria | 2517 |
| 286 | Ga0207681_10480473 | 3300025923 | Bacteria | 1015 |
| 287 | Ga0207694_10252016 | 3300025924 | Bacteria | 1445 |
| 288 | Ga0207650_10000609 | 3300025925 | Bacteria | 28609 |
| 289 | Ga0207650_10015567 | 3300025925 | Bacteria | 5298 |
| 290 | Ga0207650_10104689 | 3300025925 | Bacteria | 2183 |
| 291 | Ga0207650_10180102 | 3300025925 | Bacteria | 1684 |
| 292 | Ga0207659_10164930 | 3300025926 | Bacteria | 1743 |
| 293 | Ga0207644_10025895 | 3300025931 | Bacteria | 4036 |
| 294 | Ga0207644_10181693 | 3300025931 | Bacteria | 1649 |
| 295 | Ga0207644_10269409 | 3300025931 | Bacteria | 1364 |
| 296 | Ga0207690_10115038 | 3300025932 | Bacteria | 1943 |
| 297 | Ga0207706_10029354 | 3300025933 | Bacteria | 4909 |
| 298 | Ga0207706_10609788 | 3300025933 | Bacteria | 937 |
| 299 | Ga0207686_10551529 | 3300025934 | Bacteria | 901 |
| 300 | Ga0207709_10004956 | 3300025935 | Bacteria | 7620 |
| 301 | Ga0207670_10265562 | 3300025936 | Bacteria | 1332 |
| 302 | Ga0207669_10325524 | 3300025937 | Bacteria | 1178 |
| 303 | Ga0207704_10032344 | 3300025938 | Bacteria | 2959 |
| 304 | Ga0207704_10059125 | 3300025938 | Bacteria | 2364 |
| 305 | Ga0207691_10012595 | 3300025940 | Bacteria | 8107 |
| 306 | Ga0207691_10019964 | 3300025940 | Bacteria | 6339 |
| 307 | Ga0207711_10002210 | 3300025941 | Bacteria | 17471 |
| 308 | Ga0207689_10043389 | 3300025942 | Bacteria | 3718 |
| 309 | Ga0207689_10197427 | 3300025942 | Bacteria | 1661 |
| 310 | Ga0207661_10084178 | 3300025944 | Bacteria | 2633 |
| 311 | Ga0207667_10006642 | 3300025949 | Bacteria | 13979 |
| 312 | Ga0207667_10009259 | 3300025949 | Bacteria | 11628 |
| 313 | Ga0207667_10061270 | 3300025949 | Bacteria | 3936 |
| 314 | Ga0207667_10272394 | 3300025949 | Bacteria | 1730 |
| 315 | Ga0207667_10759167 | 3300025949 | Bacteria | 969 |
| 316 | Ga0207667_11008976 | 3300025949 | Bacteria | 819 |
| 317 | Ga0207651_10151481 | 3300025960 | Bacteria | 1806 |
| 318 | Ga0207712_10000056 | 3300025961 | Bacteria | 143677 |
| 319 | Ga0207712_10243910 | 3300025961 | Bacteria | 1449 |
| 320 | Ga0207668_10135154 | 3300025972 | Bacteria | 1888 |
| 321 | Ga0207668_10222264 | 3300025972 | Bacteria | 1517 |
| 322 | Ga0207640_10017451 | 3300025981 | Bacteria | 4200 |
| 323 | Ga0207640_10508797 | 3300025981 | Bacteria | 1004 |
| 324 | Ga0207658_10000020 | 3300025986 | Bacteria | 202984 |
| 325 | Ga0207658_10003800 | 3300025986 | Bacteria | 10633 |
| 326 | Ga0207658_10049334 | 3300025986 | Bacteria | 3093 |
| 327 | Ga0207658_10322030 | 3300025986 | Bacteria | 1338 |
| 328 | Ga0207658_10679911 | 3300025986 | Bacteria | 929 |
| 329 | Ga0207703_10322997 | 3300026035 | Bacteria | 1414 |
| 330 | Ga0207703_10521670 | 3300026035 | Bacteria | 1117 |
| 331 | Ga0207639_10001658 | 3300026041 | Bacteria | 15005 |
| 332 | Ga0207639_10002592 | 3300026041 | Bacteria | 12131 |
| 333 | Ga0207639_10004818 | 3300026041 | Bacteria | 9101 |
| 334 | Ga0207639_10005192 | 3300026041 | Bacteria | 8786 |
| 335 | Ga0207639_10010298 | 3300026041 | Bacteria | 6471 |
| 336 | Ga0207639_10011899 | 3300026041 | Bacteria | 6053 |
| 337 | Ga0207639_10057786 | 3300026041 | Bacteria | 2981 |
| 338 | Ga0207639_10099933 | 3300026041 | Bacteria | 2342 |
| 339 | Ga0207678_10000010 | 3300026067 | Bacteria | 149258 |
| 340 | Ga0207702_10002211 | 3300026078 | Bacteria | 18639 |
| 341 | Ga0207702_10006391 | 3300026078 | Bacteria | 10169 |
| 342 | Ga0207641_10006298 | 3300026088 | Bacteria | 10033 |
| 343 | Ga0207641_10018733 | 3300026088 | Bacteria | 5676 |
| 344 | Ga0207641_10023027 | 3300026088 | Bacteria | 5131 |
| 345 | Ga0207648_10002984 | 3300026089 | Bacteria | 17884 |
| 346 | Ga0207676_10032827 | 3300026095 | Bacteria | 3916 |
| 347 | Ga0207676_10556158 | 3300026095 | Bacteria | 1097 |
| 348 | Ga0207674_10072246 | 3300026116 | Bacteria | 3466 |
| 349 | Ga0207674_10231187 | 3300026116 | Bacteria | 1797 |
| 350 | Ga0207675_100627883 | 3300026118 | Bacteria | 1079 |
| 351 | Ga0207698_10043287 | 3300026142 | Bacteria | 3372 |
| 352 | Ga0207698_10158227 | 3300026142 | Bacteria | 1977 |
| 353 | Ga0207698_10169888 | 3300026142 | Bacteria | 1918 |
| 354 | Ga0207698_10332243 | 3300026142 | Bacteria | 1428 |
| 355 | Ga0207698_10441865 | 3300026142 | Bacteria | 1253 |
| 356 | Ga0207698_10614220 | 3300026142 | Bacteria | 1073 |
| 357 | Ga0209371_1000235 | 3300027312 | Bacteria | 69492 |
| 358 | Ga0209967_1012379 | 3300027364 | Bacteria | 1205 |
| 359 | Ga0209984_1001378 | 3300027424 | Bacteria | 2631 |
| 360 | Ga0210000_1011804 | 3300027462 | Bacteria | 1296 |
| 361 | Ga0209999_1004979 | 3300027543 | Bacteria | 2392 |
| 362 | Ga0209982_1002346 | 3300027552 | Bacteria | 2661 |
| 363 | Ga0209983_1000709 | 3300027665 | Bacteria | 7199 |
| 364 | Ga0209971_1001818 | 3300027682 | Bacteria | 5224 |
| 365 | Ga0209974_10005300 | 3300027876 | Bacteria | 4546 |
| 366 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 367 | Ga0268266_10024141 | 3300028379 | Bacteria | 5173 |
| 368 | Ga0268266_10096108 | 3300028379 | Bacteria | 2603 |
| 369 | Ga0268266_10248270 | 3300028379 | Bacteria | 1645 |
| 370 | Ga0268266_10278713 | 3300028379 | Bacteria | 1554 |
| 371 | Ga0268266_10437231 | 3300028379 | Bacteria | 1242 |
| 372 | Ga0268266_10459412 | 3300028379 | Bacteria | 1211 |
| 373 | Ga0268265_10000137 | 3300028380 | Bacteria | 93389 |
| 374 | Ga0268264_10060987 | 3300028381 | Bacteria | 3162 |
| 375 | Ga0268264_10371381 | 3300028381 | Bacteria | 1367 |
| 376 | Ga0268256_1000196 | 3300030500 | Bacteria | 69428 |
| 377 | Ga0314311_1005669 | 3300030733 | Bacteria | 2954 |
| 378 | Ga0314311_1183412 | 3300030733 | Bacteria | 3758 |
| 379 | Ga0316180_1048768 | 3300030736 | Bacteria | 1100 |
| 380 | Ga0316183_1047328 | 3300030742 | Bacteria | 4007 |
| 381 | Ga0316182_1226196 | 3300030745 | Bacteria | 2334 |
| 382 | Ga0307513_10018587 | 3300031456 | Bacteria | 8299 |
| 383 | Ga0307408_100056242 | 3300031548 | Bacteria | 2852 |
| 384 | Ga0307408_100757408 | 3300031548 | Bacteria | 878 |
| 385 | Ga0307516_10025758 | 3300031730 | Bacteria | 5984 |
| 386 | Ga0307516_10159177 | 3300031730 | Bacteria | 2010 |
| 387 | Ga0307516_10169553 | 3300031730 | Bacteria | 1924 |
| 388 | Ga0307405_10128201 | 3300031731 | Bacteria | 1748 |
| 389 | Ga0307413_10087760 | 3300031824 | Bacteria | 2016 |
| 390 | Ga0307406_10014708 | 3300031901 | Bacteria | 4507 |
| 391 | Ga0307406_10357102 | 3300031901 | Bacteria | 1144 |
| 392 | Ga0307407_10040952 | 3300031903 | Bacteria | 2587 |
| 393 | Ga0307412_10037333 | 3300031911 | Bacteria | 3121 |
| 394 | Ga0307412_10070648 | 3300031911 | Bacteria | 2381 |
| 395 | Ga0307416_100004229 | 3300032002 | Bacteria | 8619 |
| 396 | Ga0307416_100206007 | 3300032002 | Bacteria | 1871 |
| 397 | Ga0307416_100250679 | 3300032002 | Bacteria | 1723 |
| 398 | Ga0307414_10000159 | 3300032004 | Bacteria | 45131 |
| 399 | Ga0307414_10000490 | 3300032004 | Bacteria | 20605 |
| 400 | Ga0307414_10016037 | 3300032004 | Bacteria | 4542 |
| 401 | Ga0307414_10059038 | 3300032004 | Bacteria | 2706 |
| 402 | Ga0307414_10119791 | 3300032004 | Bacteria | 2021 |
| 403 | Ga0307414_10226360 | 3300032004 | Bacteria | 1539 |
| 404 | Ga0307414_10258799 | 3300032004 | Bacteria | 1451 |
| 405 | Ga0307414_10505221 | 3300032004 | Bacteria | 1070 |
| 406 | Ga0307414_10599618 | 3300032004 | Bacteria | 987 |
| 407 | Ga0307411_10041362 | 3300032005 | Bacteria | 2932 |
| 408 | Ga0307411_10063599 | 3300032005 | Bacteria | 2466 |
| 409 | Ga0307411_10204749 | 3300032005 | Bacteria | 1518 |
| 410 | Ga0307411_10242391 | 3300032005 | Bacteria | 1412 |
| 411 | Ga0307411_10257994 | 3300032005 | Bacteria | 1375 |
| 412 | Ga0307415_100340659 | 3300032126 | Bacteria | 1258 |
| 413 | Ga0307507_10077351 | 3300033179 | Bacteria | 2960 |
| 414 | Ga0395899_0153258 | 3300037312 | Bacteria | 1632 |
| 415 | Ga0395899_0234970 | 3300037312 | Bacteria | 1264 |
| 416 | Ga0395900_0051479 | 3300037418 | Bacteria | 4242 |
| 417 | Ga0395900_0156442 | 3300037418 | Bacteria | 2328 |
| 418 | Ga0395905_0001151 | 3300037471 | Bacteria | 33114 |
| 419 | Ga0395905_0092352 | 3300037471 | Bacteria | 2838 |
| 420 | Ga0395905_0158891 | 3300037471 | Bacteria | 2125 |
| 421 | Ga0395905_0667218 | 3300037471 | Bacteria | 942 |
| 422 | Ga0237819_00408 | 3300038705 | Bacteria | 14905 |
| 423 | Ga0237816_02319 | 3300039145 | Bacteria | 1467 |
| 424 | Ga0439436_0001101 | 3300041404 | Bacteria | 7628 |
| 425 | Ga0439436_0038342 | 3300041404 | Bacteria | 1378 |
| 426 | Ga0439436_0086789 | 3300041404 | Bacteria | 871 |
| 427 | Ga0439439_0007220 | 3300041406 | Bacteria | 2593 |
| 428 | Ga0439439_0060223 | 3300041406 | Bacteria | 1007 |
| 429 | Ga0439465_0038820 | 3300041413 | Bacteria | 1535 |
| 430 | Ga0451791_0128905 | 3300041451 | Bacteria | 2050 |
| 431 | Ga0451791_0620911 | 3300041451 | Bacteria | 1176 |
| 432 | Ga0451791_0870286 | 3300041451 | Bacteria | 1567 |
| 433 | Ga0451791_1795432 | 3300041451 | Bacteria | 5383 |
| 434 | Ga0451793_0075781 | 3300041452 | Bacteria | 2398 |
| 435 | Ga0451793_1030055 | 3300041452 | Bacteria | 2337 |
| 436 | Ga0451793_1174458 | 3300041452 | Bacteria | 4482 |
| 437 | Ga0451793_1737054 | 3300041452 | Bacteria | 1499 |
| 438 | Ga0451797_0255695 | 3300041453 | Bacteria | 1010 |
| 439 | Ga0451797_0356747 | 3300041453 | Bacteria | 1207 |
| 440 | Ga0451795_1325393 | 3300041456 | Bacteria | 965 |
| 441 | Ga0451800_0052513 | 3300041459 | Bacteria | 828 |
| 442 | Ga0451800_0176271 | 3300041459 | Bacteria | 6708 |
| 443 | Ga0451802_1780811 | 3300041460 | Bacteria | 3457 |
| 444 | Ga0451806_243563 | 3300041462 | Bacteria | 6519 |
| 445 | Ga0451804_0548075 | 3300041463 | Bacteria | 3037 |
| 446 | Ga0451807_0148046 | 3300041486 | Bacteria | 1197 |
| 447 | Ga0451807_1481108 | 3300041486 | Bacteria | 4891 |
| 448 | Ga0451833_1391529 | 3300041491 | Bacteria | 1332 |
| 449 | Ga0451837_0148912 | 3300041494 | Bacteria | 2380 |
| 450 | Ga0451837_1187473 | 3300041494 | Bacteria | 2013 |
| 451 | Ga0451839_0733957 | 3300041496 | Bacteria | 1220 |
| 452 | Ga0451843_1336202 | 3300041509 | Bacteria | 1298 |
| 453 | Ga0451843_1341863 | 3300041509 | Bacteria | 1050 |
| 454 | Ga0451853_3320709 | 3300041512 | Bacteria | 1143 |
| 455 | Ga0439445_0001895 | 3300042004 | Bacteria | 4612 |
| 456 | Ga0439432_002495 | 3300042006 | Bacteria | 6931 |
| 457 | Ga0439432_012529 | 3300042006 | Bacteria | 2899 |
| 458 | Ga0439449_0000005 | 3300042007 | Bacteria | 81904 |
| 459 | Ga0439449_0003367 | 3300042007 | Bacteria | 6228 |
| 460 | Ga0439449_0013350 | 3300042007 | Bacteria | 3090 |
| 461 | Ga0439449_0018213 | 3300042007 | Bacteria | 2635 |
| 462 | Ga0439449_0035650 | 3300042007 | Bacteria | 1851 |
| 463 | Ga0439449_0054170 | 3300042007 | Bacteria | 1482 |
| 464 | Ga0439452_054468 | 3300042010 | Bacteria | 908 |
| 465 | Ga0439457_026647 | 3300042014 | Bacteria | 1280 |
| 466 | Ga0466972_0000334 | 3300044658 | Bacteria | 26111 |
| 467 | Ga0466970_0007051 | 3300044765 | Bacteria | 5621 |
| 468 | Ga0495592_0314056 | 3300046454 | Bacteria | 1015 |
| 469 | Ga0495629_0176417 | 3300046459 | Bacteria | 1482 |
| 470 | Ga0495638_0002595 | 3300046460 | Bacteria | 14586 |
| 471 | Ga0495638_0073120 | 3300046460 | Bacteria | 2093 |
| 472 | Ga0495605_0072431 | 3300046474 | Bacteria | 1625 |
| 473 | Ga0495607_0046027 | 3300046501 | Bacteria | 2564 |
| 474 | Ga0495606_0054020 | 3300046507 | Bacteria | 2603 |
| 475 | Ga0495610_0003711 | 3300046512 | Bacteria | 11700 |
| 476 | Ga0495610_0061976 | 3300046512 | Bacteria | 1775 |
| 477 | Ga0495631_0008855 | 3300046518 | Bacteria | 5052 |
| 478 | Ga0495643_0001375 | 3300046522 | Bacteria | 22762 |
| 479 | Ga0495663_0029743 | 3300046525 | Bacteria | 1614 |
| 480 | Ga0495663_0089770 | 3300046525 | Bacteria | 1000 |
| 481 | Ga0495598_0015241 | 3300046537 | Bacteria | 1937 |
| 482 | Ga0495621_0000496 | 3300046539 | Bacteria | 9722 |
| 483 | Ga0495621_0061477 | 3300046539 | Bacteria | 1364 |
| 484 | Ga0495633_0012995 | 3300046558 | Bacteria | 4405 |
| 485 | Ga0495633_0028608 | 3300046558 | Bacteria | 2714 |
| 486 | Ga0495625_0079320 | 3300046660 | Bacteria | 2289 |
| 487 | Ga0495659_0051771 | 3300046664 | Bacteria | 1496 |
| 488 | Ga0495671_0010287 | 3300046692 | Bacteria | 5194 |
| 489 | Ga0495636_0000147 | 3300047318 | Bacteria | 28119 |
| 490 | Ga0495636_0016257 | 3300047318 | Bacteria | 2971 |
| 491 | Ga0495672_0001550 | 3300047320 | Bacteria | 22485 |
| 492 | Ga0495680_0214891 | 3300047322 | Bacteria | 1375 |
| 493 | Ga0495686_0020416 | 3300047472 | Bacteria | 4417 |
| 494 | Ga0495686_0039504 | 3300047472 | Bacteria | 3013 |
| 495 | Ga0496101_0233150 | 3300048904 | Bacteria | 1431 |
| 496 | Ga0496102_0293251 | 3300048905 | Bacteria | 1533 |
| 497 | Ga0496108_0217980 | 3300048911 | Bacteria | 1658 |
| 498 | Ga0496108_0446075 | 3300048911 | Bacteria | 1130 |
| 499 | Ga0496115_0000002 | 3300048918 | Bacteria | 365286 |
| 500 | Ga0496116_0039520 | 3300048919 | Bacteria | 3261 |
| 501 | Ga0496116_0153685 | 3300048919 | Bacteria | 1274 |
| 502 | Ga0496117_0002512 | 3300048920 | Bacteria | 22989 |
| 503 | Ga0496117_0002847 | 3300048920 | Bacteria | 21034 |
| 504 | Ga0496117_0003923 | 3300048920 | Bacteria | 16846 |
| 505 | Ga0496117_0033222 | 3300048920 | Bacteria | 3904 |
| 506 | Ga0496117_0085654 | 3300048920 | Bacteria | 2050 |
| 507 | Ga0496118_0000065 | 3300048921 | Bacteria | 211750 |
| 508 | Ga0496118_0000183 | 3300048921 | Bacteria | 110206 |
| 509 | Ga0496118_0003155 | 3300048921 | Bacteria | 21078 |
| 510 | Ga0496118_0004179 | 3300048921 | Bacteria | 17387 |
| 511 | Ga0496118_0027139 | 3300048921 | Bacteria | 4854 |
| 512 | Ga0496118_0111948 | 3300048921 | Bacteria | 1808 |
| 513 | Ga0496118_0181823 | 3300048921 | Bacteria | 1269 |
| 514 | Ga0496119_0000787 | 3300048922 | Bacteria | 42365 |
| 515 | Ga0496119_0005545 | 3300048922 | Bacteria | 12020 |
| 516 | Ga0496120_0000776 | 3300048923 | Bacteria | 46146 |
| 517 | Ga0496120_0001660 | 3300048923 | Bacteria | 25701 |
| 518 | Ga0496121_0009225 | 3300048924 | Bacteria | 11395 |
| 519 | Ga0496121_0042488 | 3300048924 | Bacteria | 3953 |
| 520 | Ga0496121_0095925 | 3300048924 | Bacteria | 2303 |
| 521 | Ga0496122_0000037 | 3300048925 | Bacteria | 304495 |
| 522 | Ga0496122_0000355 | 3300048925 | Bacteria | 98786 |
| 523 | Ga0496122_0000361 | 3300048925 | Bacteria | 97861 |
| 524 | Ga0496122_0036940 | 3300048925 | Bacteria | 3941 |
| 525 | Ga0496122_0080025 | 3300048925 | Bacteria | 2280 |
| 526 | Ga0496122_0143733 | 3300048925 | Bacteria | 1487 |
| 527 | Ga0496123_0000167 | 3300048926 | Bacteria | 131151 |
| 528 | Ga0496123_0001332 | 3300048926 | Bacteria | 34880 |
| 529 | Ga0496123_0002053 | 3300048926 | Bacteria | 25986 |
| 530 | Ga0496123_0006515 | 3300048926 | Bacteria | 11286 |
| 531 | Ga0496123_0051202 | 3300048926 | Bacteria | 2751 |
| 532 | Ga0496123_0128526 | 3300048926 | Bacteria | 1409 |
| 533 | Ga0496123_0200952 | 3300048926 | Bacteria | 1021 |
| 534 | Ga0496124_0000018 | 3300048927 | Bacteria | 442940 |
| 535 | Ga0496124_0002453 | 3300048927 | Bacteria | 24263 |
| 536 | Ga0496124_0003077 | 3300048927 | Bacteria | 20780 |
| 537 | Ga0496124_0031164 | 3300048927 | Bacteria | 4723 |
| 538 | Ga0496124_0057662 | 3300048927 | Bacteria | 3271 |
| 539 | Ga0496124_0064200 | 3300048927 | Bacteria | 3066 |
| 540 | Ga0496124_0118670 | 3300048927 | Bacteria | 2117 |
| 541 | Ga0496125_0000486 | 3300048928 | Bacteria | 69727 |
| 542 | Ga0496125_0028711 | 3300048928 | Bacteria | 5016 |
| 543 | Ga0496125_0030723 | 3300048928 | Bacteria | 4799 |
| 544 | Ga0496125_0047889 | 3300048928 | Bacteria | 3569 |
| 545 | Ga0496125_0049149 | 3300048928 | Bacteria | 3508 |
| 546 | Ga0496125_0356871 | 3300048928 | Bacteria | 871 |
| 547 | Ga0496126_0000052 | 3300048929 | Bacteria | 312383 |
| 548 | Ga0496126_0002494 | 3300048929 | Bacteria | 24732 |
| 549 | Ga0496126_0119312 | 3300048929 | Bacteria | 2289 |
| 550 | Ga0501031_0005216 | 3300049568 | Bacteria | 8469 |
| 551 | Ga0501031_0019030 | 3300049568 | Bacteria | 4471 |
| 552 | Ga0501031_0037656 | 3300049568 | Bacteria | 3157 |
| 553 | Ga0501032_0000210 | 3300049569 | Bacteria | 48794 |
| 554 | Ga0501032_0017490 | 3300049569 | Bacteria | 5034 |
| 555 | Ga0501032_0041805 | 3300049569 | Bacteria | 3111 |
| 556 | Ga0501032_0124583 | 3300049569 | Bacteria | 1702 |
| 557 | Ga0501032_0270441 | 3300049569 | Bacteria | 1101 |
| 558 | Ga0501033_0000847 | 3300049570 | Bacteria | 27913 |
| 559 | Ga0501033_0002201 | 3300049570 | Bacteria | 16827 |
| 560 | Ga0501033_0002803 | 3300049570 | Bacteria | 14585 |
| 561 | Ga0501034_0000980 | 3300049571 | Bacteria | 41015 |
| 562 | Ga0501034_0002412 | 3300049571 | Bacteria | 22627 |
| 563 | Ga0501034_0006726 | 3300049571 | Bacteria | 12316 |
| 564 | Ga0501034_0020750 | 3300049571 | Bacteria | 6705 |
| 565 | Ga0501034_0028818 | 3300049571 | Bacteria | 5648 |
| 566 | Ga0501034_0031232 | 3300049571 | Bacteria | 5411 |
| 567 | Ga0501034_0038655 | 3300049571 | Bacteria | 4832 |
| 568 | Ga0501034_0131898 | 3300049571 | Bacteria | 2481 |
| 569 | Ga0501034_0285713 | 3300049571 | Bacteria | 1589 |
| 570 | Ga0501034_0382400 | 3300049571 | Bacteria | 1332 |
| 571 | Ga0501036_0002348 | 3300049572 | Bacteria | 14795 |
| 572 | Ga0501036_0004079 | 3300049572 | Bacteria | 11751 |
| 573 | Ga0501036_0004973 | 3300049572 | Bacteria | 10748 |
| 574 | Ga0501036_0008356 | 3300049572 | Bacteria | 8483 |
| 575 | Ga0501036_0164595 | 3300049572 | Bacteria | 1869 |
| 576 | Ga0501037_0006826 | 3300049573 | Bacteria | 8341 |
| 577 | Ga0501037_0015960 | 3300049573 | Bacteria | 5528 |
| 578 | Ga0501037_0024190 | 3300049573 | Bacteria | 4491 |
| 579 | Ga0501038_0002683 | 3300049574 | Bacteria | 16602 |
| 580 | Ga0501038_0003333 | 3300049574 | Bacteria | 14977 |
| 581 | Ga0501038_0017012 | 3300049574 | Bacteria | 6578 |
| 582 | Ga0501038_0034942 | 3300049574 | Bacteria | 4417 |
| 583 | Ga0501038_0080555 | 3300049574 | Bacteria | 2745 |
| 584 | Ga0501038_0095997 | 3300049574 | Bacteria | 2475 |
| 585 | Ga0501039_0051215 | 3300049575 | Bacteria | 3195 |
| 586 | Ga0501040_0015264 | 3300049576 | Bacteria | 5077 |
| 587 | Ga0501042_0021090 | 3300049578 | Bacteria | 4537 |
| 588 | Ga0501042_0168165 | 3300049578 | Bacteria | 1582 |
| 589 | Ga0501043_0001996 | 3300049579 | Bacteria | 17412 |
| 590 | Ga0501043_0002614 | 3300049579 | Bacteria | 15190 |
| 591 | Ga0501043_0061548 | 3300049579 | Bacteria | 2948 |
| 592 | Ga0501043_0070939 | 3300049579 | Bacteria | 2736 |
| 593 | Ga0501043_0088867 | 3300049579 | Bacteria | 2428 |
| 594 | Ga0501043_0106581 | 3300049579 | Bacteria | 2201 |
| 595 | Ga0501043_0463120 | 3300049579 | Bacteria | 951 |
| 596 | Ga0501046_0000871 | 3300049580 | Bacteria | 29395 |
| 597 | Ga0501046_0009063 | 3300049580 | Bacteria | 8627 |
| 598 | Ga0501046_0121760 | 3300049580 | Bacteria | 1984 |
| 599 | Ga0501046_0194316 | 3300049580 | Bacteria | 1512 |
| 600 | Ga0501046_0314740 | 3300049580 | Bacteria | 1141 |
| 601 | Ga0501046_0413873 | 3300049580 | Bacteria | 972 |
| 602 | Ga0501047_0005436 | 3300049581 | Bacteria | 11984 |
| 603 | Ga0501047_0007253 | 3300049581 | Bacteria | 10421 |
| 604 | Ga0501047_0030303 | 3300049581 | Bacteria | 5216 |
| 605 | Ga0501047_0039255 | 3300049581 | Bacteria | 4580 |
| 606 | Ga0501047_0054618 | 3300049581 | Bacteria | 3863 |
| 607 | Ga0501047_0426413 | 3300049581 | Bacteria | 1157 |
| 608 | Ga0501048_0003611 | 3300049582 | Bacteria | 11784 |
| 609 | Ga0501048_0309593 | 3300049582 | Bacteria | 1124 |
| 610 | Ga0501067_0000786 | 3300049583 | Bacteria | 17094 |
| 611 | Ga0501067_0009081 | 3300049583 | Bacteria | 5505 |
| 612 | Ga0501068_0079848 | 3300049584 | Bacteria | 2006 |
| 613 | Ga0501069_0002420 | 3300049585 | Bacteria | 9490 |
| 614 | Ga0501069_0003626 | 3300049585 | Bacteria | 7948 |
| 615 | Ga0501069_0266661 | 3300049585 | Bacteria | 1000 |
| 616 | Ga0501070_0007151 | 3300049586 | Bacteria | 9485 |
| 617 | Ga0501070_0039775 | 3300049586 | Bacteria | 3921 |
| 618 | Ga0501070_0040947 | 3300049586 | Bacteria | 3860 |
| 619 | Ga0501070_0060336 | 3300049586 | Bacteria | 3143 |
| 620 | Ga0501070_0092389 | 3300049586 | Bacteria | 2504 |
| 621 | Ga0501070_0100374 | 3300049586 | Bacteria | 2394 |
| 622 | Ga0501070_0301078 | 3300049586 | Bacteria | 1306 |
| 623 | Ga0501071_0018515 | 3300049587 | Bacteria | 4823 |
| 624 | Ga0501072_0001140 | 3300049588 | Bacteria | 19734 |
| 625 | Ga0501072_0346866 | 3300049588 | Bacteria | 1179 |
| 626 | Ga0501073_0002336 | 3300049589 | Bacteria | 14198 |
| 627 | Ga0501073_0007516 | 3300049589 | Bacteria | 8095 |
| 628 | Ga0501073_0008635 | 3300049589 | Bacteria | 7547 |
| 629 | Ga0501073_0041334 | 3300049589 | Bacteria | 3257 |
| 630 | Ga0501073_0382545 | 3300049589 | Bacteria | 972 |
| 631 | Ga0501074_0002549 | 3300049590 | Bacteria | 12713 |
| 632 | Ga0501074_0011395 | 3300049590 | Bacteria | 6464 |
| 633 | Ga0501074_0075819 | 3300049590 | Bacteria | 2414 |
| 634 | Ga0501074_0076261 | 3300049590 | Bacteria | 2406 |
| 635 | Ga0501074_0231646 | 3300049590 | Bacteria | 1315 |
| 636 | Ga0501074_0266826 | 3300049590 | Bacteria | 1217 |
| 637 | Ga0501076_0074408 | 3300049592 | Bacteria | 2721 |
| 638 | Ga0501076_0694092 | 3300049592 | Bacteria | 840 |
| 639 | Ga0501202_008710 | 3300049652 | Bacteria | 1854 |
| 640 | Ga0501202_053011 | 3300049652 | Bacteria | 902 |
| 641 | Ga0501225_0002360 | 3300049705 | Bacteria | 5817 |
| 642 | Ga0501079_0054572 | 3300049741 | Bacteria | 3082 |
| 643 | Ga0501080_0001127 | 3300049742 | Bacteria | 21983 |
| 644 | Ga0501080_0022902 | 3300049742 | Bacteria | 5790 |
| 645 | Ga0501080_0052468 | 3300049742 | Bacteria | 3795 |
| 646 | Ga0501080_0192926 | 3300049742 | Bacteria | 1872 |
| 647 | Ga0501080_0338260 | 3300049742 | Bacteria | 1360 |
| 648 | Ga0501081_0017691 | 3300049743 | Bacteria | 4723 |
| 649 | Ga0501083_0009033 | 3300049744 | Bacteria | 7035 |
| 650 | Ga0501083_0056170 | 3300049744 | Bacteria | 2638 |
| 651 | Ga0501083_0144523 | 3300049744 | Bacteria | 1557 |
| 652 | Ga0501265_001084 | 3300049762 | Bacteria | 3064 |
| 653 | Ga0501275_000135 | 3300049772 | Bacteria | 8249 |
| 654 | Ga0501035_0001149 | 3300049822 | Bacteria | 27646 |
| 655 | Ga0501035_0010515 | 3300049822 | Bacteria | 8575 |
| 656 | Ga0501035_0149214 | 3300049822 | Bacteria | 2029 |
| 657 | Ga0501044_0003431 | 3300049823 | Bacteria | 17868 |
| 658 | Ga0501044_0034792 | 3300049823 | Bacteria | 5280 |
| 659 | Ga0501044_0228605 | 3300049823 | Bacteria | 1808 |
| 660 | Ga0501044_0269086 | 3300049823 | Bacteria | 1640 |
| 661 | Ga0501044_0367971 | 3300049823 | Bacteria | 1354 |
| 662 | Ga0501044_0371265 | 3300049823 | Bacteria | 1347 |
| 663 | Ga0501045_0009388 | 3300049824 | Bacteria | 6840 |
| 664 | Ga0501045_0245086 | 3300049824 | Bacteria | 1334 |
| 665 | nmdc:mga00v17_108907_c1 | 3300050491 | Bacteria | 1756 |
| 666 | nmdc:mga00v17_200_c1 | 3300050491 | Bacteria | 36047 |
| 667 | Ga0500643_003586 | 3300053087 | Bacteria | 7386 |
| 668 | Ga0500651_0000297 | 3300053093 | Bacteria | 28799 |
| 669 | Ga0500651_0004553 | 3300053093 | Bacteria | 7782 |
| 670 | Ga0500597_000205 | 3300053120 | Bacteria | 12176 |
| 671 | Ga0500568_0003667 | 3300053139 | Bacteria | 8441 |
| 672 | Ga0500634_0000582 | 3300053161 | Bacteria | 12119 |
| 673 | Ga0501084_0028932 | 3300054114 | Bacteria | 4632 |
| 674 | Ga0501084_0036845 | 3300054114 | Bacteria | 4087 |
| 675 | Ga0501082_0000728 | 3300060353 | Bacteria | 28982 |
| 676 | Ga0501082_0043533 | 3300060353 | Bacteria | 3871 |
| 677 | Ga0501082_0114854 | 3300060353 | Bacteria | 2331 |
| 678 | Ga0501082_0129723 | 3300060353 | Bacteria | 2187 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042010 | Ga0439452_054468 | Ga0439452_054468_220_891 | 219 |
| 2 | 3300041406 | Ga0439439_0007220 | Ga0439439_0007220_199_900 | 223 |
| 3 | 3300042014 | Ga0439457_026647 | Ga0439457_026647_92_793 | 223 |
| 4 | 3300042007 | Ga0439449_0013350 | Ga0439449_0013350_1190_1891 | 231 |
| 5 | 3300031824 | Ga0307413_10087760 | Ga0307413_100877601 | 232 |
| 6 | 3300032004 | Ga0307414_10000159 | Ga0307414_1000015918 | 235 |
| 7 | 3300041452 | Ga0451793_1030055 | Ga0451793_1030055_736_1452 | 235 |
| 8 | 3300041453 | Ga0451797_0255695 | Ga0451797_0255695_119_835 | 235 |
| 9 | 3300003794 | Ga0055531_10001754 | Ga0055531_100017545 | 236 |
| 10 | 3300021384 | Ga0213876_10255700 | Ga0213876_102557002 | 236 |
| 11 | 3300025304 | Ga0209257_1000078 | Ga0209257_100007845 | 236 |
| 12 | 3300028379 | Ga0268266_10096108 | Ga0268266_100961083 | 236 |
| 13 | 3300037471 | Ga0395905_0667218 | Ga0395905_0667218_13_738 | 236 |
| 14 | 3300041451 | Ga0451791_0870286 | Ga0451791_0870286_494_1288 | 236 |
| 15 | 3300041451 | Ga0451791_1795432 | Ga0451791_1795432_3308_4105 | 236 |
| 16 | 3300041452 | Ga0451793_1737054 | Ga0451793_1737054_355_1149 | 236 |
| 17 | 3300041460 | Ga0451802_1780811 | Ga0451802_1780811_461_1255 | 236 |
| 18 | 3300041512 | Ga0451853_3320709 | Ga0451853_3320709_264_1058 | 236 |
| 19 | 3300047318 | Ga0495636_0016257 | Ga0495636_0016257_356_1078 | 236 |
| 20 | iso_pu_bacteria | 2576861471 | 2578456407 | 236 |
| 21 | iso_pu_bacteria | 2747842501 | 2748019912 | 236 |
| 22 | iso_pu_bacteria | 2818991457 | 2819661826 | 236 |
| 23 | iso_pu_bacteria | 2842757796 | 2842761238 | 236 |
| 24 | iso_pu_bacteria | 2842780639 | 2842781495 | 236 |
| 25 | iso_pu_bacteria | 2852649853 | 2852651655 | 236 |
| 26 | iso_pu_bacteria | 2852684882 | 2852688490 | 236 |
| 27 | iso_pu_bacteria | 2919130084 | 2919133873 | 236 |
| 28 | iso_pu_bacteria | 2929195423 | 2929199837 | 236 |
| 29 | iso_pu_bacteria | 2939589442 | 2939590351 | 236 |
| 30 | iso_pu_bacteria | 2939622612 | 2939626563 | 236 |
| 31 | iso_pu_bacteria | 2974307012 | 2974307069 | 236 |
| 32 | iso_pu_bacteria | 2977247770 | 2977247813 | 236 |
| 33 | iso_pu_bacteria | 2984514374 | 2984517730 | 236 |
| 34 | iso_pu_bacteria | 2987605356 | 2987606912 | 236 |
| 35 | iso_pu_bacteria | 8021622325 | 8021622975 | 236 |
| 36 | iso_pu_bacteria | 8021626552 | 8021629091 | 236 |
| 37 | iso_pu_bacteria | 8021648035 | 8021651201 | 236 |
| 38 | 3300002773 | JGI25152J39213_1000038 | JGI25152J39213_100003813 | 237 |
| 39 | 3300002774 | JGI25150J39212_1000853 | JGI25150J39212_10008532 | 237 |
| 40 | 3300003187 | JGI25151J46595_10000088 | JGI25151J46595_1000008836 | 237 |
| 41 | 3300003187 | JGI25151J46595_10000150 | JGI25151J46595_1000015063 | 237 |
| 42 | 3300003187 | JGI25151J46595_10017285 | JGI25151J46595_100172852 | 237 |
| 43 | 3300003215 | JGI25153J46596_10000114 | JGI25153J46596_1000011413 | 237 |
| 44 | 3300003771 | Ga0055526_1000004 | Ga0055526_1000004259 | 237 |
| 45 | 3300003771 | Ga0055526_1000814 | Ga0055526_10008148 | 237 |
| 46 | 3300003771 | Ga0055526_1026191 | Ga0055526_10261912 | 237 |
| 47 | 3300003773 | Ga0055537_1000242 | Ga0055537_10002424 | 237 |
| 48 | 3300003773 | Ga0055537_1000989 | Ga0055537_10009897 | 237 |
| 49 | 3300003775 | Ga0055524_1000004 | Ga0055524_1000004259 | 237 |
| 50 | 3300003775 | Ga0055524_1021838 | Ga0055524_10218382 | 237 |
| 51 | 3300003775 | Ga0055524_1032910 | Ga0055524_10329102 | 237 |
| 52 | 3300003775 | Ga0055524_1032988 | Ga0055524_10329882 | 237 |
| 53 | 3300003781 | Ga0055536_1008305 | Ga0055536_10083053 | 237 |
| 54 | 3300003781 | Ga0055536_1009780 | Ga0055536_10097803 | 237 |
| 55 | 3300003781 | Ga0055536_1056115 | Ga0055536_10561151 | 237 |
| 56 | 3300003784 | Ga0055534_1000011 | Ga0055534_100001149 | 237 |
| 57 | 3300003784 | Ga0055534_1000307 | Ga0055534_100030718 | 237 |
| 58 | 3300003790 | Ga0055528_1000015 | Ga0055528_100001549 | 237 |
| 59 | 3300003790 | Ga0055528_1000402 | Ga0055528_100040219 | 237 |
| 60 | 3300003791 | Ga0055530_10000735 | Ga0055530_1000073526 | 237 |
| 61 | 3300003791 | Ga0055530_10001883 | Ga0055530_100018833 | 237 |
| 62 | 3300003791 | Ga0055530_10001945 | Ga0055530_100019459 | 237 |
| 63 | 3300003794 | Ga0055531_10005310 | Ga0055531_100053105 | 237 |
| 64 | 3300003794 | Ga0055531_10010821 | Ga0055531_100108213 | 237 |
| 65 | 3300003794 | Ga0055531_10011663 | Ga0055531_100116633 | 237 |
| 66 | 3300003794 | Ga0055531_10012552 | Ga0055531_100125521 | 237 |
| 67 | 3300003794 | Ga0055531_10015883 | Ga0055531_100158833 | 237 |
| 68 | 3300003794 | Ga0055531_10024977 | Ga0055531_100249773 | 237 |
| 69 | 3300003856 | Ga0058692_1000081 | Ga0058692_100008143 | 237 |
| 70 | 3300005288 | Ga0065714_10010475 | Ga0065714_100104756 | 237 |
| 71 | 3300005289 | Ga0065704_10073328 | Ga0065704_100733287 | 237 |
| 72 | 3300005293 | Ga0065715_10391905 | Ga0065715_103919051 | 237 |
| 73 | 3300005331 | Ga0070670_100003557 | Ga0070670_1000035572 | 237 |
| 74 | 3300005331 | Ga0070670_100081203 | Ga0070670_1000812033 | 237 |
| 75 | 3300005331 | Ga0070670_100194358 | Ga0070670_1001943581 | 237 |
| 76 | 3300005335 | Ga0070666_10000953 | Ga0070666_100009539 | 237 |
| 77 | 3300005335 | Ga0070666_10119214 | Ga0070666_101192141 | 237 |
| 78 | 3300005335 | Ga0070666_10221736 | Ga0070666_102217363 | 237 |
| 79 | 3300005337 | Ga0070682_100077670 | Ga0070682_1000776703 | 237 |
| 80 | 3300005339 | Ga0070660_100061822 | Ga0070660_1000618222 | 237 |
| 81 | 3300005339 | Ga0070660_100281257 | Ga0070660_1002812572 | 237 |
| 82 | 3300005344 | Ga0070661_100002100 | Ga0070661_10000210017 | 237 |
| 83 | 3300005344 | Ga0070661_100069955 | Ga0070661_1000699553 | 237 |
| 84 | 3300005344 | Ga0070661_100230344 | Ga0070661_1002303441 | 237 |
| 85 | 3300005344 | Ga0070661_100454405 | Ga0070661_1004544051 | 237 |
| 86 | 3300005347 | Ga0070668_100020594 | Ga0070668_1000205945 | 237 |
| 87 | 3300005354 | Ga0070675_100242239 | Ga0070675_1002422392 | 237 |
| 88 | 3300005355 | Ga0070671_100092317 | Ga0070671_1000923172 | 237 |
| 89 | 3300005365 | Ga0070688_100179863 | Ga0070688_1001798632 | 237 |
| 90 | 3300005366 | Ga0070659_100006373 | Ga0070659_1000063739 | 237 |
| 91 | 3300005366 | Ga0070659_100538480 | Ga0070659_1005384801 | 237 |
| 92 | 3300005367 | Ga0070667_100000093 | Ga0070667_10000009356 | 237 |
| 93 | 3300005367 | Ga0070667_100005913 | Ga0070667_1000059139 | 237 |
| 94 | 3300005367 | Ga0070667_100016216 | Ga0070667_1000162168 | 237 |
| 95 | 3300005367 | Ga0070667_100175713 | Ga0070667_1001757132 | 237 |
| 96 | 3300005367 | Ga0070667_100203449 | Ga0070667_1002034493 | 237 |
| 97 | 3300005434 | Ga0070709_10341500 | Ga0070709_103415001 | 237 |
| 98 | 3300005455 | Ga0070663_100000032 | Ga0070663_10000003223 | 237 |
| 99 | 3300005455 | Ga0070663_100125237 | Ga0070663_1001252371 | 237 |
| 100 | 3300005457 | Ga0070662_100214984 | Ga0070662_1002149841 | 237 |
| 101 | 3300005458 | Ga0070681_10036489 | Ga0070681_100364895 | 237 |
| 102 | 3300005459 | Ga0068867_100010240 | Ga0068867_1000102409 | 237 |
| 103 | 3300005530 | Ga0070679_100236893 | Ga0070679_1002368932 | 237 |
| 104 | 3300005530 | Ga0070679_100338094 | Ga0070679_1003380942 | 237 |
| 105 | 3300005530 | Ga0070679_100350210 | Ga0070679_1003502101 | 237 |
| 106 | 3300005535 | Ga0070684_100088823 | Ga0070684_1000888234 | 237 |
| 107 | 3300005539 | Ga0068853_100000578 | Ga0068853_10000057821 | 237 |
| 108 | 3300005539 | Ga0068853_100002169 | Ga0068853_10000216915 | 237 |
| 109 | 3300005539 | Ga0068853_100016586 | Ga0068853_1000165867 | 237 |
| 110 | 3300005539 | Ga0068853_100062688 | Ga0068853_1000626884 | 237 |
| 111 | 3300005539 | Ga0068853_100121937 | Ga0068853_1001219373 | 237 |
| 112 | 3300005539 | Ga0068853_100136224 | Ga0068853_1001362243 | 237 |
| 113 | 3300005543 | Ga0070672_100038309 | Ga0070672_1000383091 | 237 |
| 114 | 3300005544 | Ga0070686_100581910 | Ga0070686_1005819101 | 237 |
| 115 | 3300005547 | Ga0070693_100018332 | Ga0070693_1000183325 | 237 |
| 116 | 3300005547 | Ga0070693_100042646 | Ga0070693_1000426462 | 237 |
| 117 | 3300005548 | Ga0070665_100000053 | Ga0070665_100000053184 | 237 |
| 118 | 3300005548 | Ga0070665_100006542 | Ga0070665_10000654213 | 237 |
| 119 | 3300005548 | Ga0070665_100077369 | Ga0070665_1000773694 | 237 |
| 120 | 3300005548 | Ga0070665_100363370 | Ga0070665_1003633702 | 237 |
| 121 | 3300005563 | Ga0068855_100001236 | Ga0068855_10000123615 | 237 |
| 122 | 3300005563 | Ga0068855_100069561 | Ga0068855_1000695615 | 237 |
| 123 | 3300005563 | Ga0068855_100118404 | Ga0068855_1001184044 | 237 |
| 124 | 3300005563 | Ga0068855_100404007 | Ga0068855_1004040072 | 237 |
| 125 | 3300005577 | Ga0068857_100158515 | Ga0068857_1001585152 | 237 |
| 126 | 3300005577 | Ga0068857_100242262 | Ga0068857_1002422622 | 237 |
| 127 | 3300005578 | Ga0068854_100017640 | Ga0068854_1000176406 | 237 |
| 128 | 3300005614 | Ga0068856_100019245 | Ga0068856_1000192452 | 237 |
| 129 | 3300005614 | Ga0068856_100080678 | Ga0068856_1000806783 | 237 |
| 130 | 3300005614 | Ga0068856_100080681 | Ga0068856_1000806814 | 237 |
| 131 | 3300005614 | Ga0068856_100293279 | Ga0068856_1002932791 | 237 |
| 132 | 3300005616 | Ga0068852_100024631 | Ga0068852_1000246313 | 237 |
| 133 | 3300005616 | Ga0068852_100066615 | Ga0068852_1000666154 | 237 |
| 134 | 3300005616 | Ga0068852_100306075 | Ga0068852_1003060752 | 237 |
| 135 | 3300005617 | Ga0068859_100000070 | Ga0068859_10000007042 | 237 |
| 136 | 3300005617 | Ga0068859_100175296 | Ga0068859_1001752961 | 237 |
| 137 | 3300005618 | Ga0068864_100013257 | Ga0068864_1000132576 | 237 |
| 138 | 3300005834 | Ga0068851_10131766 | Ga0068851_101317661 | 237 |
| 139 | 3300005841 | Ga0068863_100003508 | Ga0068863_1000035087 | 237 |
| 140 | 3300005841 | Ga0068863_100014341 | Ga0068863_1000143412 | 237 |
| 141 | 3300005841 | Ga0068863_100019413 | Ga0068863_1000194136 | 237 |
| 142 | 3300005841 | Ga0068863_100071823 | Ga0068863_1000718234 | 237 |
| 143 | 3300005841 | Ga0068863_100611658 | Ga0068863_1006116582 | 237 |
| 144 | 3300005841 | Ga0068863_100789514 | Ga0068863_1007895141 | 237 |
| 145 | 3300005842 | Ga0068858_100039469 | Ga0068858_1000394695 | 237 |
| 146 | 3300005842 | Ga0068858_100100298 | Ga0068858_1001002982 | 237 |
| 147 | 3300005842 | Ga0068858_100273067 | Ga0068858_1002730672 | 237 |
| 148 | 3300005843 | Ga0068860_100753571 | Ga0068860_1007535712 | 237 |
| 149 | 3300005844 | Ga0068862_100000041 | Ga0068862_10000004143 | 237 |
| 150 | 3300005937 | Ga0081455_10462099 | Ga0081455_104620991 | 237 |
| 151 | 3300006028 | Ga0070717_10038092 | Ga0070717_100380924 | 237 |
| 152 | 3300006051 | Ga0075364_10001168 | Ga0075364_100011683 | 237 |
| 153 | 3300006051 | Ga0075364_10050400 | Ga0075364_100504003 | 237 |
| 154 | 3300006051 | Ga0075364_10406993 | Ga0075364_104069932 | 237 |
| 155 | 3300006237 | Ga0097621_100027840 | Ga0097621_1000278403 | 237 |
| 156 | 3300006237 | Ga0097621_100050252 | Ga0097621_1000502522 | 237 |
| 157 | 3300006237 | Ga0097621_100270841 | Ga0097621_1002708412 | 237 |
| 158 | 3300006237 | Ga0097621_100272501 | Ga0097621_1002725012 | 237 |
| 159 | 3300006881 | Ga0068865_100008851 | Ga0068865_1000088514 | 237 |
| 160 | 3300006881 | Ga0068865_100016541 | Ga0068865_1000165412 | 237 |
| 161 | 3300006931 | Ga0097620_100000070 | Ga0097620_10000007042 | 237 |
| 162 | 3300006931 | Ga0097620_100175296 | Ga0097620_1001752961 | 237 |
| 163 | 3300009011 | Ga0105251_10000008 | Ga0105251_1000000888 | 237 |
| 164 | 3300009011 | Ga0105251_10019337 | Ga0105251_100193374 | 237 |
| 165 | 3300009093 | Ga0105240_10501134 | Ga0105240_105011342 | 237 |
| 166 | 3300009174 | Ga0105241_10013791 | Ga0105241_100137916 | 237 |
| 167 | 3300009174 | Ga0105241_10140953 | Ga0105241_101409533 | 237 |
| 168 | 3300009174 | Ga0105241_10640139 | Ga0105241_106401391 | 237 |
| 169 | 3300009177 | Ga0105248_10000248 | Ga0105248_1000024842 | 237 |
| 170 | 3300009177 | Ga0105248_10225916 | Ga0105248_102259164 | 237 |
| 171 | 3300009545 | Ga0105237_10054199 | Ga0105237_100541995 | 237 |
| 172 | 3300009545 | Ga0105237_10166124 | Ga0105237_101661242 | 237 |
| 173 | 3300009545 | Ga0105237_10233916 | Ga0105237_102339163 | 237 |
| 174 | 3300009551 | Ga0105238_10011499 | Ga0105238_100114996 | 237 |
| 175 | 3300009551 | Ga0105238_10034369 | Ga0105238_100343696 | 237 |
| 176 | 3300009551 | Ga0105238_10089269 | Ga0105238_100892693 | 237 |
| 177 | 3300009553 | Ga0105249_10000471 | Ga0105249_1000047127 | 237 |
| 178 | 3300009553 | Ga0105249_10222541 | Ga0105249_102225413 | 237 |
| 179 | 3300010375 | Ga0105239_10001467 | Ga0105239_100014672 | 237 |
| 180 | 3300010375 | Ga0105239_10001780 | Ga0105239_1000178016 | 237 |
| 181 | 3300010375 | Ga0105239_10007054 | Ga0105239_100070542 | 237 |
| 182 | 3300010375 | Ga0105239_10028873 | Ga0105239_100288734 | 237 |
| 183 | 3300010375 | Ga0105239_10080575 | Ga0105239_100805755 | 237 |
| 184 | 3300010375 | Ga0105239_10396790 | Ga0105239_103967902 | 237 |
| 185 | 3300010375 | Ga0105239_11210160 | Ga0105239_112101601 | 237 |
| 186 | 3300012512 | Ga0157327_1015868 | Ga0157327_10158681 | 237 |
| 187 | 3300013100 | Ga0157373_10026274 | Ga0157373_100262743 | 237 |
| 188 | 3300013104 | Ga0157370_10005233 | Ga0157370_100052336 | 237 |
| 189 | 3300013104 | Ga0157370_10008733 | Ga0157370_100087338 | 237 |
| 190 | 3300013104 | Ga0157370_10085514 | Ga0157370_100855142 | 237 |
| 191 | 3300013104 | Ga0157370_10227362 | Ga0157370_102273622 | 237 |
| 192 | 3300013105 | Ga0157369_10013085 | Ga0157369_100130854 | 237 |
| 193 | 3300013105 | Ga0157369_10021113 | Ga0157369_100211133 | 237 |
| 194 | 3300013296 | Ga0157374_10141397 | Ga0157374_101413974 | 237 |
| 195 | 3300013296 | Ga0157374_10220845 | Ga0157374_102208451 | 237 |
| 196 | 3300013297 | Ga0157378_10000052 | Ga0157378_1000005249 | 237 |
| 197 | 3300013297 | Ga0157378_10065566 | Ga0157378_100655662 | 237 |
| 198 | 3300013306 | Ga0163162_10000061 | Ga0163162_1000006179 | 237 |
| 199 | 3300013306 | Ga0163162_10155248 | Ga0163162_101552484 | 237 |
| 200 | 3300013306 | Ga0163162_10453125 | Ga0163162_104531252 | 237 |
| 201 | 3300013306 | Ga0163162_10612768 | Ga0163162_106127681 | 237 |
| 202 | 3300013307 | Ga0157372_10008531 | Ga0157372_100085315 | 237 |
| 203 | 3300013307 | Ga0157372_10409140 | Ga0157372_104091402 | 237 |
| 204 | 3300013308 | Ga0157375_10023874 | Ga0157375_100238745 | 237 |
| 205 | 3300013308 | Ga0157375_10179802 | Ga0157375_101798022 | 237 |
| 206 | 3300014325 | Ga0163163_10000166 | Ga0163163_1000016615 | 237 |
| 207 | 3300014325 | Ga0163163_10005131 | Ga0163163_1000513110 | 237 |
| 208 | 3300014325 | Ga0163163_10008166 | Ga0163163_100081666 | 237 |
| 209 | 3300014326 | Ga0157380_10244117 | Ga0157380_102441172 | 237 |
| 210 | 3300014497 | Ga0182008_10000913 | Ga0182008_1000091313 | 237 |
| 211 | 3300014968 | Ga0157379_10004862 | Ga0157379_1000486212 | 237 |
| 212 | 3300014968 | Ga0157379_10154679 | Ga0157379_101546792 | 237 |
| 213 | 3300014969 | Ga0157376_10037455 | Ga0157376_100374555 | 237 |
| 214 | 3300014969 | Ga0157376_10181048 | Ga0157376_101810481 | 237 |
| 215 | 3300015261 | Ga0182006_1014002 | Ga0182006_10140022 | 237 |
| 216 | 3300015261 | Ga0182006_1035742 | Ga0182006_10357422 | 237 |
| 217 | 3300015261 | Ga0182006_1107513 | Ga0182006_11075132 | 237 |
| 218 | 3300015689 | Ga0183360_10004 | Ga0183360_10004147 | 237 |
| 219 | 3300017792 | Ga0163161_10001958 | Ga0163161_1000195810 | 237 |
| 220 | 3300017792 | Ga0163161_10035692 | Ga0163161_100356925 | 237 |
| 221 | 3300025245 | Ga0207425_1000029 | Ga0207425_1000029173 | 237 |
| 222 | 3300025258 | Ga0209129_1000073 | Ga0209129_100007362 | 237 |
| 223 | 3300025263 | Ga0209565_1000002 | Ga0209565_10000021126 | 237 |
| 224 | 3300025263 | Ga0209565_1000113 | Ga0209565_100011354 | 237 |
| 225 | 3300025273 | Ga0209673_1000002 | Ga0209673_10000021126 | 237 |
| 226 | 3300025273 | Ga0209673_1000369 | Ga0209673_100036934 | 237 |
| 227 | 3300025273 | Ga0209673_1023345 | Ga0209673_10233452 | 237 |
| 228 | 3300025284 | Ga0209130_1030023 | Ga0209130_10300232 | 237 |
| 229 | 3300025284 | Ga0209130_1039891 | Ga0209130_10398911 | 237 |
| 230 | 3300025291 | Ga0209675_1000002 | Ga0209675_10000021126 | 237 |
| 231 | 3300025291 | Ga0209675_1000007 | Ga0209675_100000748 | 237 |
| 232 | 3300025291 | Ga0209675_1022095 | Ga0209675_10220952 | 237 |
| 233 | 3300025292 | Ga0209676_1000018 | Ga0209676_1000018498 | 237 |
| 234 | 3300025292 | Ga0209676_1001361 | Ga0209676_100136111 | 237 |
| 235 | 3300025292 | Ga0209676_1001572 | Ga0209676_100157210 | 237 |
| 236 | 3300025292 | Ga0209676_1007516 | Ga0209676_10075163 | 237 |
| 237 | 3300025292 | Ga0209676_1009869 | Ga0209676_10098694 | 237 |
| 238 | 3300025292 | Ga0209676_1051041 | Ga0209676_10510412 | 237 |
| 239 | 3300025294 | Ga0209025_1000076 | Ga0209025_1000076177 | 237 |
| 240 | 3300025294 | Ga0209025_1000134 | Ga0209025_100013451 | 237 |
| 241 | 3300025294 | Ga0209025_1001794 | Ga0209025_10017946 | 237 |
| 242 | 3300025295 | Ga0209564_1000004 | Ga0209564_10000041127 | 237 |
| 243 | 3300025295 | Ga0209564_1000333 | Ga0209564_100033347 | 237 |
| 244 | 3300025295 | Ga0209564_1020240 | Ga0209564_10202402 | 237 |
| 245 | 3300025297 | Ga0209758_1000112 | Ga0209758_1000112113 | 237 |
| 246 | 3300025298 | Ga0209050_1000396 | Ga0209050_100039642 | 237 |
| 247 | 3300025298 | Ga0209050_1001391 | Ga0209050_10013913 | 237 |
| 248 | 3300025298 | Ga0209050_1001430 | Ga0209050_10014309 | 237 |
| 249 | 3300025298 | Ga0209050_1038936 | Ga0209050_10389362 | 237 |
| 250 | 3300025298 | Ga0209050_1046199 | Ga0209050_10461992 | 237 |
| 251 | 3300025299 | Ga0209256_1000004 | Ga0209256_10000041127 | 237 |
| 252 | 3300025299 | Ga0209256_1002151 | Ga0209256_10021512 | 237 |
| 253 | 3300025299 | Ga0209256_1002538 | Ga0209256_10025382 | 237 |
| 254 | 3300025299 | Ga0209256_1005969 | Ga0209256_10059693 | 237 |
| 255 | 3300025299 | Ga0209256_1006907 | Ga0209256_10069074 | 237 |
| 256 | 3300025299 | Ga0209256_1009592 | Ga0209256_10095924 | 237 |
| 257 | 3300025303 | Ga0209051_1000449 | Ga0209051_100044918 | 237 |
| 258 | 3300025303 | Ga0209051_1032865 | Ga0209051_10328652 | 237 |
| 259 | 3300025304 | Ga0209257_1000035 | Ga0209257_1000035498 | 237 |
| 260 | 3300025304 | Ga0209257_1000150 | Ga0209257_100015077 | 237 |
| 261 | 3300025304 | Ga0209257_1000861 | Ga0209257_10008618 | 237 |
| 262 | 3300025304 | Ga0209257_1001769 | Ga0209257_100176915 | 237 |
| 263 | 3300025304 | Ga0209257_1002921 | Ga0209257_100292118 | 237 |
| 264 | 3300025304 | Ga0209257_1004367 | Ga0209257_10043679 | 237 |
| 265 | 3300025304 | Ga0209257_1006408 | Ga0209257_10064084 | 237 |
| 266 | 3300025304 | Ga0209257_1008020 | Ga0209257_10080205 | 237 |
| 267 | 3300025321 | Ga0207656_10137475 | Ga0207656_101374752 | 237 |
| 268 | 3300025735 | Ga0207713_1000170 | Ga0207713_100017043 | 237 |
| 269 | 3300025735 | Ga0207713_1070744 | Ga0207713_10707442 | 237 |
| 270 | 3300025898 | Ga0207692_10172743 | Ga0207692_101727432 | 237 |
| 271 | 3300025903 | Ga0207680_10000676 | Ga0207680_1000067610 | 237 |
| 272 | 3300025903 | Ga0207680_10054437 | Ga0207680_100544373 | 237 |
| 273 | 3300025903 | Ga0207680_10146267 | Ga0207680_101462672 | 237 |
| 274 | 3300025904 | Ga0207647_10001196 | Ga0207647_1000119617 | 237 |
| 275 | 3300025904 | Ga0207647_10165850 | Ga0207647_101658502 | 237 |
| 276 | 3300025907 | Ga0207645_10090284 | Ga0207645_100902842 | 237 |
| 277 | 3300025908 | Ga0207643_10218073 | Ga0207643_102180732 | 237 |
| 278 | 3300025909 | Ga0207705_10276548 | Ga0207705_102765482 | 237 |
| 279 | 3300025911 | Ga0207654_10001933 | Ga0207654_1000193312 | 237 |
| 280 | 3300025911 | Ga0207654_10011118 | Ga0207654_100111185 | 237 |
| 281 | 3300025911 | Ga0207654_10082581 | Ga0207654_100825812 | 237 |
| 282 | 3300025912 | Ga0207707_10081643 | Ga0207707_100816432 | 237 |
| 283 | 3300025913 | Ga0207695_10000271 | Ga0207695_1000027182 | 237 |
| 284 | 3300025914 | Ga0207671_10008442 | Ga0207671_100084421 | 237 |
| 285 | 3300025914 | Ga0207671_10018141 | Ga0207671_100181414 | 237 |
| 286 | 3300025914 | Ga0207671_10133090 | Ga0207671_101330902 | 237 |
| 287 | 3300025914 | Ga0207671_10138065 | Ga0207671_101380652 | 237 |
| 288 | 3300025915 | Ga0207693_10389321 | Ga0207693_103893211 | 237 |
| 289 | 3300025919 | Ga0207657_10013571 | Ga0207657_100135712 | 237 |
| 290 | 3300025919 | Ga0207657_10150759 | Ga0207657_101507594 | 237 |
| 291 | 3300025920 | Ga0207649_10006390 | Ga0207649_100063907 | 237 |
| 292 | 3300025920 | Ga0207649_10042889 | Ga0207649_100428894 | 237 |
| 293 | 3300025923 | Ga0207681_10480473 | Ga0207681_104804732 | 237 |
| 294 | 3300025924 | Ga0207694_10252016 | Ga0207694_102520161 | 237 |
| 295 | 3300025925 | Ga0207650_10000609 | Ga0207650_1000060914 | 237 |
| 296 | 3300025925 | Ga0207650_10104689 | Ga0207650_101046893 | 237 |
| 297 | 3300025925 | Ga0207650_10180102 | Ga0207650_101801023 | 237 |
| 298 | 3300025931 | Ga0207644_10025895 | Ga0207644_100258955 | 237 |
| 299 | 3300025931 | Ga0207644_10269409 | Ga0207644_102694091 | 237 |
| 300 | 3300025932 | Ga0207690_10115038 | Ga0207690_101150382 | 237 |
| 301 | 3300025933 | Ga0207706_10029354 | Ga0207706_100293544 | 237 |
| 302 | 3300025934 | Ga0207686_10551529 | Ga0207686_105515292 | 237 |
| 303 | 3300025935 | Ga0207709_10004956 | Ga0207709_100049567 | 237 |
| 304 | 3300025936 | Ga0207670_10265562 | Ga0207670_102655622 | 237 |
| 305 | 3300025938 | Ga0207704_10032344 | Ga0207704_100323444 | 237 |
| 306 | 3300025938 | Ga0207704_10059125 | Ga0207704_100591252 | 237 |
| 307 | 3300025940 | Ga0207691_10019964 | Ga0207691_100199643 | 237 |
| 308 | 3300025941 | Ga0207711_10002210 | Ga0207711_1000221011 | 237 |
| 309 | 3300025942 | Ga0207689_10043389 | Ga0207689_100433894 | 237 |
| 310 | 3300025942 | Ga0207689_10197427 | Ga0207689_101974274 | 237 |
| 311 | 3300025944 | Ga0207661_10084178 | Ga0207661_100841784 | 237 |
| 312 | 3300025949 | Ga0207667_10006642 | Ga0207667_100066422 | 237 |
| 313 | 3300025949 | Ga0207667_10009259 | Ga0207667_100092599 | 237 |
| 314 | 3300025949 | Ga0207667_10061270 | Ga0207667_100612702 | 237 |
| 315 | 3300025949 | Ga0207667_10272394 | Ga0207667_102723942 | 237 |
| 316 | 3300025949 | Ga0207667_10759167 | Ga0207667_107591671 | 237 |
| 317 | 3300025960 | Ga0207651_10151481 | Ga0207651_101514812 | 237 |
| 318 | 3300025961 | Ga0207712_10000056 | Ga0207712_1000005620 | 237 |
| 319 | 3300025961 | Ga0207712_10243910 | Ga0207712_102439101 | 237 |
| 320 | 3300025972 | Ga0207668_10135154 | Ga0207668_101351542 | 237 |
| 321 | 3300025972 | Ga0207668_10222264 | Ga0207668_102222641 | 237 |
| 322 | 3300025981 | Ga0207640_10017451 | Ga0207640_100174514 | 237 |
| 323 | 3300025981 | Ga0207640_10508797 | Ga0207640_105087972 | 237 |
| 324 | 3300025986 | Ga0207658_10000020 | Ga0207658_100000208 | 237 |
| 325 | 3300025986 | Ga0207658_10003800 | Ga0207658_100038001 | 237 |
| 326 | 3300025986 | Ga0207658_10049334 | Ga0207658_100493343 | 237 |
| 327 | 3300025986 | Ga0207658_10322030 | Ga0207658_103220302 | 237 |
| 328 | 3300025986 | Ga0207658_10679911 | Ga0207658_106799111 | 237 |
| 329 | 3300026035 | Ga0207703_10322997 | Ga0207703_103229972 | 237 |
| 330 | 3300026035 | Ga0207703_10521670 | Ga0207703_105216701 | 237 |
| 331 | 3300026041 | Ga0207639_10001658 | Ga0207639_1000165816 | 237 |
| 332 | 3300026041 | Ga0207639_10002592 | Ga0207639_100025927 | 237 |
| 333 | 3300026041 | Ga0207639_10004818 | Ga0207639_100048182 | 237 |
| 334 | 3300026041 | Ga0207639_10005192 | Ga0207639_100051922 | 237 |
| 335 | 3300026041 | Ga0207639_10010298 | Ga0207639_100102984 | 237 |
| 336 | 3300026041 | Ga0207639_10011899 | Ga0207639_100118992 | 237 |
| 337 | 3300026041 | Ga0207639_10057786 | Ga0207639_100577864 | 237 |
| 338 | 3300026041 | Ga0207639_10099933 | Ga0207639_100999333 | 237 |
| 339 | 3300026067 | Ga0207678_10000010 | Ga0207678_1000001023 | 237 |
| 340 | 3300026078 | Ga0207702_10002211 | Ga0207702_100022118 | 237 |
| 341 | 3300026078 | Ga0207702_10006391 | Ga0207702_1000639112 | 237 |
| 342 | 3300026088 | Ga0207641_10006298 | Ga0207641_100062982 | 237 |
| 343 | 3300026088 | Ga0207641_10018733 | Ga0207641_100187337 | 237 |
| 344 | 3300026088 | Ga0207641_10023027 | Ga0207641_100230273 | 237 |
| 345 | 3300026089 | Ga0207648_10002984 | Ga0207648_1000298412 | 237 |
| 346 | 3300026095 | Ga0207676_10032827 | Ga0207676_100328275 | 237 |
| 347 | 3300026095 | Ga0207676_10556158 | Ga0207676_105561581 | 237 |
| 348 | 3300026116 | Ga0207674_10072246 | Ga0207674_100722463 | 237 |
| 349 | 3300026116 | Ga0207674_10231187 | Ga0207674_102311872 | 237 |
| 350 | 3300026118 | Ga0207675_100627883 | Ga0207675_1006278831 | 237 |
| 351 | 3300026142 | Ga0207698_10158227 | Ga0207698_101582272 | 237 |
| 352 | 3300026142 | Ga0207698_10169888 | Ga0207698_101698882 | 237 |
| 353 | 3300026142 | Ga0207698_10332243 | Ga0207698_103322432 | 237 |
| 354 | 3300026142 | Ga0207698_10614220 | Ga0207698_106142201 | 237 |
| 355 | 3300027312 | Ga0209371_1000235 | Ga0209371_100023543 | 237 |
| 356 | 3300028379 | Ga0268266_10000001 | Ga0268266_10000001181 | 237 |
| 357 | 3300028379 | Ga0268266_10024141 | Ga0268266_100241413 | 237 |
| 358 | 3300028379 | Ga0268266_10248270 | Ga0268266_102482702 | 237 |
| 359 | 3300028379 | Ga0268266_10278713 | Ga0268266_102787131 | 237 |
| 360 | 3300028379 | Ga0268266_10437231 | Ga0268266_104372312 | 237 |
| 361 | 3300028379 | Ga0268266_10459412 | Ga0268266_104594122 | 237 |
| 362 | 3300028380 | Ga0268265_10000137 | Ga0268265_1000013737 | 237 |
| 363 | 3300028381 | Ga0268264_10060987 | Ga0268264_100609874 | 237 |
| 364 | 3300028381 | Ga0268264_10371381 | Ga0268264_103713813 | 237 |
| 365 | 3300030500 | Ga0268256_1000196 | Ga0268256_100019620 | 237 |
| 366 | 3300030733 | Ga0314311_1183412 | Ga0314311_11834123 | 237 |
| 367 | 3300030736 | Ga0316180_1048768 | Ga0316180_10487682 | 237 |
| 368 | 3300030742 | Ga0316183_1047328 | Ga0316183_10473285 | 237 |
| 369 | 3300030745 | Ga0316182_1226196 | Ga0316182_12261962 | 237 |
| 370 | 3300031548 | Ga0307408_100056242 | Ga0307408_1000562421 | 237 |
| 371 | 3300031548 | Ga0307408_100757408 | Ga0307408_1007574081 | 237 |
| 372 | 3300031730 | Ga0307516_10159177 | Ga0307516_101591772 | 237 |
| 373 | 3300031730 | Ga0307516_10169553 | Ga0307516_101695531 | 237 |
| 374 | 3300031731 | Ga0307405_10128201 | Ga0307405_101282012 | 237 |
| 375 | 3300031901 | Ga0307406_10014708 | Ga0307406_100147084 | 237 |
| 376 | 3300031901 | Ga0307406_10357102 | Ga0307406_103571022 | 237 |
| 377 | 3300031903 | Ga0307407_10040952 | Ga0307407_100409522 | 237 |
| 378 | 3300031911 | Ga0307412_10070648 | Ga0307412_100706482 | 237 |
| 379 | 3300032002 | Ga0307416_100206007 | Ga0307416_1002060072 | 237 |
| 380 | 3300032002 | Ga0307416_100250679 | Ga0307416_1002506792 | 237 |
| 381 | 3300032004 | Ga0307414_10059038 | Ga0307414_100590382 | 237 |
| 382 | 3300032004 | Ga0307414_10119791 | Ga0307414_101197912 | 237 |
| 383 | 3300032004 | Ga0307414_10226360 | Ga0307414_102263602 | 237 |
| 384 | 3300032004 | Ga0307414_10258799 | Ga0307414_102587992 | 237 |
| 385 | 3300032004 | Ga0307414_10505221 | Ga0307414_105052212 | 237 |
| 386 | 3300032005 | Ga0307411_10063599 | Ga0307411_100635993 | 237 |
| 387 | 3300032005 | Ga0307411_10204749 | Ga0307411_102047492 | 237 |
| 388 | 3300032005 | Ga0307411_10242391 | Ga0307411_102423912 | 237 |
| 389 | 3300032005 | Ga0307411_10257994 | Ga0307411_102579943 | 237 |
| 390 | 3300032126 | Ga0307415_100340659 | Ga0307415_1003406591 | 237 |
| 391 | 3300037471 | Ga0395905_0092352 | Ga0395905_0092352_1290_2012 | 237 |
| 392 | 3300037471 | Ga0395905_0158891 | Ga0395905_0158891_360_1082 | 237 |
| 393 | 3300038705 | Ga0237819_00408 | Ga0237819_00408_10654_11376 | 237 |
| 394 | 3300039145 | Ga0237816_02319 | Ga0237816_02319_328_1056 | 237 |
| 395 | 3300041404 | Ga0439436_0001101 | Ga0439436_0001101_3836_4582 | 237 |
| 396 | 3300041404 | Ga0439436_0038342 | Ga0439436_0038342_110_835 | 237 |
| 397 | 3300041413 | Ga0439465_0038820 | Ga0439465_0038820_429_1154 | 237 |
| 398 | 3300041451 | Ga0451791_0128905 | Ga0451791_0128905_32_754 | 237 |
| 399 | 3300041451 | Ga0451791_0620911 | Ga0451791_0620911_11_727 | 237 |
| 400 | 3300041452 | Ga0451793_0075781 | Ga0451793_0075781_1470_2186 | 237 |
| 401 | 3300041452 | Ga0451793_1174458 | Ga0451793_1174458_812_1609 | 237 |
| 402 | 3300041456 | Ga0451795_1325393 | Ga0451795_1325393_27_743 | 237 |
| 403 | 3300041459 | Ga0451800_0052513 | Ga0451800_0052513_49_771 | 237 |
| 404 | 3300041459 | Ga0451800_0176271 | Ga0451800_0176271_1769_2566 | 237 |
| 405 | 3300041462 | Ga0451806_243563 | Ga0451806_243563_2953_3750 | 237 |
| 406 | 3300041463 | Ga0451804_0548075 | Ga0451804_0548075_1127_1924 | 237 |
| 407 | 3300041486 | Ga0451807_0148046 | Ga0451807_0148046_141_857 | 237 |
| 408 | 3300041486 | Ga0451807_1481108 | Ga0451807_1481108_2729_3526 | 237 |
| 409 | 3300041491 | Ga0451833_1391529 | Ga0451833_1391529_30_746 | 237 |
| 410 | 3300041494 | Ga0451837_0148912 | Ga0451837_0148912_1647_2363 | 237 |
| 411 | 3300041496 | Ga0451839_0733957 | Ga0451839_0733957_318_1034 | 237 |
| 412 | 3300042004 | Ga0439445_0001895 | Ga0439445_0001895_524_1264 | 237 |
| 413 | 3300042006 | Ga0439432_002495 | Ga0439432_002495_815_1570 | 237 |
| 414 | 3300042006 | Ga0439432_012529 | Ga0439432_012529_1663_2385 | 237 |
| 415 | 3300042007 | Ga0439449_0000005 | Ga0439449_0000005_5586_6311 | 237 |
| 416 | 3300042007 | Ga0439449_0018213 | Ga0439449_0018213_187_942 | 237 |
| 417 | 3300042007 | Ga0439449_0035650 | Ga0439449_0035650_946_1701 | 237 |
| 418 | 3300042007 | Ga0439449_0054170 | Ga0439449_0054170_485_1231 | 237 |
| 419 | 3300044658 | Ga0466972_0000334 | Ga0466972_0000334_2991_3707 | 237 |
| 420 | 3300044765 | Ga0466970_0007051 | Ga0466970_0007051_56_772 | 237 |
| 421 | 3300046454 | Ga0495592_0314056 | Ga0495592_0314056_280_996 | 237 |
| 422 | 3300046459 | Ga0495629_0176417 | Ga0495629_0176417_229_945 | 237 |
| 423 | 3300046460 | Ga0495638_0002595 | Ga0495638_0002595_11137_11859 | 237 |
| 424 | 3300046474 | Ga0495605_0072431 | Ga0495605_0072431_398_1129 | 237 |
| 425 | 3300046501 | Ga0495607_0046027 | Ga0495607_0046027_1648_2379 | 237 |
| 426 | 3300046507 | Ga0495606_0054020 | Ga0495606_0054020_740_1471 | 237 |
| 427 | 3300046512 | Ga0495610_0003711 | Ga0495610_0003711_10539_11261 | 237 |
| 428 | 3300046512 | Ga0495610_0061976 | Ga0495610_0061976_210_941 | 237 |
| 429 | 3300046518 | Ga0495631_0008855 | Ga0495631_0008855_2849_3571 | 237 |
| 430 | 3300046522 | Ga0495643_0001375 | Ga0495643_0001375_10228_10950 | 237 |
| 431 | 3300046539 | Ga0495621_0000496 | Ga0495621_0000496_8470_9195 | 237 |
| 432 | 3300046558 | Ga0495633_0012995 | Ga0495633_0012995_3088_3810 | 237 |
| 433 | 3300046558 | Ga0495633_0028608 | Ga0495633_0028608_722_1444 | 237 |
| 434 | 3300046660 | Ga0495625_0079320 | Ga0495625_0079320_1059_1781 | 237 |
| 435 | 3300046664 | Ga0495659_0051771 | Ga0495659_0051771_467_1222 | 237 |
| 436 | 3300047318 | Ga0495636_0000147 | Ga0495636_0000147_11742_12497 | 237 |
| 437 | 3300047320 | Ga0495672_0001550 | Ga0495672_0001550_11481_12203 | 237 |
| 438 | 3300047322 | Ga0495680_0214891 | Ga0495680_0214891_631_1347 | 237 |
| 439 | 3300047472 | Ga0495686_0020416 | Ga0495686_0020416_2687_3433 | 237 |
| 440 | 3300047472 | Ga0495686_0039504 | Ga0495686_0039504_844_1566 | 237 |
| 441 | 3300048904 | Ga0496101_0233150 | Ga0496101_0233150_382_1104 | 237 |
| 442 | 3300048911 | Ga0496108_0217980 | Ga0496108_0217980_849_1574 | 237 |
| 443 | 3300048911 | Ga0496108_0446075 | Ga0496108_0446075_154_876 | 237 |
| 444 | 3300048918 | Ga0496115_0000002 | Ga0496115_0000002_291488_292204 | 237 |
| 445 | 3300048919 | Ga0496116_0039520 | Ga0496116_0039520_595_1317 | 237 |
| 446 | 3300048919 | Ga0496116_0153685 | Ga0496116_0153685_24_746 | 237 |
| 447 | 3300048920 | Ga0496117_0002512 | Ga0496117_0002512_14326_15048 | 237 |
| 448 | 3300048920 | Ga0496117_0002847 | Ga0496117_0002847_10815_11537 | 237 |
| 449 | 3300048920 | Ga0496117_0003923 | Ga0496117_0003923_13433_14155 | 237 |
| 450 | 3300048920 | Ga0496117_0033222 | Ga0496117_0033222_2461_3177 | 237 |
| 451 | 3300048920 | Ga0496117_0085654 | Ga0496117_0085654_558_1274 | 237 |
| 452 | 3300048921 | Ga0496118_0000065 | Ga0496118_0000065_101251_101967 | 237 |
| 453 | 3300048921 | Ga0496118_0000183 | Ga0496118_0000183_31070_31786 | 237 |
| 454 | 3300048921 | Ga0496118_0003155 | Ga0496118_0003155_9512_10234 | 237 |
| 455 | 3300048921 | Ga0496118_0004179 | Ga0496118_0004179_13433_14155 | 237 |
| 456 | 3300048921 | Ga0496118_0027139 | Ga0496118_0027139_2101_2823 | 237 |
| 457 | 3300048921 | Ga0496118_0111948 | Ga0496118_0111948_1055_1777 | 237 |
| 458 | 3300048921 | Ga0496118_0181823 | Ga0496118_0181823_49_771 | 237 |
| 459 | 3300048922 | Ga0496119_0000787 | Ga0496119_0000787_35787_36509 | 237 |
| 460 | 3300048922 | Ga0496119_0005545 | Ga0496119_0005545_7931_8653 | 237 |
| 461 | 3300048923 | Ga0496120_0000776 | Ga0496120_0000776_9459_10181 | 237 |
| 462 | 3300048923 | Ga0496120_0001660 | Ga0496120_0001660_7935_8657 | 237 |
| 463 | 3300048924 | Ga0496121_0009225 | Ga0496121_0009225_1747_2469 | 237 |
| 464 | 3300048924 | Ga0496121_0042488 | Ga0496121_0042488_398_1144 | 237 |
| 465 | 3300048924 | Ga0496121_0095925 | Ga0496121_0095925_689_1405 | 237 |
| 466 | 3300048925 | Ga0496122_0000037 | Ga0496122_0000037_54718_55464 | 237 |
| 467 | 3300048925 | Ga0496122_0000355 | Ga0496122_0000355_10257_11021 | 237 |
| 468 | 3300048925 | Ga0496122_0000361 | Ga0496122_0000361_8135_8857 | 237 |
| 469 | 3300048925 | Ga0496122_0080025 | Ga0496122_0080025_65_787 | 237 |
| 470 | 3300048925 | Ga0496122_0143733 | Ga0496122_0143733_486_1208 | 237 |
| 471 | 3300048926 | Ga0496123_0000167 | Ga0496123_0000167_106578_107324 | 237 |
| 472 | 3300048926 | Ga0496123_0001332 | Ga0496123_0001332_23864_24628 | 237 |
| 473 | 3300048926 | Ga0496123_0002053 | Ga0496123_0002053_17066_17788 | 237 |
| 474 | 3300048926 | Ga0496123_0051202 | Ga0496123_0051202_536_1258 | 237 |
| 475 | 3300048926 | Ga0496123_0128526 | Ga0496123_0128526_204_926 | 237 |
| 476 | 3300048926 | Ga0496123_0200952 | Ga0496123_0200952_224_946 | 237 |
| 477 | 3300048927 | Ga0496124_0000018 | Ga0496124_0000018_295137_295868 | 237 |
| 478 | 3300048927 | Ga0496124_0002453 | Ga0496124_0002453_7872_8594 | 237 |
| 479 | 3300048927 | Ga0496124_0003077 | Ga0496124_0003077_7932_8654 | 237 |
| 480 | 3300048927 | Ga0496124_0031164 | Ga0496124_0031164_1318_2040 | 237 |
| 481 | 3300048927 | Ga0496124_0057662 | Ga0496124_0057662_74_796 | 237 |
| 482 | 3300048927 | Ga0496124_0064200 | Ga0496124_0064200_1618_2340 | 237 |
| 483 | 3300048927 | Ga0496124_0118670 | Ga0496124_0118670_74_796 | 237 |
| 484 | 3300048928 | Ga0496125_0000486 | Ga0496125_0000486_66178_66900 | 237 |
| 485 | 3300048928 | Ga0496125_0028711 | Ga0496125_0028711_3160_3882 | 237 |
| 486 | 3300048928 | Ga0496125_0030723 | Ga0496125_0030723_1421_2143 | 237 |
| 487 | 3300048928 | Ga0496125_0047889 | Ga0496125_0047889_1561_2283 | 237 |
| 488 | 3300048928 | Ga0496125_0049149 | Ga0496125_0049149_653_1375 | 237 |
| 489 | 3300048928 | Ga0496125_0356871 | Ga0496125_0356871_14_730 | 237 |
| 490 | 3300048929 | Ga0496126_0000052 | Ga0496126_0000052_238659_239375 | 237 |
| 491 | 3300048929 | Ga0496126_0002494 | Ga0496126_0002494_14574_15296 | 237 |
| 492 | 3300048929 | Ga0496126_0119312 | Ga0496126_0119312_1110_1826 | 237 |
| 493 | 3300049568 | Ga0501031_0005216 | Ga0501031_0005216_4798_5514 | 237 |
| 494 | 3300049568 | Ga0501031_0019030 | Ga0501031_0019030_3441_4157 | 237 |
| 495 | 3300049569 | Ga0501032_0000210 | Ga0501032_0000210_20511_21227 | 237 |
| 496 | 3300049569 | Ga0501032_0017490 | Ga0501032_0017490_3753_4469 | 237 |
| 497 | 3300049569 | Ga0501032_0124583 | Ga0501032_0124583_427_1143 | 237 |
| 498 | 3300049569 | Ga0501032_0270441 | Ga0501032_0270441_344_1060 | 237 |
| 499 | 3300049570 | Ga0501033_0002201 | Ga0501033_0002201_15064_15780 | 237 |
| 500 | 3300049570 | Ga0501033_0002803 | Ga0501033_0002803_5293_6009 | 237 |
| 501 | 3300049571 | Ga0501034_0002412 | Ga0501034_0002412_9180_9896 | 237 |
| 502 | 3300049571 | Ga0501034_0006726 | Ga0501034_0006726_10876_11601 | 237 |
| 503 | 3300049571 | Ga0501034_0020750 | Ga0501034_0020750_2253_2969 | 237 |
| 504 | 3300049571 | Ga0501034_0031232 | Ga0501034_0031232_2849_3565 | 237 |
| 505 | 3300049571 | Ga0501034_0038655 | Ga0501034_0038655_2257_2982 | 237 |
| 506 | 3300049571 | Ga0501034_0131898 | Ga0501034_0131898_135_851 | 237 |
| 507 | 3300049571 | Ga0501034_0382400 | Ga0501034_0382400_446_1162 | 237 |
| 508 | 3300049572 | Ga0501036_0002348 | Ga0501036_0002348_5185_5901 | 237 |
| 509 | 3300049572 | Ga0501036_0004079 | Ga0501036_0004079_3056_3772 | 237 |
| 510 | 3300049572 | Ga0501036_0008356 | Ga0501036_0008356_7327_8043 | 237 |
| 511 | 3300049572 | Ga0501036_0164595 | Ga0501036_0164595_604_1320 | 237 |
| 512 | 3300049573 | Ga0501037_0006826 | Ga0501037_0006826_4670_5386 | 237 |
| 513 | 3300049573 | Ga0501037_0015960 | Ga0501037_0015960_441_1157 | 237 |
| 514 | 3300049574 | Ga0501038_0002683 | Ga0501038_0002683_8660_9376 | 237 |
| 515 | 3300049574 | Ga0501038_0003333 | Ga0501038_0003333_14071_14787 | 237 |
| 516 | 3300049574 | Ga0501038_0017012 | Ga0501038_0017012_2238_2954 | 237 |
| 517 | 3300049574 | Ga0501038_0080555 | Ga0501038_0080555_1228_1944 | 237 |
| 518 | 3300049575 | Ga0501039_0051215 | Ga0501039_0051215_2043_2759 | 237 |
| 519 | 3300049576 | Ga0501040_0015264 | Ga0501040_0015264_1417_2133 | 237 |
| 520 | 3300049578 | Ga0501042_0021090 | Ga0501042_0021090_1753_2469 | 237 |
| 521 | 3300049578 | Ga0501042_0168165 | Ga0501042_0168165_458_1174 | 237 |
| 522 | 3300049579 | Ga0501043_0001996 | Ga0501043_0001996_15763_16479 | 237 |
| 523 | 3300049579 | Ga0501043_0002614 | Ga0501043_0002614_948_1688 | 237 |
| 524 | 3300049579 | Ga0501043_0061548 | Ga0501043_0061548_2183_2899 | 237 |
| 525 | 3300049579 | Ga0501043_0070939 | Ga0501043_0070939_1048_1764 | 237 |
| 526 | 3300049579 | Ga0501043_0106581 | Ga0501043_0106581_537_1253 | 237 |
| 527 | 3300049579 | Ga0501043_0463120 | Ga0501043_0463120_213_929 | 237 |
| 528 | 3300049580 | Ga0501046_0000871 | Ga0501046_0000871_19874_20590 | 237 |
| 529 | 3300049580 | Ga0501046_0121760 | Ga0501046_0121760_441_1157 | 237 |
| 530 | 3300049580 | Ga0501046_0194316 | Ga0501046_0194316_247_963 | 237 |
| 531 | 3300049580 | Ga0501046_0314740 | Ga0501046_0314740_270_986 | 237 |
| 532 | 3300049580 | Ga0501046_0413873 | Ga0501046_0413873_41_757 | 237 |
| 533 | 3300049581 | Ga0501047_0005436 | Ga0501047_0005436_9547_10263 | 237 |
| 534 | 3300049581 | Ga0501047_0007253 | Ga0501047_0007253_2828_3544 | 237 |
| 535 | 3300049581 | Ga0501047_0030303 | Ga0501047_0030303_3753_4469 | 237 |
| 536 | 3300049581 | Ga0501047_0039255 | Ga0501047_0039255_739_1464 | 237 |
| 537 | 3300049581 | Ga0501047_0054618 | Ga0501047_0054618_1317_2033 | 237 |
| 538 | 3300049582 | Ga0501048_0003611 | Ga0501048_0003611_7397_8113 | 237 |
| 539 | 3300049582 | Ga0501048_0309593 | Ga0501048_0309593_345_1061 | 237 |
| 540 | 3300049583 | Ga0501067_0000786 | Ga0501067_0000786_6225_6941 | 237 |
| 541 | 3300049583 | Ga0501067_0009081 | Ga0501067_0009081_3633_4349 | 237 |
| 542 | 3300049584 | Ga0501068_0079848 | Ga0501068_0079848_167_883 | 237 |
| 543 | 3300049585 | Ga0501069_0002420 | Ga0501069_0002420_4346_5062 | 237 |
| 544 | 3300049585 | Ga0501069_0003626 | Ga0501069_0003626_5261_5977 | 237 |
| 545 | 3300049585 | Ga0501069_0266661 | Ga0501069_0266661_232_948 | 237 |
| 546 | 3300049586 | Ga0501070_0007151 | Ga0501070_0007151_5752_6468 | 237 |
| 547 | 3300049586 | Ga0501070_0039775 | Ga0501070_0039775_1573_2289 | 237 |
| 548 | 3300049586 | Ga0501070_0040947 | Ga0501070_0040947_2199_2915 | 237 |
| 549 | 3300049586 | Ga0501070_0060336 | Ga0501070_0060336_1873_2589 | 237 |
| 550 | 3300049586 | Ga0501070_0092389 | Ga0501070_0092389_254_970 | 237 |
| 551 | 3300049586 | Ga0501070_0100374 | Ga0501070_0100374_1220_1936 | 237 |
| 552 | 3300049586 | Ga0501070_0301078 | Ga0501070_0301078_52_768 | 237 |
| 553 | 3300049587 | Ga0501071_0018515 | Ga0501071_0018515_2135_2851 | 237 |
| 554 | 3300049588 | Ga0501072_0001140 | Ga0501072_0001140_186_902 | 237 |
| 555 | 3300049588 | Ga0501072_0346866 | Ga0501072_0346866_207_923 | 237 |
| 556 | 3300049589 | Ga0501073_0002336 | Ga0501073_0002336_1839_2555 | 237 |
| 557 | 3300049589 | Ga0501073_0007516 | Ga0501073_0007516_3148_3864 | 237 |
| 558 | 3300049589 | Ga0501073_0008635 | Ga0501073_0008635_2313_3029 | 237 |
| 559 | 3300049589 | Ga0501073_0041334 | Ga0501073_0041334_94_810 | 237 |
| 560 | 3300049589 | Ga0501073_0382545 | Ga0501073_0382545_170_886 | 237 |
| 561 | 3300049590 | Ga0501074_0002549 | Ga0501074_0002549_9568_10284 | 237 |
| 562 | 3300049590 | Ga0501074_0011395 | Ga0501074_0011395_2764_3480 | 237 |
| 563 | 3300049590 | Ga0501074_0075819 | Ga0501074_0075819_413_1129 | 237 |
| 564 | 3300049590 | Ga0501074_0076261 | Ga0501074_0076261_1441_2157 | 237 |
| 565 | 3300049590 | Ga0501074_0231646 | Ga0501074_0231646_382_1098 | 237 |
| 566 | 3300049590 | Ga0501074_0266826 | Ga0501074_0266826_344_1060 | 237 |
| 567 | 3300049592 | Ga0501076_0074408 | Ga0501076_0074408_1882_2598 | 237 |
| 568 | 3300049592 | Ga0501076_0694092 | Ga0501076_0694092_47_763 | 237 |
| 569 | 3300049652 | Ga0501202_008710 | Ga0501202_008710_479_1204 | 237 |
| 570 | 3300049652 | Ga0501202_053011 | Ga0501202_053011_159_887 | 237 |
| 571 | 3300049705 | Ga0501225_0002360 | Ga0501225_0002360_1083_1823 | 237 |
| 572 | 3300049741 | Ga0501079_0054572 | Ga0501079_0054572_934_1650 | 237 |
| 573 | 3300049742 | Ga0501080_0001127 | Ga0501080_0001127_4275_4991 | 237 |
| 574 | 3300049742 | Ga0501080_0022902 | Ga0501080_0022902_2888_3604 | 237 |
| 575 | 3300049742 | Ga0501080_0052468 | Ga0501080_0052468_2397_3113 | 237 |
| 576 | 3300049742 | Ga0501080_0192926 | Ga0501080_0192926_818_1534 | 237 |
| 577 | 3300049742 | Ga0501080_0338260 | Ga0501080_0338260_147_863 | 237 |
| 578 | 3300049743 | Ga0501081_0017691 | Ga0501081_0017691_3959_4675 | 237 |
| 579 | 3300049744 | Ga0501083_0009033 | Ga0501083_0009033_5219_5935 | 237 |
| 580 | 3300049744 | Ga0501083_0056170 | Ga0501083_0056170_1705_2421 | 237 |
| 581 | 3300049762 | Ga0501265_001084 | Ga0501265_001084_1343_2065 | 237 |
| 582 | 3300049772 | Ga0501275_000135 | Ga0501275_000135_3438_4160 | 237 |
| 583 | 3300049822 | Ga0501035_0001149 | Ga0501035_0001149_18341_19057 | 237 |
| 584 | 3300049822 | Ga0501035_0149214 | Ga0501035_0149214_441_1157 | 237 |
| 585 | 3300049823 | Ga0501044_0003431 | Ga0501044_0003431_10652_11368 | 237 |
| 586 | 3300049823 | Ga0501044_0034792 | Ga0501044_0034792_1539_2255 | 237 |
| 587 | 3300049823 | Ga0501044_0228605 | Ga0501044_0228605_555_1271 | 237 |
| 588 | 3300049823 | Ga0501044_0269086 | Ga0501044_0269086_369_1085 | 237 |
| 589 | 3300049824 | Ga0501045_0009388 | Ga0501045_0009388_2413_3129 | 237 |
| 590 | 3300049824 | Ga0501045_0245086 | Ga0501045_0245086_563_1279 | 237 |
| 591 | 3300050491 | nmdc:mga00v17_108907_c1 | nmdc:mga00v17_108907_c1_220_942 | 237 |
| 592 | 3300050491 | nmdc:mga00v17_200_c1 | nmdc:mga00v17_200_c1_6912_7634 | 237 |
| 593 | 3300053087 | Ga0500643_003586 | Ga0500643_003586_4210_4956 | 237 |
| 594 | 3300053093 | Ga0500651_0000297 | Ga0500651_0000297_5920_6636 | 237 |
| 595 | 3300053093 | Ga0500651_0004553 | Ga0500651_0004553_1406_2122 | 237 |
| 596 | 3300053120 | Ga0500597_000205 | Ga0500597_000205_2780_3526 | 237 |
| 597 | 3300053139 | Ga0500568_0003667 | Ga0500568_0003667_56_772 | 237 |
| 598 | 3300053161 | Ga0500634_0000582 | Ga0500634_0000582_8867_9589 | 237 |
| 599 | 3300054114 | Ga0501084_0028932 | Ga0501084_0028932_2999_3715 | 237 |
| 600 | 3300054114 | Ga0501084_0036845 | Ga0501084_0036845_2127_2843 | 237 |
| 601 | 3300060353 | Ga0501082_0000728 | Ga0501082_0000728_22334_23050 | 237 |
| 602 | 3300060353 | Ga0501082_0043533 | Ga0501082_0043533_1659_2375 | 237 |
| 603 | 3300060353 | Ga0501082_0114854 | Ga0501082_0114854_1098_1814 | 237 |
| 604 | 3300060353 | Ga0501082_0129723 | Ga0501082_0129723_467_1183 | 237 |
| 605 | iso_pu_bacteria | 2571042365 | 2572255484 | 237 |
| 606 | iso_pu_bacteria | 2643221559 | 2643817962 | 237 |
| 607 | iso_pu_bacteria | 2643221573 | 2643880127 | 237 |
| 608 | iso_pu_bacteria | 2643221586 | 2643937620 | 237 |
| 609 | iso_pu_bacteria | 2643221593 | 2643975247 | 237 |
| 610 | iso_pu_bacteria | 2643221612 | 2644078534 | 237 |
| 611 | iso_pu_bacteria | 2643221695 | 2644527926 | 237 |
| 612 | iso_pu_bacteria | 2643221720 | 2644662324 | 237 |
| 613 | iso_pu_bacteria | 2643221727 | 2644693311 | 237 |
| 614 | iso_pu_bacteria | 2643221728 | 2644698784 | 237 |
| 615 | iso_pu_bacteria | 2895498888 | 2895502010 | 237 |
| 616 | iso_pu_bacteria | 2895511927 | 2895517037 | 237 |
| 617 | iso_pu_bacteria | 2895522137 | 2895524567 | 237 |
| 618 | iso_pu_bacteria | 2895525241 | 2895525876 | 237 |
| 619 | iso_pu_bacteria | 2941489479 | 2941492654 | 237 |
| 620 | iso_pu_bacteria | 2995948881 | 2995953889 | 237 |
| 621 | iso_pu_bacteria | 8002869464 | 8002870511 | 237 |
| 622 | 3300003371 | JGI26145J50221_1001441 | JGI26145J50221_10014412 | 238 |
| 623 | 3300003503 | JGI26141J51220_1002698 | JGI26141J51220_10026982 | 238 |
| 624 | 3300005293 | Ga0065715_10124790 | Ga0065715_101247903 | 238 |
| 625 | 3300005329 | Ga0070683_100471253 | Ga0070683_1004712532 | 238 |
| 626 | 3300005331 | Ga0070670_100093679 | Ga0070670_1000936792 | 238 |
| 627 | 3300005344 | Ga0070661_100084608 | Ga0070661_1000846082 | 238 |
| 628 | 3300005353 | Ga0070669_100012531 | Ga0070669_1000125317 | 238 |
| 629 | 3300005353 | Ga0070669_100201861 | Ga0070669_1002018611 | 238 |
| 630 | 3300005355 | Ga0070671_100328878 | Ga0070671_1003288782 | 238 |
| 631 | 3300005438 | Ga0070701_10043807 | Ga0070701_100438072 | 238 |
| 632 | 3300005543 | Ga0070672_100009029 | Ga0070672_1000090294 | 238 |
| 633 | 3300005548 | Ga0070665_100562364 | Ga0070665_1005623641 | 238 |
| 634 | 3300005563 | Ga0068855_100915226 | Ga0068855_1009152262 | 238 |
| 635 | 3300005616 | Ga0068852_100000604 | Ga0068852_10000060417 | 238 |
| 636 | 3300009148 | Ga0105243_10224988 | Ga0105243_102249882 | 238 |
| 637 | 3300013308 | Ga0157375_10125738 | Ga0157375_101257383 | 238 |
| 638 | 3300025294 | Ga0209025_1004726 | Ga0209025_10047268 | 238 |
| 639 | 3300025923 | Ga0207681_10065182 | Ga0207681_100651824 | 238 |
| 640 | 3300025925 | Ga0207650_10015567 | Ga0207650_100155672 | 238 |
| 641 | 3300025926 | Ga0207659_10164930 | Ga0207659_101649302 | 238 |
| 642 | 3300025931 | Ga0207644_10181693 | Ga0207644_101816932 | 238 |
| 643 | 3300025933 | Ga0207706_10609788 | Ga0207706_106097881 | 238 |
| 644 | 3300025937 | Ga0207669_10325524 | Ga0207669_103255242 | 238 |
| 645 | 3300025940 | Ga0207691_10012595 | Ga0207691_100125952 | 238 |
| 646 | 3300025949 | Ga0207667_11008976 | Ga0207667_110089761 | 238 |
| 647 | 3300026142 | Ga0207698_10043287 | Ga0207698_100432872 | 238 |
| 648 | 3300026142 | Ga0207698_10441865 | Ga0207698_104418652 | 238 |
| 649 | 3300027364 | Ga0209967_1012379 | Ga0209967_10123792 | 238 |
| 650 | 3300027424 | Ga0209984_1001378 | Ga0209984_10013783 | 238 |
| 651 | 3300027462 | Ga0210000_1011804 | Ga0210000_10118042 | 238 |
| 652 | 3300027543 | Ga0209999_1004979 | Ga0209999_10049792 | 238 |
| 653 | 3300027552 | Ga0209982_1002346 | Ga0209982_10023464 | 238 |
| 654 | 3300027665 | Ga0209983_1000709 | Ga0209983_10007095 | 238 |
| 655 | 3300027682 | Ga0209971_1001818 | Ga0209971_10018186 | 238 |
| 656 | 3300027876 | Ga0209974_10005300 | Ga0209974_100053004 | 238 |
| 657 | 3300031456 | Ga0307513_10018587 | Ga0307513_100185874 | 238 |
| 658 | 3300032004 | Ga0307414_10000490 | Ga0307414_100004905 | 238 |
| 659 | 3300033179 | Ga0307507_10077351 | Ga0307507_100773514 | 238 |
| 660 | 3300037312 | Ga0395899_0153258 | Ga0395899_0153258_650_1375 | 238 |
| 661 | 3300037312 | Ga0395899_0234970 | Ga0395899_0234970_318_1055 | 238 |
| 662 | 3300037418 | Ga0395900_0051479 | Ga0395900_0051479_957_1682 | 238 |
| 663 | 3300037418 | Ga0395900_0156442 | Ga0395900_0156442_322_1059 | 238 |
| 664 | 3300037471 | Ga0395905_0001151 | Ga0395905_0001151_5345_6070 | 238 |
| 665 | 3300041406 | Ga0439439_0060223 | Ga0439439_0060223_79_849 | 238 |
| 666 | 3300041453 | Ga0451797_0356747 | Ga0451797_0356747_170_952 | 238 |
| 667 | 3300041494 | Ga0451837_1187473 | Ga0451837_1187473_660_1391 | 238 |
| 668 | 3300041509 | Ga0451843_1336202 | Ga0451843_1336202_383_1114 | 238 |
| 669 | 3300042007 | Ga0439449_0003367 | Ga0439449_0003367_273_1043 | 238 |
| 670 | 3300046460 | Ga0495638_0073120 | Ga0495638_0073120_774_1538 | 238 |
| 671 | 3300046525 | Ga0495663_0029743 | Ga0495663_0029743_83_823 | 238 |
| 672 | 3300046525 | Ga0495663_0089770 | Ga0495663_0089770_83_823 | 238 |
| 673 | 3300046537 | Ga0495598_0015241 | Ga0495598_0015241_797_1534 | 238 |
| 674 | 3300046539 | Ga0495621_0061477 | Ga0495621_0061477_261_998 | 238 |
| 675 | 3300046692 | Ga0495671_0010287 | Ga0495671_0010287_2750_3490 | 238 |
| 676 | 3300048905 | Ga0496102_0293251 | Ga0496102_0293251_686_1426 | 238 |
| 677 | 3300048925 | Ga0496122_0036940 | Ga0496122_0036940_1452_2183 | 238 |
| 678 | 3300048926 | Ga0496123_0006515 | Ga0496123_0006515_5884_6615 | 238 |
| 679 | 3300049569 | Ga0501032_0041805 | Ga0501032_0041805_221_961 | 238 |
| 680 | 3300049574 | Ga0501038_0095997 | Ga0501038_0095997_166_906 | 238 |
| 681 | 3300049579 | Ga0501043_0088867 | Ga0501043_0088867_1163_1903 | 238 |
| 682 | 3300049581 | Ga0501047_0426413 | Ga0501047_0426413_141_881 | 238 |
| 683 | 3300049823 | Ga0501044_0367971 | Ga0501044_0367971_415_1155 | 238 |
| 684 | 3300005339 | Ga0070660_100662229 | Ga0070660_1006622291 | 239 |
| 685 | 3300005366 | Ga0070659_100303267 | Ga0070659_1003032672 | 239 |
| 686 | 3300005564 | Ga0070664_100370383 | Ga0070664_1003703832 | 239 |
| 687 | 3300013104 | Ga0157370_10151912 | Ga0157370_101519122 | 239 |
| 688 | 3300013105 | Ga0157369_10087264 | Ga0157369_100872642 | 239 |
| 689 | 3300025917 | Ga0207660_10430079 | Ga0207660_104300791 | 239 |
| 690 | 3300025919 | Ga0207657_10182101 | Ga0207657_101821011 | 239 |
| 691 | 3300031730 | Ga0307516_10025758 | Ga0307516_100257585 | 239 |
| 692 | 3300031911 | Ga0307412_10037333 | Ga0307412_100373334 | 239 |
| 693 | 3300032002 | Ga0307416_100004229 | Ga0307416_1000042294 | 239 |
| 694 | 3300041509 | Ga0451843_1341863 | Ga0451843_1341863_11_733 | 239 |
| 695 | 3300049571 | Ga0501034_0028818 | Ga0501034_0028818_3697_4428 | 239 |
| 696 | 3300049571 | Ga0501034_0285713 | Ga0501034_0285713_25_747 | 239 |
| 697 | 3300049572 | Ga0501036_0004973 | Ga0501036_0004973_656_1387 | 239 |
| 698 | 3300049573 | Ga0501037_0024190 | Ga0501037_0024190_162_893 | 239 |
| 699 | 3300049574 | Ga0501038_0034942 | Ga0501038_0034942_143_874 | 239 |
| 700 | 3300049580 | Ga0501046_0009063 | Ga0501046_0009063_14_736 | 239 |
| 701 | 3300049744 | Ga0501083_0144523 | Ga0501083_0144523_11_733 | 239 |
| 702 | 3300049822 | Ga0501035_0010515 | Ga0501035_0010515_834_1565 | 239 |
| 703 | 3300049823 | Ga0501044_0371265 | Ga0501044_0371265_212_934 | 239 |
| 704 | iso_pu_bacteria | 2643221579 | 2643907670 | 240 |
| 705 | iso_pu_bacteria | 2923516293 | 2923516528 | 240 |
| 706 | 3300032005 | Ga0307411_10041362 | Ga0307411_100413624 | 241 |
| 707 | 3300030733 | Ga0314311_1005669 | Ga0314311_10056692 | 243 |
| 708 | 3300032004 | Ga0307414_10599618 | Ga0307414_105996182 | 243 |
| 709 | 3300041404 | Ga0439436_0086789 | Ga0439436_0086789_44_805 | 243 |
| 710 | 3300049568 | Ga0501031_0037656 | Ga0501031_0037656_510_1268 | 243 |
| 711 | 3300049570 | Ga0501033_0000847 | Ga0501033_0000847_6887_7633 | 243 |
| 712 | iso_pu_bacteria | 2643221581 | 2643914067 | 243 |
| 713 | 2162886007 | SwRhRL2b_contig_670719 | SwRhRL2b_0519.00003540 | 244 |
| 714 | 3300005289 | Ga0065704_10070599 | Ga0065704_1007059912 | 244 |
| 715 | 3300032004 | Ga0307414_10016037 | Ga0307414_100160375 | 244 |
| 716 | 3300049571 | Ga0501034_0000980 | Ga0501034_0000980_38992_39750 | 244 |
| 717 | iso_pu_bacteria | 2643221579 | 2643909208 | 244 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ekp-assembly1.cif.gz_A | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) | 0.8485 | 1 | 194 |
| 5eke-assembly1.cif.gz_A | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) | 0.8481 | 1 | 194 |
| 5mm0-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) | 0.8358 | 2 | 229 |
| 5eke-assembly1.cif.gz_D | structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) | 0.8023 | 1 | 221 |
| 5mm1-assembly1.cif.gz_A | dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose | 0.7832 | 4 | 229 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8WSL9_63_329_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8562 | 2 | 228 | 3.90.550.10 |
| af_P77293_1_188_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8553 | 2 | 181 | 3.90.550.10 |
| af_K7MVE2_46_307_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8476 | 1 | 210 | 3.90.550.10 |
| af_O60061_43_318_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8429 | 2 | 225 | 3.90.550.10 |
| af_A4ICW5_2_228_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8299 | 4 | 220 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523V6E2-F1-model_v4 | Glycosyltransferase | 0.9776 | 2 | 112 |
GO:0005886
GO:0016757 |
| AF-A0A7C4KIH1-F1-model_v4 | Glycosyltransferase | 0.9567 | 4 | 113 |
GO:0005886
GO:0016757 |
| AF-A0A086CFE5-F1-model_v4 | Glycosyl transferase | 0.9539 | 2 | 107 |
GO:0005886
GO:0016757 |
| AF-A0A2T2RJQ4-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9453 | 2 | 227 |
GO:0005886
GO:0099621 |
| AF-W2D0Y6-F1-model_v4 | Glycosyltransferase 2-like domain-containing protein | 0.9441 | 1 | 113 |
GO:0005886
GO:0016757 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar