F477100

General Info

Members Datasets Scaffolds Average Seq Length
717 307 708 367

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10015760|Ga0105237_100157603
Length 415
Sequence MQLSACRHPNVLIILFINFIHSRNDCPAAFTIAALRFIKTFSNTKNPVTMSLTSRREVLKTLALASGAACFSPNVLLAATRRKKEKLGIALVGLGYYSTDLLSPALQQTKNCYLAGIVTGTPAKAEAWKAKYNIPDKNIYNYESFDKIANNDDIDVIYVVLPPSMHKEYVIRAANAGKHVFCEKPMAITAVECKAMIDACNKNKRSLAIGYRLHHEPNTQEYTRIINNKLLGKVKKMSCAAGYTENRTNHWKQKKEMGGGVLYDMGVYAIQGARLGTGMEPVEIVSAKTSTTRPEIYKNGLDETTVAQLEFPGGVLADIKTSFGENINFLTVNCEKGDIKMEPYSGYNGLQGSSPLGSINYPYDVPWQQAKQLDDDTMAIMQGKPMLVPGEEGLRDIRIVEAIYKCAGSGQRVTI

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
5 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
6 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
7 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
184 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
185 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
191 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
201 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
204 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
205 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
214 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
215 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
216 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
220 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
221 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
222 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
223 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
226 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
227 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
228 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
229 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
251 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
265 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
266 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
267 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
268 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
269 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
270 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
274 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
275 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
276 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
277 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
278 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
279 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
280 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
281 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
282 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
287 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
299 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
300 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0.14
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.58
Nodule 0
Rhizoplane 0.98
Rhizosphere 87.59
Stem 0
Stem Tuber 0
Unclassified 5.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10007776 3300001989 Bacteria 4011
2 JGI25153J46596_10000766 3300003215 Bacteria 19670
3 JGI25153J46596_10018149 3300003215 Bacteria 2743
4 rootH1_10033439 3300003316 Bacteria 30115
5 rootH2_10010010 3300003320 Bacteria 6137
6 rootH2_10217225 3300003320 Bacteria 3628
7 rootL2_10005471 3300003322 Bacteria 3464
8 rootL2_10058065 3300003322 Bacteria 10287
9 rootL2_10068274 3300003322 Bacteria 19040
10 rootL2_10077131 3300003322 Bacteria 2174
11 rootL2_10155085 3300003322 Bacteria 6787
12 rootL2_10235208 3300003322 Bacteria 5534
13 rootL2_10282538 3300003322 Archaea 2105
14 rootL2_10302482 3300003322 Unclassified 2801
15 rootH1_10003268 3300003323 Bacteria 19976
16 rootH1_10008265 3300003323 Bacteria 10217
17 rootH1_10011937 3300003316 Bacteria 5065
18 rootH1_10011937 3300003323 Bacteria 7280
19 rootH1_10023828 3300003323 Bacteria 9527
20 rootH1_10096985 3300003323 Bacteria 3864
21 rootH1_10102452 3300003323 Bacteria 4655
22 rootH1_10105715 3300003323 Bacteria 2411
23 rootH1_10119811 3300003323 Bacteria 7048
24 rootH1_10387958 3300003323 Unclassified 1660
25 JGI25160J50197_1000863 3300003354 Bacteria 16119
26 JGI25160J50197_1021239 3300003354 Bacteria 1936
27 Ga0055526_1018304 3300003771 Bacteria 2620
28 Ga0055528_1002478 3300003790 Bacteria 9868
29 Ga0055530_10009262 3300003791 Bacteria 3812
30 Ga0055531_10000435 3300003794 Bacteria 39538
31 Ga0058863_11707405 3300004799 Bacteria 2848
32 Ga0065165_1000043 3300005262 Bacteria 203850
33 Ga0065165_1000219 3300005262 Bacteria 100119
34 Ga0065712_10145165 3300005290 Bacteria 1415
35 Ga0070658_10081100 3300005327 Bacteria 2665
36 Ga0070676_10198100 3300005328 Bacteria 1315
37 Ga0070683_100074968 3300005329 Unclassified 3160
38 Ga0070683_100340248 3300005329 Bacteria 1429
39 Ga0070690_100009302 3300005330 Bacteria 5689
40 Ga0070670_100032495 3300005331 Bacteria 4494
41 Ga0070670_100133952 3300005331 Unclassified 2141
42 Ga0070670_100156661 3300005331 Bacteria 1973
43 Ga0070677_10000400 3300005333 Bacteria 15144
44 Ga0068869_100015239 3300005334 Bacteria 5152
45 Ga0068869_100017422 3300005334 Bacteria 4868
46 Ga0068869_100021471 3300005334 Unclassified 4442
47 Ga0068869_100042642 3300005334 Bacteria 3254
48 Ga0068869_100239344 3300005334 Bacteria 1445
49 Ga0070666_10000138 3300005335 Bacteria 50719
50 Ga0070666_10045688 3300005335 Bacteria 2936
51 Ga0070680_100072172 3300005336 Unclassified 2837
52 Ga0070682_100037733 3300005337 Bacteria 2960
53 Ga0070682_100158626 3300005337 Bacteria 1560
54 Ga0068868_100002592 3300005338 Bacteria 12529
55 Ga0068868_100014395 3300005338 Bacteria 5831
56 Ga0068868_100080951 3300005338 Bacteria 2603
57 Ga0068868_100083152 3300005338 Unclassified 2569
58 Ga0068868_100165677 3300005338 Bacteria 1828
59 Ga0068868_100182786 3300005338 Bacteria 1740
60 Ga0070660_100128464 3300005339 Bacteria 2026
61 Ga0070660_100136450 3300005339 Bacteria 1966
62 Ga0070689_100000797 3300005340 Bacteria 19388
63 Ga0070689_100057636 3300005340 Bacteria 3015
64 Ga0070689_100140712 3300005340 Bacteria 1940
65 Ga0070689_100345343 3300005340 Bacteria 1247
66 Ga0070687_100082748 3300005343 Unclassified 1756
67 Ga0070661_100010000 3300005344 Bacteria 6583
68 Ga0070668_100052230 3300005347 Unclassified 3150
69 Ga0070668_100063629 3300005347 Bacteria 2860
70 Ga0070668_100069315 3300005347 Bacteria 2743
71 Ga0070668_100193559 3300005347 Bacteria 1666
72 Ga0070669_100028232 3300005353 Bacteria 4041
73 Ga0070669_100037494 3300005353 Bacteria 3517
74 Ga0070675_100006161 3300005354 Bacteria 9195
75 Ga0070675_100080373 3300005354 Bacteria 2717
76 Ga0070675_100130221 3300005354 Bacteria 2143
77 Ga0070671_100164849 3300005355 Bacteria 1874
78 Ga0070674_100009539 3300005356 Bacteria 5813
79 Ga0070674_100051483 3300005356 Bacteria 2838
80 Ga0070674_100083274 3300005356 Unclassified 2290
81 Ga0070674_100099853 3300005356 Bacteria 2112
82 Ga0070674_100141716 3300005356 Bacteria 1804
83 Ga0070673_100012837 3300005364 Bacteria 5767
84 Ga0070673_100014554 3300005364 Bacteria 5485
85 Ga0070673_100047596 3300005364 Bacteria 3337
86 Ga0070673_100375445 3300005364 Bacteria 1267
87 Ga0070688_100036747 3300005365 Unclassified 2980
88 Ga0070688_100077384 3300005365 Unclassified 2143
89 Ga0070659_100010682 3300005366 Bacteria 6763
90 Ga0070659_100032648 3300005366 Unclassified 4039
91 Ga0070659_100049299 3300005366 Bacteria 3311
92 Ga0070667_100001467 3300005367 Bacteria 21123
93 Ga0070667_100145082 3300005367 Bacteria 2081
94 Ga0070700_100048188 3300005441 Bacteria 2640
95 Ga0070700_100112425 3300005441 Bacteria 1813
96 Ga0070678_100048685 3300005456 Bacteria 3054
97 Ga0070678_100204861 3300005456 Bacteria 1631
98 Ga0070678_100224535 3300005456 Bacteria 1563
99 Ga0070678_100341033 3300005456 Unclassified 1285
100 Ga0070662_100066547 3300005457 Bacteria 2644
101 Ga0070681_10043616 3300005458 Unclassified 4491
102 Ga0068867_100009217 3300005459 Bacteria 6968
103 Ga0068867_100026116 3300005459 Bacteria 4192
104 Ga0068867_100252211 3300005459 Bacteria 1435
105 Ga0070685_10022566 3300005466 Bacteria 3432
106 Ga0070685_10034947 3300005466 Bacteria 2834
107 Ga0070699_100107997 3300005518 Bacteria 2442
108 Ga0070679_100032976 3300005530 Bacteria 5125
109 Ga0070684_100002054 3300005535 Bacteria 14821
110 Ga0070684_100043586 3300005535 Bacteria 3875
111 Ga0070684_100290550 3300005535 Bacteria 1499
112 Ga0068853_100048688 3300005539 Unclassified 3642
113 Ga0068853_100070352 3300005539 Bacteria 3046
114 Ga0068853_100232818 3300005539 Bacteria 1686
115 Ga0070672_100036103 3300005543 Bacteria 3763
116 Ga0070672_100045621 3300005543 Bacteria 3391
117 Ga0070672_100061580 3300005543 Bacteria 2959
118 Ga0070672_100211327 3300005543 Unclassified 1625
119 Ga0070672_100261311 3300005543 Bacteria 1460
120 Ga0070686_100058855 3300005544 Bacteria 2474
121 Ga0070696_100172879 3300005546 Bacteria 1598
122 Ga0070693_100043222 3300005547 Bacteria 2544
123 Ga0070665_100000016 3300005548 Bacteria 451538
124 Ga0070665_100003454 3300005548 Bacteria 16836
125 Ga0070665_100052967 3300005548 Bacteria 4070
126 Ga0070665_100362309 3300005548 Bacteria 1456
127 Ga0070704_100258070 3300005549 Bacteria 1434
128 Ga0068855_100002311 3300005563 Bacteria 23570
129 Ga0068855_100013738 3300005563 Bacteria 9760
130 Ga0068855_100076505 3300005563 Unclassified 3884
131 Ga0068855_100226959 3300005563 Unclassified 2093
132 Ga0070664_100011247 3300005564 Bacteria 7260
133 Ga0070664_100013959 3300005564 Bacteria 6550
134 Ga0070664_100182491 3300005564 Bacteria 1866
135 Ga0068857_100103626 3300005577 Bacteria 2554
136 Ga0068857_100216660 3300005577 Bacteria 1748
137 Ga0068854_100028862 3300005578 Unclassified 3837
138 Ga0070702_100002295 3300005615 Bacteria 8198
139 Ga0070702_100013127 3300005615 Bacteria 4174
140 Ga0068852_100062071 3300005616 Bacteria 3249
141 Ga0068852_100433798 3300005616 Bacteria 1298
142 Ga0068859_100000086 3300005617 Bacteria 85696
143 Ga0068859_100019258 3300005617 Bacteria 6857
144 Ga0068859_100058356 3300005617 Bacteria 3887
145 Ga0068859_100328809 3300005617 Bacteria 1623
146 Ga0068864_100013839 3300005618 Bacteria 6685
147 Ga0068864_100017294 3300005618 Bacteria 6010
148 Ga0068864_100053363 3300005618 Bacteria 3487
149 Ga0068864_100074765 3300005618 Unclassified 2956
150 Ga0068866_10049789 3300005718 Bacteria 2125
151 Ga0068866_10053909 3300005718 Bacteria 2058
152 Ga0068866_10054269 3300005718 Bacteria 2053
153 Ga0068861_100003410 3300005719 Bacteria 10545
154 Ga0068861_100003537 3300005719 Bacteria 10386
155 Ga0068861_100033659 3300005719 Unclassified 3783
156 Ga0068861_100046232 3300005719 Bacteria 3281
157 Ga0068861_100057903 3300005719 Bacteria 2961
158 Ga0068861_100086968 3300005719 Bacteria 2458
159 Ga0068861_100413759 3300005719 Bacteria 1200
160 Ga0068851_10005291 3300005834 Bacteria 5857
161 Ga0068870_10029303 3300005840 Bacteria 2771
162 Ga0068863_100009150 3300005841 Bacteria 9667
163 Ga0068863_100010890 3300005841 Bacteria 8818
164 Ga0068863_100017951 3300005841 Bacteria 6771
165 Ga0068863_100041315 3300005841 Bacteria 4384
166 Ga0068863_100124869 3300005841 Bacteria 2455
167 Ga0068863_100128733 3300005841 Bacteria 2416
168 Ga0068863_100301641 3300005841 Bacteria 1554
169 Ga0068858_100017405 3300005842 Bacteria 6742
170 Ga0068860_100000006 3300005843 Bacteria 461966
171 Ga0068860_100002840 3300005843 Bacteria 17998
172 Ga0068860_100012354 3300005843 Bacteria 8413
173 Ga0068860_100024871 3300005843 Bacteria 5781
174 Ga0068860_100085545 3300005843 Bacteria 3001
175 Ga0068860_100154901 3300005843 Bacteria 2208
176 Ga0068860_100205263 3300005843 Unclassified 1911
177 Ga0068862_100013075 3300005844 Bacteria 6866
178 Ga0068862_100188425 3300005844 Bacteria 1855
179 Ga0068862_100360587 3300005844 Bacteria 1351
180 Ga0081455_10008109 3300005937 Bacteria 10962
181 Ga0081539_10000816 3300005985 Bacteria 60353
182 Ga0081539_10008031 3300005985 Bacteria 9351
183 Ga0075364_10000088 3300006051 Bacteria 36693
184 Ga0075366_10070479 3300006195 Unclassified 2082
185 Ga0097621_100006601 3300006237 Bacteria 8240
186 Ga0097621_100008063 3300006237 Bacteria 7563
187 Ga0097621_100029627 3300006237 Bacteria 4325
188 Ga0097621_100070868 3300006237 Unclassified 2879
189 Ga0097621_100110567 3300006237 Bacteria 2321
190 Ga0097621_100115064 3300006237 Bacteria 2276
191 Ga0068871_100001606 3300006358 Bacteria 15201
192 Ga0068871_100019167 3300006358 Bacteria 5221
193 Ga0068871_100028555 3300006358 Bacteria 4374
194 Ga0068871_100177883 3300006358 Bacteria 1827
195 Ga0068871_100206891 3300006358 Bacteria 1696
196 Ga0068871_100215039 3300006358 Bacteria 1664
197 Ga0068871_100229040 3300006358 Bacteria 1612
198 Ga0068871_100259740 3300006358 Bacteria 1515
199 Ga0075428_100013628 3300006844 Bacteria 9053
200 Ga0075428_100045822 3300006844 Bacteria 4805
201 Ga0075428_100106726 3300006844 Bacteria 3053
202 Ga0075428_100186233 3300006844 Bacteria 2246
203 Ga0075428_100199519 3300006844 Bacteria 2163
204 Ga0075430_100014626 3300006846 Bacteria 6684
205 Ga0075431_100014855 3300006847 Bacteria 7882
206 Ga0075431_100018946 3300006847 Bacteria 7012
207 Ga0075429_100000105 3300006880 Bacteria 47284
208 Ga0075429_100000606 3300006880 Bacteria 27574
209 Ga0075429_100181704 3300006880 Unclassified 1843
210 Ga0068865_100028700 3300006881 Bacteria 3685
211 Ga0068865_100045075 3300006881 Bacteria 3022
212 Ga0068865_100130124 3300006881 Bacteria 1885
213 Ga0068865_100130575 3300006881 Bacteria 1882
214 Ga0097620_100000086 3300006931 Bacteria 85696
215 Ga0097620_100019258 3300006931 Bacteria 6857
216 Ga0097620_100058359 3300006931 Bacteria 3887
217 Ga0097620_100328781 3300006931 Bacteria 1623
218 Ga0105240_10000328 3300009093 Bacteria 89466
219 Ga0105240_10008271 3300009093 Bacteria 14892
220 Ga0105240_10016663 3300009093 Bacteria 9940
221 Ga0105240_10023977 3300009093 Bacteria 8060
222 Ga0105240_10039408 3300009093 Bacteria 6050
223 Ga0111539_10005241 3300009094 Bacteria 16795
224 Ga0111539_10012104 3300009094 Bacteria 10823
225 Ga0111539_10033434 3300009094 Bacteria 6242
226 Ga0111539_10057540 3300009094 Bacteria 4616
227 Ga0111539_10446284 3300009094 Bacteria 1506
228 Ga0105247_10004124 3300009101 Bacteria 9325
229 Ga0114129_10002392 3300009147 Bacteria 26071
230 Ga0114129_10055251 3300009147 Bacteria 5566
231 Ga0114129_10112735 3300009147 Bacteria 3750
232 Ga0105243_10069969 3300009148 Unclassified 2832
233 Ga0105243_10125853 3300009148 Bacteria 2168
234 Ga0105241_10000403 3300009174 Bacteria 32619
235 Ga0105241_10001753 3300009174 Bacteria 16461
236 Ga0105241_10097566 3300009174 Bacteria 2330
237 Ga0105241_10175695 3300009174 Bacteria 1772
238 Ga0105241_10196839 3300009174 Bacteria 1681
239 Ga0105242_10238637 3300009176 Unclassified 1633
240 Ga0105242_10271125 3300009176 Unclassified 1537
241 Ga0105248_10665160 3300009177 Unclassified 1175
242 Ga0105237_10002164 3300009545 Bacteria 24675
243 Ga0105237_10002660 3300009545 Bacteria 21961
244 Ga0105237_10007945 3300009545 Bacteria 11560
245 Ga0105237_10015760 3300009545 Bacteria 7860
246 Ga0105237_10018209 3300009545 Bacteria 7269
247 Ga0105237_10036552 3300009545 Bacteria 4971
248 Ga0105237_10068168 3300009545 Bacteria 3552
249 Ga0105237_10113106 3300009545 Bacteria 2707
250 Ga0105238_10127922 3300009551 Bacteria 2518
251 Ga0105238_10286858 3300009551 Bacteria 1628
252 Ga0105249_10009844 3300009553 Bacteria 8378
253 Ga0105249_10013748 3300009553 Bacteria 7148
254 Ga0105249_10101072 3300009553 Bacteria 2712
255 Ga0105249_10168166 3300009553 Bacteria 2124
256 Ga0105249_10218971 3300009553 Bacteria 1872
257 Ga0105239_10000101 3300010375 Bacteria 119610
258 Ga0105239_10005300 3300010375 Bacteria 15146
259 Ga0105239_10015372 3300010375 Bacteria 8479
260 Ga0105239_10020208 3300010375 Bacteria 7346
261 Ga0105239_10023231 3300010375 Bacteria 6833
262 Ga0105239_10478336 3300010375 Bacteria 1415
263 Ga0105246_10007061 3300011119 Bacteria 6875
264 Ga0105246_10018901 3300011119 Bacteria 4395
265 Ga0105246_10033670 3300011119 Bacteria 3408
266 Ga0157373_10003137 3300013100 Bacteria 12489
267 Ga0157373_10019920 3300013100 Bacteria 4880
268 Ga0157373_10038045 3300013100 Unclassified 3448
269 Ga0157371_10182197 3300013102 Bacteria 1502
270 Ga0157370_10015201 3300013104 Bacteria 7838
271 Ga0157370_10015874 3300013104 Bacteria 7641
272 Ga0157369_10029201 3300013105 Bacteria 6096
273 Ga0157369_10036494 3300013105 Bacteria 5384
274 Ga0157374_10000029 3300013296 Bacteria 211547
275 Ga0157374_10002518 3300013296 Bacteria 15459
276 Ga0157374_10009357 3300013296 Bacteria 8407
277 Ga0157374_10022675 3300013296 Bacteria 5603
278 Ga0157374_10228827 3300013296 Bacteria 1826
279 Ga0157374_10229327 3300013296 Unclassified 1824
280 Ga0157374_10274678 3300013296 Bacteria 1662
281 Ga0157374_10457765 3300013296 Unclassified 1278
282 Ga0157378_10002981 3300013297 Bacteria 15034
283 Ga0157378_10014684 3300013297 Bacteria 6861
284 Ga0157378_10036566 3300013297 Bacteria 4346
285 Ga0157378_10045202 3300013297 Bacteria 3912
286 Ga0157378_10062832 3300013297 Bacteria 3317
287 Ga0157378_10195028 3300013297 Unclassified 1913
288 Ga0157378_10279760 3300013297 Unclassified 1608
289 Ga0163162_10000355 3300013306 Bacteria 41762
290 Ga0163162_10003500 3300013306 Bacteria 15011
291 Ga0163162_10006493 3300013306 Bacteria 11324
292 Ga0163162_10032916 3300013306 Bacteria 5149
293 Ga0163162_10101459 3300013306 Bacteria 2969
294 Ga0163162_10190355 3300013306 Bacteria 2179
295 Ga0163162_10236468 3300013306 Bacteria 1957
296 Ga0157372_10006751 3300013307 Bacteria 12201
297 Ga0157372_10035569 3300013307 Bacteria 5484
298 Ga0157372_10105613 3300013307 Bacteria 3221
299 Ga0157372_10220850 3300013307 Bacteria 2197
300 Ga0157372_10235796 3300013307 Bacteria 2122
301 Ga0157375_10000207 3300013308 Bacteria 54636
302 Ga0157375_10046071 3300013308 Bacteria 4249
303 Ga0157375_10066270 3300013308 Bacteria 3604
304 Ga0157375_10106141 3300013308 Bacteria 2900
305 Ga0157375_10127200 3300013308 Bacteria 2664
306 Ga0157375_10142343 3300013308 Bacteria 2526
307 Ga0157375_10159336 3300013308 Unclassified 2398
308 Ga0157375_10167901 3300013308 Bacteria 2340
309 Ga0157375_10184107 3300013308 Bacteria 2241
310 Ga0157375_10235105 3300013308 Bacteria 1992
311 Ga0163163_10075457 3300014325 Bacteria 3365
312 Ga0163163_10177947 3300014325 Unclassified 2174
313 Ga0163163_10192403 3300014325 Bacteria 2088
314 Ga0157380_10000443 3300014326 Bacteria 25341
315 Ga0157380_10002654 3300014326 Bacteria 12120
316 Ga0157380_10011948 3300014326 Bacteria 6282
317 Ga0157380_10013569 3300014326 Bacteria 5948
318 Ga0157380_10048129 3300014326 Bacteria 3357
319 Ga0157380_10172883 3300014326 Bacteria 1890
320 Ga0157380_10178839 3300014326 Unclassified 1862
321 Ga0157380_10261892 3300014326 Bacteria 1571
322 Ga0157380_10450270 3300014326 Bacteria 1236
323 Ga0157377_10025096 3300014745 Bacteria 3176
324 Ga0157377_10072696 3300014745 Bacteria 1991
325 Ga0157379_10024379 3300014968 Bacteria 5371
326 Ga0157379_10216518 3300014968 Bacteria 1735
327 Ga0157379_10323816 3300014968 Bacteria 1407
328 Ga0157379_10329740 3300014968 Unclassified 1394
329 Ga0157376_10002108 3300014969 Bacteria 13383
330 Ga0157376_10021073 3300014969 Bacteria 5057
331 Ga0157376_10088629 3300014969 Bacteria 2673
332 Ga0157376_10164905 3300014969 Bacteria 2012
333 Ga0157376_10311592 3300014969 Bacteria 1493
334 Ga0157376_10330992 3300014969 Bacteria 1451
335 Ga0182005_1000280 3300015265 Bacteria 32088
336 Ga0163161_10004389 3300017792 Bacteria 9834
337 Ga0163161_10004778 3300017792 Bacteria 9431
338 Ga0163161_10144685 3300017792 Bacteria 1802
339 Ga0213876_10005477 3300021384 Bacteria 6969
340 Ga0209436_101063 3300025208 Bacteria 10401
341 Ga0209646_1000003 3300025246 Bacteria 1160860
342 Ga0209646_1001862 3300025246 Bacteria 5193
343 Ga0209026_1000614 3300025250 Bacteria 22834
344 Ga0209673_1000962 3300025273 Bacteria 35913
345 Ga0209676_1000584 3300025292 Bacteria 54694
346 Ga0209564_1003078 3300025295 Bacteria 11823
347 Ga0209758_1002110 3300025297 Bacteria 21061
348 Ga0209758_1011568 3300025297 Bacteria 5085
349 Ga0209050_1000561 3300025298 Bacteria 60726
350 Ga0207426_1000093 3300025302 Bacteria 277663
351 Ga0207426_1000187 3300025302 Bacteria 153809
352 Ga0207426_1015489 3300025302 Bacteria 2761
353 Ga0209257_1000005 3300025304 Bacteria 1592528
354 Ga0209257_1010390 3300025304 Bacteria 4720
355 Ga0207682_10013064 3300025893 Bacteria 3237
356 Ga0207682_10069148 3300025893 Bacteria 1493
357 Ga0207642_10016957 3300025899 Bacteria 2758
358 Ga0207642_10078093 3300025899 Bacteria 1599
359 Ga0207688_10014165 3300025901 Bacteria 4338
360 Ga0207680_10193039 3300025903 Bacteria 1383
361 Ga0207647_10020994 3300025904 Bacteria 4367
362 Ga0207645_10000193 3300025907 Bacteria 49552
363 Ga0207645_10000279 3300025907 Bacteria 42459
364 Ga0207645_10001124 3300025907 Bacteria 22129
365 Ga0207645_10007389 3300025907 Bacteria 7770
366 Ga0207643_10002695 3300025908 Bacteria 9596
367 Ga0207643_10008261 3300025908 Bacteria 5588
368 Ga0207643_10022145 3300025908 Bacteria 3497
369 Ga0207643_10022803 3300025908 Bacteria 3450
370 Ga0207643_10038307 3300025908 Bacteria 2692
371 Ga0207654_10028214 3300025911 Bacteria 3059
372 Ga0207695_10001513 3300025913 Bacteria 38611
373 Ga0207695_10002144 3300025913 Bacteria 29897
374 Ga0207695_10044421 3300025913 Unclassified 4726
375 Ga0207695_10046762 3300025913 Bacteria 4584
376 Ga0207695_10137474 3300025913 Bacteria 2395
377 Ga0207671_10002804 3300025914 Bacteria 18168
378 Ga0207671_10003963 3300025914 Bacteria 14397
379 Ga0207671_10005605 3300025914 Bacteria 11520
380 Ga0207671_10008668 3300025914 Bacteria 8586
381 Ga0207671_10019962 3300025914 Bacteria 5111
382 Ga0207671_10025430 3300025914 Bacteria 4447
383 Ga0207671_10130845 3300025914 Bacteria 1926
384 Ga0207662_10049696 3300025918 Bacteria 2488
385 Ga0207657_10005188 3300025919 Bacteria 13665
386 Ga0207657_10092518 3300025919 Bacteria 2520
387 Ga0207657_10167202 3300025919 Bacteria 1783
388 Ga0207649_10068462 3300025920 Bacteria 2257
389 Ga0207649_10112130 3300025920 Bacteria 1824
390 Ga0207652_10000093 3300025921 Bacteria 98248
391 Ga0207681_10018827 3300025923 Bacteria 4355
392 Ga0207681_10122224 3300025923 Bacteria 1911
393 Ga0207681_10258681 3300025923 Bacteria 1362
394 Ga0207694_10206118 3300025924 Bacteria 1601
395 Ga0207650_10106496 3300025925 Bacteria 2165
396 Ga0207659_10006163 3300025926 Bacteria 7334
397 Ga0207659_10031482 3300025926 Unclassified 3632
398 Ga0207659_10283410 3300025926 Bacteria 1355
399 Ga0207659_10300091 3300025926 Bacteria 1319
400 Ga0207700_10078365 3300025928 Bacteria 2570
401 Ga0207690_10014232 3300025932 Bacteria 4801
402 Ga0207706_10037886 3300025933 Bacteria 4279
403 Ga0207706_10082970 3300025933 Unclassified 2817
404 Ga0207686_10002379 3300025934 Bacteria 10261
405 Ga0207686_10175111 3300025934 Bacteria 1516
406 Ga0207670_10002207 3300025936 Bacteria 10177
407 Ga0207670_10034377 3300025936 Bacteria 3275
408 Ga0207670_10280269 3300025936 Bacteria 1299
409 Ga0207669_10019354 3300025937 Unclassified 3543
410 Ga0207704_10013780 3300025938 Bacteria 4061
411 Ga0207704_10062827 3300025938 Bacteria 2311
412 Ga0207704_10072127 3300025938 Bacteria 2194
413 Ga0207704_10124733 3300025938 Unclassified 1770
414 Ga0207704_10159396 3300025938 Bacteria 1604
415 Ga0207691_10020637 3300025940 Bacteria 6228
416 Ga0207691_10033523 3300025940 Unclassified 4780
417 Ga0207691_10034558 3300025940 Bacteria 4700
418 Ga0207691_10063680 3300025940 Bacteria 3344
419 Ga0207691_10065070 3300025940 Bacteria 3302
420 Ga0207691_10066517 3300025940 Bacteria 3260
421 Ga0207691_10078777 3300025940 Unclassified 2966
422 Ga0207691_10107322 3300025940 Bacteria 2486
423 Ga0207689_10001574 3300025942 Bacteria 21618
424 Ga0207689_10005101 3300025942 Bacteria 11812
425 Ga0207689_10006249 3300025942 Bacteria 10556
426 Ga0207689_10016558 3300025942 Bacteria 6239
427 Ga0207689_10027543 3300025942 Bacteria 4755
428 Ga0207689_10029959 3300025942 Bacteria 4538
429 Ga0207689_10041176 3300025942 Bacteria 3822
430 Ga0207689_10046666 3300025942 Bacteria 3580
431 Ga0207689_10051265 3300025942 Bacteria 3402
432 Ga0207689_10114379 3300025942 Bacteria 2218
433 Ga0207661_10016817 3300025944 Bacteria 5400
434 Ga0207661_10017076 3300025944 Bacteria 5362
435 Ga0207661_10050302 3300025944 Bacteria 3320
436 Ga0207679_10006182 3300025945 Bacteria 7560
437 Ga0207679_10040417 3300025945 Bacteria 3338
438 Ga0207679_10298365 3300025945 Bacteria 1388
439 Ga0207667_10003174 3300025949 Bacteria 20328
440 Ga0207667_10134411 3300025949 Bacteria 2547
441 Ga0207667_10211102 3300025949 Unclassified 1990
442 Ga0207651_10011488 3300025960 Bacteria 4961
443 Ga0207651_10037260 3300025960 Bacteria 3185
444 Ga0207651_10099594 3300025960 Unclassified 2153
445 Ga0207712_10007096 3300025961 Bacteria 7066
446 Ga0207712_10008345 3300025961 Bacteria 6543
447 Ga0207712_10064471 3300025961 Bacteria 2612
448 Ga0207712_10349203 3300025961 Bacteria 1229
449 Ga0207668_10032790 3300025972 Bacteria 3437
450 Ga0207640_10201131 3300025981 Bacteria 1510
451 Ga0207658_10008348 3300025986 Bacteria 7052
452 Ga0207677_10193738 3300026023 Bacteria 1610
453 Ga0207703_10013272 3300026035 Bacteria 6417
454 Ga0207639_10036027 3300026041 Unclassified 3664
455 Ga0207639_10185266 3300026041 Bacteria 1774
456 Ga0207678_10016529 3300026067 Bacteria 6479
457 Ga0207708_10014031 3300026075 Bacteria 5985
458 Ga0207708_10030440 3300026075 Bacteria 4092
459 Ga0207708_10050880 3300026075 Bacteria 3154
460 Ga0207702_10011501 3300026078 Bacteria 7373
461 Ga0207702_10146011 3300026078 Bacteria 2146
462 Ga0207702_10229277 3300026078 Bacteria 1735
463 Ga0207641_10000061 3300026088 Bacteria 160161
464 Ga0207641_10001165 3300026088 Bacteria 26454
465 Ga0207641_10107164 3300026088 Bacteria 2471
466 Ga0207641_10409354 3300026088 Bacteria 1304
467 Ga0207648_10004327 3300026089 Bacteria 14627
468 Ga0207648_10007665 3300026089 Bacteria 10566
469 Ga0207648_10066730 3300026089 Bacteria 3137
470 Ga0207648_10077588 3300026089 Unclassified 2896
471 Ga0207648_10099073 3300026089 Bacteria 2552
472 Ga0207648_10198308 3300026089 Bacteria 1780
473 Ga0207648_10203134 3300026089 Bacteria 1758
474 Ga0207676_10012851 3300026095 Bacteria 6012
475 Ga0207676_10265381 3300026095 Bacteria 1552
476 Ga0207674_10006014 3300026116 Bacteria 14353
477 Ga0207674_10069011 3300026116 Bacteria 3555
478 Ga0207674_10094746 3300026116 Bacteria 2972
479 Ga0207674_10121792 3300026116 Bacteria 2575
480 Ga0207674_10147747 3300026116 Unclassified 2308
481 Ga0207675_100003242 3300026118 Bacteria 15948
482 Ga0207675_100013361 3300026118 Bacteria 7661
483 Ga0207675_100034715 3300026118 Bacteria 4704
484 Ga0207675_100038225 3300026118 Bacteria 4478
485 Ga0207675_100096291 3300026118 Unclassified 2786
486 Ga0207675_100105919 3300026118 Bacteria 2651
487 Ga0207675_100153605 3300026118 Bacteria 2192
488 Ga0207683_10001985 3300026121 Bacteria 18106
489 Ga0207683_10002587 3300026121 Bacteria 15805
490 Ga0207683_10005259 3300026121 Bacteria 11109
491 Ga0207683_10028416 3300026121 Bacteria 4836
492 Ga0207698_10032736 3300026142 Bacteria 3769
493 Ga0207698_10053125 3300026142 Bacteria 3108
494 Ga0207698_10075351 3300026142 Bacteria 2696
495 Ga0209974_10024879 3300027876 Bacteria 1981
496 Ga0207428_10186678 3300027907 Unclassified 1564
497 Ga0207428_10212738 3300027907 Bacteria 1452
498 Ga0268266_10000149 3300028379 Bacteria 134809
499 Ga0268266_10081142 3300028379 Bacteria 2827
500 Ga0268266_10133298 3300028379 Bacteria 2224
501 Ga0268265_10049918 3300028380 Bacteria 3150
502 Ga0268265_10169008 3300028380 Bacteria 1866
503 Ga0268265_10357801 3300028380 Bacteria 1335
504 Ga0268264_10000064 3300028381 Bacteria 301274
505 Ga0268264_10005438 3300028381 Bacteria 10791
506 Ga0268264_10017824 3300028381 Bacteria 5812
507 Ga0268264_10037388 3300028381 Bacteria 4003
508 Ga0268264_10040678 3300028381 Bacteria 3841
509 Ga0268264_10128374 3300028381 Bacteria 2244
510 Ga0268264_10135630 3300028381 Bacteria 2188
511 Ga0268264_10274058 3300028381 Bacteria 1577
512 Ga0265336_10041509 3300028666 Bacteria 1406
513 Ga0307515_10031913 3300028794 Bacteria 8750
514 Ga0307515_10072264 3300028794 Bacteria 4660
515 Ga0265320_10001749 3300031240 Bacteria 15394
516 Ga0307513_10017090 3300031456 Bacteria 8717
517 Ga0307513_10021862 3300031456 Bacteria 7538
518 Ga0307513_10158870 3300031456 Bacteria 2156
519 Ga0307509_10032616 3300031507 Bacteria 5739
520 Ga0307509_10060648 3300031507 Bacteria 3997
521 Ga0307509_10097570 3300031507 Bacteria 2987
522 Ga0307509_10128864 3300031507 Bacteria 2490
523 Ga0307408_100065279 3300031548 Bacteria 2669
524 Ga0307508_10000052 3300031616 Bacteria 129344
525 Ga0307508_10000425 3300031616 Bacteria 50122
526 Ga0316576_10025408 3300031727 Unclassified 4147
527 Ga0316576_10059748 3300031727 Unclassified 2791
528 Ga0316578_10138094 3300031728 Bacteria 1468
529 Ga0307405_10151283 3300031731 Unclassified 1632
530 Ga0307413_10001643 3300031824 Bacteria 8666
531 Ga0307410_10128870 3300031852 Unclassified 1856
532 Ga0307406_10064141 3300031901 Bacteria 2383
533 Ga0307406_10110878 3300031901 Bacteria 1889
534 Ga0307407_10004105 3300031903 Bacteria 6127
535 Ga0307407_10044350 3300031903 Bacteria 2506
536 Ga0307407_10053432 3300031903 Bacteria 2324
537 Ga0307412_10031068 3300031911 Bacteria 3369
538 Ga0307412_10231195 3300031911 Unclassified 1424
539 Ga0307409_100008128 3300031995 Bacteria 6338
540 Ga0307409_100008129 3300031995 Bacteria 6338
541 Ga0307416_100002761 3300032002 Bacteria 10193
542 Ga0307416_100129054 3300032002 Bacteria 2271
543 Ga0307416_100328727 3300032002 Unclassified 1535
544 Ga0307414_10000021 3300032004 Bacteria 213521
545 Ga0307414_10009337 3300032004 Bacteria 5629
546 Ga0307414_10028590 3300032004 Bacteria 3618
547 Ga0307414_10168513 3300032004 Bacteria 1748
548 Ga0307414_10191614 3300032004 Bacteria 1655
549 Ga0307411_10173876 3300032005 Unclassified 1627
550 Ga0307415_100075560 3300032126 Bacteria 2385
551 Ga0373928_0000580 3300035084 Bacteria 7191
552 Ga0373953_0074295 3300035117 Bacteria 1406
553 Ga0373943_0100061 3300035170 Bacteria 1515
554 Ga0373927_0019622 3300035695 Bacteria 4432
555 Ga0373947_0047085 3300035725 Bacteria 2583
556 Ga0316582_0008001 3300036647 Archaea 5657
557 Ga0395899_0000001 3300037312 Bacteria 1750322
558 Ga0395900_0055523 3300037418 Unclassified 4078
559 Ga0395905_0000737 3300037471 Bacteria 43081
560 Ga0395905_0080252 3300037471 Bacteria 3058
561 Ga0395905_0097874 3300037471 Unclassified 2755
562 Ga0436365_1354401 3300039437 Bacteria 12100
563 Ga0451789_0136231 3300041443 Bacteria 1215
564 Ga0451791_1150138 3300041451 Bacteria 3013
565 Ga0451797_0598084 3300041453 Bacteria 1185
566 Ga0451798_0094830 3300041458 Bacteria 1867
567 Ga0451807_1542018 3300041486 Bacteria 2092
568 Ga0451807_2585360 3300041486 Bacteria 5257
569 Ga0451853_2458528 3300041512 Bacteria 1580
570 Ga0439442_007186 3300042002 Bacteria 2240
571 Ga0439449_0023577 3300042007 Bacteria 2301
572 Ga0439457_014352 3300042014 Unclassified 1773
573 Ga0450898_014017 3300042134 Bacteria 1343
574 Ga0450899_003069 3300042135 Bacteria 1801
575 Ga0451577_0007245 3300042876 Bacteria 10930
576 Ga0451577_0011066 3300042876 Bacteria 8569
577 Ga0451577_0479263 3300042876 Bacteria 1129
578 Ga0466969_0000399 3300044656 Bacteria 23843
579 Ga0466972_0000027 3300044658 Bacteria 174082
580 Ga0466972_0000038 3300044658 Bacteria 135937
581 Ga0466972_0001168 3300044658 Bacteria 12577
582 Ga0466972_0012027 3300044658 Bacteria 4348
583 Ga0466972_0051935 3300044658 Bacteria 1977
584 Ga0466966_0019820 3300044684 Bacteria 4423
585 Ga0453684_0000549 3300044712 Bacteria 141927
586 Ga0453684_0028193 3300044712 Bacteria 8024
587 Ga0453684_0076844 3300044712 Unclassified 4190
588 Ga0453684_0122492 3300044712 Bacteria 3137
589 Ga0453684_0147300 3300044712 Bacteria 2802
590 Ga0466968_0039794 3300044735 Bacteria 1980
591 Ga0466959_0000011 3300045049 Bacteria 173387
592 Ga0451576_0003363 3300045051 Bacteria 22150
593 Ga0495627_017509 3300046453 Bacteria 2433
594 Ga0495590_0003661 3300046457 Bacteria 6257
595 Ga0495638_0000020 3300046460 Bacteria 372434
596 Ga0495638_0108767 3300046460 Bacteria 1649
597 Ga0495664_0062271 3300046477 Unclassified 2222
598 Ga0495664_0132110 3300046477 Bacteria 1512
599 Ga0495616_0003820 3300046513 Bacteria 9602
600 Ga0495632_0153839 3300046519 Bacteria 1062
601 Ga0495648_0001120 3300046524 Bacteria 27151
602 Ga0495587_0019757 3300046536 Bacteria 4165
603 Ga0495587_0073474 3300046536 Bacteria 1987
604 Ga0495633_0018045 3300046558 Bacteria 3589
605 Ga0495668_0007170 3300046616 Bacteria 7165
606 Ga0495611_0000099 3300046648 Bacteria 60428
607 Ga0495625_0084319 3300046660 Bacteria 2207
608 Ga0495625_0114616 3300046660 Bacteria 1840
609 Ga0495604_0091570 3300047317 Unclassified 2255
610 Ga0495672_0010307 3300047320 Bacteria 6677
611 Ga0495672_0013741 3300047320 Bacteria 5571
612 Ga0495672_0128448 3300047320 Bacteria 1337
613 Ga0495687_000158 3300047443 Bacteria 103129
614 Ga0495675_0069091 3300047444 Unclassified 2231
615 Ga0495684_0070533 3300047471 Bacteria 2657
616 Ga0496104_0171454 3300048907 Bacteria 2081
617 Ga0496124_0162877 3300048927 Bacteria 1737
618 Ga0501298_016836 3300049521 Bacteria 1329
619 Ga0501031_0116488 3300049568 Bacteria 1745
620 Ga0501032_0002056 3300049569 Bacteria 15891
621 Ga0501033_0000748 3300049570 Bacteria 29907
622 Ga0501034_0019490 3300049571 Bacteria 6938
623 Ga0501034_0142306 3300049571 Bacteria 2377
624 Ga0501034_0291970 3300049571 Unclassified 1568
625 Ga0501036_0034543 3300049572 Bacteria 4277
626 Ga0501037_0002859 3300049573 Bacteria 12519
627 Ga0501037_0153501 3300049573 Bacteria 1644
628 Ga0501038_0001234 3300049574 Bacteria 23204
629 Ga0501038_0015182 3300049574 Bacteria 7007
630 Ga0501042_0031920 3300049578 Bacteria 3727
631 Ga0501043_0009431 3300049579 Bacteria 7661
632 Ga0501043_0010043 3300049579 Bacteria 7425
633 Ga0501043_0195902 3300049579 Bacteria 1569
634 Ga0501046_0002099 3300049580 Bacteria 18888
635 Ga0501047_0005561 3300049581 Bacteria 11865
636 Ga0501047_0035937 3300049581 Bacteria 4787
637 Ga0501047_0098430 3300049581 Bacteria 2803
638 Ga0501047_0141165 3300049581 Bacteria 2287
639 Ga0501047_0190767 3300049581 Bacteria 1913
640 Ga0501048_0053093 3300049582 Bacteria 2883
641 Ga0501067_0006365 3300049583 Bacteria 6540
642 Ga0501068_0000585 3300049584 Bacteria 18482
643 Ga0501070_0016579 3300049586 Bacteria 6188
644 Ga0501071_0008837 3300049587 Bacteria 6678
645 Ga0501072_0144945 3300049588 Bacteria 1894
646 Ga0501073_0011782 3300049589 Bacteria 6383
647 Ga0501074_0009290 3300049590 Bacteria 7140
648 Ga0501076_0052809 3300049592 Bacteria 3220
649 Ga0501077_0000980 3300049593 Bacteria 17208
650 Ga0501202_000294 3300049652 Bacteria 6851
651 Ga0501217_029450 3300049661 Bacteria 1343
652 Ga0501223_003903 3300049663 Bacteria 3219
653 Ga0501223_016989 3300049663 Bacteria 1437
654 Ga0501224_004619 3300049664 Bacteria 1959
655 Ga0501235_004698 3300049669 Bacteria 2955
656 Ga0501242_004225 3300049674 Bacteria 1589
657 Ga0501243_000060 3300049675 Bacteria 10743
658 Ga0501257_025025 3300049686 Bacteria 1419
659 Ga0501257_032032 3300049686 Bacteria 1270
660 Ga0501225_0001832 3300049705 Bacteria 6659
661 Ga0501225_0003149 3300049705 Bacteria 5040
662 Ga0501225_0005591 3300049705 Bacteria 3683
663 Ga0501234_003841 3300049707 Unclassified 2363
664 Ga0501079_0000653 3300049741 Bacteria 23159
665 Ga0501080_0001948 3300049742 Bacteria 17823
666 Ga0501080_0206044 3300049742 Bacteria 1804
667 Ga0501083_0093390 3300049744 Bacteria 1986
668 Ga0501264_000050 3300049761 Bacteria 16836
669 Ga0501266_003291 3300049763 Bacteria 2009
670 Ga0501035_0000115 3300049822 Bacteria 98344
671 Ga0501035_0017694 3300049822 Bacteria 6573
672 Ga0501035_0068866 3300049822 Bacteria 3137
673 Ga0501035_0285520 3300049822 Bacteria 1394
674 Ga0501044_0000027 3300049823 Bacteria 181388
675 Ga0501044_0007409 3300049823 Bacteria 12068
676 Ga0501044_0165502 3300049823 Bacteria 2185
677 Ga0501044_0272675 3300049823 Bacteria 1627
678 Ga0501212_011777 3300049851 Bacteria 1265
679 nmdc:mga00v17_582_c2 3300050491 Bacteria 10150
680 nmdc:mga05p37_2387_c1 3300050507 Bacteria 21852
681 nmdc:mga05p37_42353_c1 3300050507 Bacteria 5594
682 nmdc:mga09592_236206_c1 3300050508 Bacteria 1584
683 nmdc:mga09592_46734_c1 3300050508 Unclassified 3647
684 nmdc:mga0qj67_25750_c1 3300050509 Bacteria 4549
685 nmdc:mga06r32_57778_c1 3300050510 Unclassified 3727
686 nmdc:mga06r32_84417_c1 3300050510 Bacteria 3095
687 nmdc:mga08y16_160734_c1 3300050511 Bacteria 2334
688 nmdc:mga08y16_198554_c1 3300050511 Bacteria 2079
689 nmdc:mga08y16_205082_c1 3300050511 Bacteria 2043
690 nmdc:mga08y16_48682_c1 3300050511 Unclassified 4435
691 nmdc:mga08y16_8382_c1 3300050511 Bacteria 10814
692 Ga0500578_0000009 3300053086 Bacteria 219807
693 Ga0500646_0043331 3300053090 Bacteria 1274
694 Ga0500583_0000036 3300053092 Bacteria 95404
695 Ga0500583_0000666 3300053092 Bacteria 10123
696 Ga0500583_0001637 3300053092 Bacteria 6517
697 Ga0500583_0036919 3300053092 Bacteria 2191
698 Ga0500651_0019024 3300053093 Bacteria 4260
699 Ga0500568_0000346 3300053139 Bacteria 36068
700 Ga0500568_0098148 3300053139 Bacteria 1100
701 Ga0500588_0057524 3300053146 Bacteria 1234
702 Ga0500616_0000007 3300053153 Bacteria 836875
703 Ga0500616_0008695 3300053153 Bacteria 6269
704 Ga0500622_0001640 3300053156 Bacteria 17525
705 Ga0500622_0006324 3300053156 Bacteria 6908
706 Ga0500622_0026835 3300053156 Bacteria 3038
707 Ga0501084_0044840 3300054114 Bacteria 3702
708 Ga0501082_0020527 3300060353 Bacteria 5694

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046519 Ga0495632_0153839 Ga0495632_0153839_17_958 305
2 3300039437 Ga0436365_1354401 Ga0436365_1354401_801_1781 318
3 3300044684 Ga0466966_0019820 Ga0466966_0019820_3421_4401 318
4 3300042876 Ga0451577_0011066 Ga0451577_0011066_1965_3098 331
5 3300044712 Ga0453684_0028193 Ga0453684_0028193_1866_2999 331
6 3300045051 Ga0451576_0003363 Ga0451576_0003363_15739_16872 331
7 3300014325 Ga0163163_10177947 Ga0163163_101779472 333
8 3300025908 Ga0207643_10038307 Ga0207643_100383072 334
9 3300050508 nmdc:mga09592_46734_c1 nmdc:mga09592_46734_c1_330_1340 335
10 3300050509 nmdc:mga0qj67_25750_c1 nmdc:mga0qj67_25750_c1_296_1306 335
11 iso_pu_bacteria 2818991442 2819576038 335
12 3300049822 Ga0501035_0285520 Ga0501035_0285520_326_1366 336
13 3300041443 Ga0451789_0136231 Ga0451789_0136231_17_1054 337
14 3300014326 Ga0157380_10013569 Ga0157380_100135692 338
15 3300027907 Ga0207428_10186678 Ga0207428_101866781 338
16 3300009094 Ga0111539_10033434 Ga0111539_100334344 339
17 3300050511 nmdc:mga08y16_160734_c1 nmdc:mga08y16_160734_c1_625_1794 339
18 3300046460 Ga0495638_0108767 Ga0495638_0108767_460_1530 341
19 3300046477 Ga0495664_0132110 Ga0495664_0132110_352_1413 341
20 3300046536 Ga0495587_0019757 Ga0495587_0019757_1009_2070 341
21 3300047444 Ga0495675_0069091 Ga0495675_0069091_265_1326 341
22 3300053092 Ga0500583_0001637 Ga0500583_0001637_4373_5443 341
23 3300042876 Ga0451577_0479263 Ga0451577_0479263_27_1067 342
24 3300044712 Ga0453684_0122492 Ga0453684_0122492_669_1709 342
25 3300047317 Ga0495604_0091570 Ga0495604_0091570_902_1960 342
26 3300053153 Ga0500616_0008695 Ga0500616_0008695_441_1487 343
27 3300037471 Ga0395905_0000737 Ga0395905_0000737_13693_14757 344
28 3300025926 Ga0207659_10283410 Ga0207659_102834102 346
29 3300026041 Ga0207639_10036027 Ga0207639_100360272 347
30 3300026116 Ga0207674_10147747 Ga0207674_101477472 347
31 3300031903 Ga0307407_10044350 Ga0307407_100443502 347
32 3300003322 rootL2_10282538 rootL2_102825383 348
33 3300053139 Ga0500568_0098148 Ga0500568_0098148_29_1075 348
34 3300035725 Ga0373947_0047085 Ga0373947_0047085_1050_2117 349
35 3300003322 rootL2_10302482 rootL2_103024821 350
36 3300003323 rootH1_10387958 rootH1_103879581 350
37 3300031727 Ga0316576_10025408 Ga0316576_100254086 350
38 3300036647 Ga0316582_0008001 Ga0316582_0008001_202_1362 350
39 3300005340 Ga0070689_100345343 Ga0070689_1003453431 351
40 3300005617 Ga0068859_100000086 Ga0068859_10000008656 351
41 3300005841 Ga0068863_100009150 Ga0068863_1000091508 351
42 3300005842 Ga0068858_100017405 Ga0068858_10001740511 351
43 3300005843 Ga0068860_100002840 Ga0068860_10000284014 351
44 3300006237 Ga0097621_100070868 Ga0097621_1000708682 351
45 3300006358 Ga0068871_100001606 Ga0068871_10000160611 351
46 3300006881 Ga0068865_100028700 Ga0068865_1000287003 351
47 3300006931 Ga0097620_100000086 Ga0097620_10000008628 351
48 3300013308 Ga0157375_10167901 Ga0157375_101679012 351
49 3300015265 Ga0182005_1000280 Ga0182005_100028027 351
50 3300025911 Ga0207654_10028214 Ga0207654_100282144 351
51 3300025938 Ga0207704_10013780 Ga0207704_100137803 351
52 3300026035 Ga0207703_10013272 Ga0207703_100132722 351
53 3300026088 Ga0207641_10000061 Ga0207641_10000061101 351
54 3300028381 Ga0268264_10017824 Ga0268264_100178245 351
55 3300028666 Ga0265336_10041509 Ga0265336_100415091 351
56 3300028794 Ga0307515_10072264 Ga0307515_100722642 351
57 3300032126 Ga0307415_100075560 Ga0307415_1000755602 351
58 3300046513 Ga0495616_0003820 Ga0495616_0003820_3179_4264 351
59 3300046660 Ga0495625_0084319 Ga0495625_0084319_607_1692 351
60 3300005337 Ga0070682_100037733 Ga0070682_1000377332 352
61 3300005466 Ga0070685_10022566 Ga0070685_100225662 352
62 3300005466 Ga0070685_10034947 Ga0070685_100349473 352
63 3300005578 Ga0068854_100028862 Ga0068854_1000288621 352
64 3300005844 Ga0068862_100188425 Ga0068862_1001884251 352
65 3300005937 Ga0081455_10008109 Ga0081455_100081092 352
66 3300028380 Ga0268265_10357801 Ga0268265_103578011 352
67 3300031507 Ga0307509_10032616 Ga0307509_100326166 352
68 3300031727 Ga0316576_10059748 Ga0316576_100597482 352
69 3300031728 Ga0316578_10138094 Ga0316578_101380941 352
70 3300041453 Ga0451797_0598084 Ga0451797_0598084_55_1146 352
71 3300041486 Ga0451807_2585360 Ga0451807_2585360_975_2066 352
72 3300046457 Ga0495590_0003661 Ga0495590_0003661_4312_5397 352
73 3300049581 Ga0501047_0190767 Ga0501047_0190767_341_1432 352
74 iso_pu_bacteria 2919692658 2919697628 352
75 3300025208 Ga0209436_101063 Ga0209436_10106310 353
76 3300046460 Ga0495638_0000020 Ga0495638_0000020_66954_68021 353
77 3300049568 Ga0501031_0116488 Ga0501031_0116488_222_1331 353
78 3300049569 Ga0501032_0002056 Ga0501032_0002056_4532_5779 353
79 3300049570 Ga0501033_0000748 Ga0501033_0000748_24108_25355 353
80 3300049571 Ga0501034_0142306 Ga0501034_0142306_753_1862 353
81 3300049572 Ga0501036_0034543 Ga0501036_0034543_2533_3780 353
82 3300049573 Ga0501037_0153501 Ga0501037_0153501_184_1431 353
83 3300049574 Ga0501038_0001234 Ga0501038_0001234_18329_19576 353
84 3300049578 Ga0501042_0031920 Ga0501042_0031920_2421_3530 353
85 3300049579 Ga0501043_0195902 Ga0501043_0195902_450_1559 353
86 3300049581 Ga0501047_0098430 Ga0501047_0098430_631_1740 353
87 3300049582 Ga0501048_0053093 Ga0501048_0053093_758_1867 353
88 3300049652 Ga0501202_000294 Ga0501202_000294_4034_5146 353
89 3300049822 Ga0501035_0017694 Ga0501035_0017694_490_1737 353
90 3300049823 Ga0501044_0165502 Ga0501044_0165502_563_1810 353
91 3300005328 Ga0070676_10198100 Ga0070676_101981001 354
92 3300005331 Ga0070670_100032495 Ga0070670_1000324953 354
93 3300005331 Ga0070670_100133952 Ga0070670_1001339522 354
94 3300005333 Ga0070677_10000400 Ga0070677_100004006 354
95 3300005338 Ga0068868_100083152 Ga0068868_1000831522 354
96 3300005340 Ga0070689_100140712 Ga0070689_1001407122 354
97 3300005347 Ga0070668_100069315 Ga0070668_1000693154 354
98 3300005353 Ga0070669_100037494 Ga0070669_1000374942 354
99 3300005354 Ga0070675_100080373 Ga0070675_1000803732 354
100 3300005354 Ga0070675_100130221 Ga0070675_1001302212 354
101 3300005356 Ga0070674_100051483 Ga0070674_1000514832 354
102 3300005356 Ga0070674_100083274 Ga0070674_1000832741 354
103 3300005356 Ga0070674_100141716 Ga0070674_1001417162 354
104 3300005364 Ga0070673_100014554 Ga0070673_1000145542 354
105 3300005364 Ga0070673_100047596 Ga0070673_1000475963 354
106 3300005441 Ga0070700_100112425 Ga0070700_1001124251 354
107 3300005456 Ga0070678_100048685 Ga0070678_1000486852 354
108 3300005459 Ga0068867_100252211 Ga0068867_1002522112 354
109 3300005543 Ga0070672_100036103 Ga0070672_1000361032 354
110 3300005543 Ga0070672_100045621 Ga0070672_1000456212 354
111 3300005543 Ga0070672_100261311 Ga0070672_1002613111 354
112 3300005544 Ga0070686_100058855 Ga0070686_1000588552 354
113 3300005548 Ga0070665_100003454 Ga0070665_1000034549 354
114 3300005548 Ga0070665_100052967 Ga0070665_1000529672 354
115 3300005617 Ga0068859_100328809 Ga0068859_1003288092 354
116 3300005719 Ga0068861_100033659 Ga0068861_1000336593 354
117 3300005719 Ga0068861_100413759 Ga0068861_1004137591 354
118 3300005840 Ga0068870_10029303 Ga0068870_100293032 354
119 3300005841 Ga0068863_100041315 Ga0068863_1000413153 354
120 3300005843 Ga0068860_100012354 Ga0068860_1000123548 354
121 3300005844 Ga0068862_100360587 Ga0068862_1003605872 354
122 3300006237 Ga0097621_100006601 Ga0097621_1000066018 354
123 3300006237 Ga0097621_100110567 Ga0097621_1001105672 354
124 3300006358 Ga0068871_100215039 Ga0068871_1002150391 354
125 3300006358 Ga0068871_100229040 Ga0068871_1002290402 354
126 3300006881 Ga0068865_100130124 Ga0068865_1001301242 354
127 3300006931 Ga0097620_100328781 Ga0097620_1003287812 354
128 3300009094 Ga0111539_10446284 Ga0111539_104462841 354
129 3300009174 Ga0105241_10097566 Ga0105241_100975662 354
130 3300011119 Ga0105246_10007061 Ga0105246_100070618 354
131 3300013297 Ga0157378_10062832 Ga0157378_100628323 354
132 3300013306 Ga0163162_10190355 Ga0163162_101903552 354
133 3300013308 Ga0157375_10046071 Ga0157375_100460713 354
134 3300013308 Ga0157375_10184107 Ga0157375_101841072 354
135 3300014326 Ga0157380_10048129 Ga0157380_100481293 354
136 3300014326 Ga0157380_10261892 Ga0157380_102618922 354
137 3300014969 Ga0157376_10311592 Ga0157376_103115921 354
138 3300014969 Ga0157376_10330992 Ga0157376_103309921 354
139 3300021384 Ga0213876_10005477 Ga0213876_100054772 354
140 3300025893 Ga0207682_10013064 Ga0207682_100130642 354
141 3300025893 Ga0207682_10069148 Ga0207682_100691482 354
142 3300025901 Ga0207688_10014165 Ga0207688_100141653 354
143 3300025903 Ga0207680_10193039 Ga0207680_101930391 354
144 3300025907 Ga0207645_10000193 Ga0207645_1000019312 354
145 3300025908 Ga0207643_10002695 Ga0207643_100026959 354
146 3300025908 Ga0207643_10022145 Ga0207643_100221451 354
147 3300025908 Ga0207643_10022803 Ga0207643_100228032 354
148 3300025918 Ga0207662_10049696 Ga0207662_100496963 354
149 3300025920 Ga0207649_10068462 Ga0207649_100684622 354
150 3300025920 Ga0207649_10112130 Ga0207649_101121302 354
151 3300025925 Ga0207650_10106496 Ga0207650_101064962 354
152 3300025926 Ga0207659_10006163 Ga0207659_100061634 354
153 3300025926 Ga0207659_10031482 Ga0207659_100314822 354
154 3300025928 Ga0207700_10078365 Ga0207700_100783652 354
155 3300025936 Ga0207670_10034377 Ga0207670_100343772 354
156 3300025938 Ga0207704_10072127 Ga0207704_100721272 354
157 3300025938 Ga0207704_10124733 Ga0207704_101247332 354
158 3300025940 Ga0207691_10020637 Ga0207691_100206376 354
159 3300025940 Ga0207691_10063680 Ga0207691_100636802 354
160 3300025940 Ga0207691_10065070 Ga0207691_100650702 354
161 3300025940 Ga0207691_10066517 Ga0207691_100665171 354
162 3300025942 Ga0207689_10006249 Ga0207689_100062495 354
163 3300025942 Ga0207689_10046666 Ga0207689_100466661 354
164 3300025942 Ga0207689_10114379 Ga0207689_101143791 354
165 3300025960 Ga0207651_10037260 Ga0207651_100372603 354
166 3300026023 Ga0207677_10193738 Ga0207677_101937381 354
167 3300026075 Ga0207708_10030440 Ga0207708_100304403 354
168 3300026075 Ga0207708_10050880 Ga0207708_100508801 354
169 3300026088 Ga0207641_10107164 Ga0207641_101071643 354
170 3300026089 Ga0207648_10004327 Ga0207648_100043278 354
171 3300026089 Ga0207648_10066730 Ga0207648_100667303 354
172 3300026089 Ga0207648_10198308 Ga0207648_101983081 354
173 3300026118 Ga0207675_100013361 Ga0207675_1000133615 354
174 3300026121 Ga0207683_10001985 Ga0207683_100019853 354
175 3300026121 Ga0207683_10005259 Ga0207683_1000525912 354
176 3300028379 Ga0268266_10081142 Ga0268266_100811421 354
177 3300031456 Ga0307513_10017090 Ga0307513_100170905 354
178 3300031456 Ga0307513_10021862 Ga0307513_100218627 354
179 3300031507 Ga0307509_10097570 Ga0307509_100975702 354
180 3300031548 Ga0307408_100065279 Ga0307408_1000652793 354
181 3300031731 Ga0307405_10151283 Ga0307405_101512831 354
182 3300031824 Ga0307413_10001643 Ga0307413_100016435 354
183 3300031852 Ga0307410_10128870 Ga0307410_101288702 354
184 3300031903 Ga0307407_10004105 Ga0307407_100041052 354
185 3300031995 Ga0307409_100008129 Ga0307409_1000081294 354
186 3300032002 Ga0307416_100129054 Ga0307416_1001290541 354
187 3300032002 Ga0307416_100328727 Ga0307416_1003287272 354
188 3300032005 Ga0307411_10173876 Ga0307411_101738762 354
189 3300047320 Ga0495672_0128448 Ga0495672_0128448_67_1161 354
190 3300048927 Ga0496124_0162877 Ga0496124_0162877_340_1425 354
191 3300005339 Ga0070660_100136450 Ga0070660_1001364502 355
192 3300005355 Ga0070671_100164849 Ga0070671_1001648492 355
193 3300005441 Ga0070700_100048188 Ga0070700_1000481883 355
194 3300005458 Ga0070681_10043616 Ga0070681_100436162 355
195 3300005459 Ga0068867_100009217 Ga0068867_1000092176 355
196 3300005546 Ga0070696_100172879 Ga0070696_1001728791 355
197 3300005549 Ga0070704_100258070 Ga0070704_1002580701 355
198 3300005563 Ga0068855_100002311 Ga0068855_10000231113 355
199 3300005615 Ga0070702_100013127 Ga0070702_1000131274 355
200 3300005617 Ga0068859_100058356 Ga0068859_1000583561 355
201 3300005618 Ga0068864_100053363 Ga0068864_1000533631 355
202 3300005719 Ga0068861_100003410 Ga0068861_1000034102 355
203 3300005719 Ga0068861_100046232 Ga0068861_1000462323 355
204 3300005841 Ga0068863_100124869 Ga0068863_1001248691 355
205 3300005841 Ga0068863_100301641 Ga0068863_1003016411 355
206 3300005843 Ga0068860_100205263 Ga0068860_1002052632 355
207 3300006881 Ga0068865_100045075 Ga0068865_1000450752 355
208 3300006931 Ga0097620_100058359 Ga0097620_1000583591 355
209 3300009094 Ga0111539_10057540 Ga0111539_100575405 355
210 3300010375 Ga0105239_10005300 Ga0105239_100053009 355
211 3300013100 Ga0157373_10038045 Ga0157373_100380452 355
212 3300013308 Ga0157375_10106141 Ga0157375_101061413 355
213 3300014326 Ga0157380_10011948 Ga0157380_100119483 355
214 3300014326 Ga0157380_10172883 Ga0157380_101728832 355
215 3300025904 Ga0207647_10020994 Ga0207647_100209942 355
216 3300025914 Ga0207671_10025430 Ga0207671_100254303 355
217 3300025919 Ga0207657_10092518 Ga0207657_100925182 355
218 3300025921 Ga0207652_10000093 Ga0207652_1000009326 355
219 3300025923 Ga0207681_10122224 Ga0207681_101222242 355
220 3300025926 Ga0207659_10300091 Ga0207659_103000911 355
221 3300025938 Ga0207704_10062827 Ga0207704_100628272 355
222 3300025940 Ga0207691_10107322 Ga0207691_101073221 355
223 3300025944 Ga0207661_10050302 Ga0207661_100503023 355
224 3300025949 Ga0207667_10003174 Ga0207667_100031747 355
225 3300026041 Ga0207639_10185266 Ga0207639_101852662 355
226 3300026067 Ga0207678_10016529 Ga0207678_100165294 355
227 3300026075 Ga0207708_10014031 Ga0207708_100140315 355
228 3300026088 Ga0207641_10409354 Ga0207641_104093542 355
229 3300026089 Ga0207648_10007665 Ga0207648_100076659 355
230 3300026116 Ga0207674_10094746 Ga0207674_100947463 355
231 3300026118 Ga0207675_100034715 Ga0207675_1000347153 355
232 3300026118 Ga0207675_100105919 Ga0207675_1001059192 355
233 3300027907 Ga0207428_10212738 Ga0207428_102127381 355
234 3300028380 Ga0268265_10049918 Ga0268265_100499183 355
235 3300028794 Ga0307515_10031913 Ga0307515_100319136 355
236 3300031616 Ga0307508_10000425 Ga0307508_1000042517 355
237 3300031903 Ga0307407_10053432 Ga0307407_100534323 355
238 3300031995 Ga0307409_100008128 Ga0307409_1000081283 355
239 3300037418 Ga0395900_0055523 Ga0395900_0055523_2538_3647 355
240 3300037471 Ga0395905_0080252 Ga0395905_0080252_318_1427 355
241 3300044656 Ga0466969_0000399 Ga0466969_0000399_22713_23828 355
242 3300044658 Ga0466972_0051935 Ga0466972_0051935_693_1829 355
243 3300044735 Ga0466968_0039794 Ga0466968_0039794_769_1884 355
244 3300045049 Ga0466959_0000011 Ga0466959_0000011_169503_170618 355
245 3300049583 Ga0501067_0006365 Ga0501067_0006365_4987_6087 355
246 3300049584 Ga0501068_0000585 Ga0501068_0000585_9434_10534 355
247 3300049586 Ga0501070_0016579 Ga0501070_0016579_4888_5988 355
248 3300049587 Ga0501071_0008837 Ga0501071_0008837_224_1324 355
249 3300049589 Ga0501073_0011782 Ga0501073_0011782_4708_5808 355
250 3300049590 Ga0501074_0009290 Ga0501074_0009290_5579_6679 355
251 3300049592 Ga0501076_0052809 Ga0501076_0052809_1787_2887 355
252 3300049593 Ga0501077_0000980 Ga0501077_0000980_15862_16962 355
253 3300049741 Ga0501079_0000653 Ga0501079_0000653_10288_11388 355
254 3300049742 Ga0501080_0001948 Ga0501080_0001948_12627_13727 355
255 3300049744 Ga0501083_0093390 Ga0501083_0093390_400_1500 355
256 3300050511 nmdc:mga08y16_205082_c1 nmdc:mga08y16_205082_c1_336_1436 355
257 3300054114 Ga0501084_0044840 Ga0501084_0044840_867_1967 355
258 3300060353 Ga0501082_0020527 Ga0501082_0020527_906_2006 355
259 iso_pu_bacteria 2911138879 2911142533 355
260 3300003320 rootH2_10217225 rootH2_102172254 356
261 3300003323 rootH1_10011937 rootH1_100119379 356
262 3300005329 Ga0070683_100340248 Ga0070683_1003402481 356
263 3300005334 Ga0068869_100021471 Ga0068869_1000214718 356
264 3300005347 Ga0070668_100052230 Ga0070668_1000522305 356
265 3300005564 Ga0070664_100013959 Ga0070664_1000139596 356
266 3300005718 Ga0068866_10053909 Ga0068866_100539093 356
267 3300005719 Ga0068861_100003537 Ga0068861_1000035377 356
268 3300006358 Ga0068871_100177883 Ga0068871_1001778831 356
269 3300009147 Ga0114129_10002392 Ga0114129_1000239213 356
270 3300013100 Ga0157373_10019920 Ga0157373_100199203 356
271 3300013104 Ga0157370_10015874 Ga0157370_100158749 356
272 3300013296 Ga0157374_10457765 Ga0157374_104577651 356
273 3300013306 Ga0163162_10006493 Ga0163162_100064931 356
274 3300013307 Ga0157372_10105613 Ga0157372_101056134 356
275 3300025942 Ga0207689_10001574 Ga0207689_1000157412 356
276 3300027876 Ga0209974_10024879 Ga0209974_100248792 356
277 3300028381 Ga0268264_10274058 Ga0268264_102740582 356
278 3300031901 Ga0307406_10110878 Ga0307406_101108783 356
279 3300031911 Ga0307412_10031068 Ga0307412_100310683 356
280 3300032002 Ga0307416_100002761 Ga0307416_1000027611 356
281 3300035117 Ga0373953_0074295 Ga0373953_0074295_31_1134 356
282 3300037312 Ga0395899_0000001 Ga0395899_0000001_1614736_1615851 356
283 3300041451 Ga0451791_1150138 Ga0451791_1150138_295_1392 356
284 3300046536 Ga0495587_0073474 Ga0495587_0073474_163_1266 356
285 3300047471 Ga0495684_0070533 Ga0495684_0070533_159_1262 356
286 3300049686 Ga0501257_025025 Ga0501257_025025_170_1288 356
287 3300050507 nmdc:mga05p37_2387_c1 nmdc:mga05p37_2387_c1_7592_8707 356
288 3300053090 Ga0500646_0043331 Ga0500646_0043331_96_1214 356
289 3300053146 Ga0500588_0057524 Ga0500588_0057524_25_1131 356
290 iso_pu_bacteria 2522125168 2522550415 356
291 3300005330 Ga0070690_100009302 Ga0070690_1000093023 357
292 3300005518 Ga0070699_100107997 Ga0070699_1001079973 357
293 3300005563 Ga0068855_100076505 Ga0068855_1000765052 357
294 3300005618 Ga0068864_100017294 Ga0068864_1000172942 357
295 3300006844 Ga0075428_100186233 Ga0075428_1001862332 357
296 3300006880 Ga0075429_100000606 Ga0075429_10000060611 357
297 3300009553 Ga0105249_10168166 Ga0105249_101681662 357
298 3300013308 Ga0157375_10235105 Ga0157375_102351052 357
299 3300017792 Ga0163161_10004389 Ga0163161_100043896 357
300 3300026095 Ga0207676_10012851 Ga0207676_100128514 357
301 3300035084 Ga0373928_0000580 Ga0373928_0000580_5890_6987 357
302 3300037471 Ga0395905_0097874 Ga0395905_0097874_1659_2744 357
303 3300044712 Ga0453684_0147300 Ga0453684_0147300_1368_2489 357
304 3300049705 Ga0501225_0003149 Ga0501225_0003149_1617_2780 357
305 3300050508 nmdc:mga09592_236206_c1 nmdc:mga09592_236206_c1_88_1242 357
306 3300003322 rootL2_10005471 rootL2_100054712 358
307 3300004799 Ga0058863_11707405 Ga0058863_117074051 358
308 3300035170 Ga0373943_0100061 Ga0373943_0100061_372_1448 358
309 3300041458 Ga0451798_0094830 Ga0451798_0094830_435_1616 358
310 3300042007 Ga0439449_0023577 Ga0439449_0023577_475_1614 358
311 3300044658 Ga0466972_0000038 Ga0466972_0000038_8034_9110 358
312 3300049588 Ga0501072_0144945 Ga0501072_0144945_533_1717 358
313 3300003322 rootL2_10235208 rootL2_102352083 359
314 3300003794 Ga0055531_10000435 Ga0055531_1000043515 359
315 3300005337 Ga0070682_100158626 Ga0070682_1001586261 359
316 3300005340 Ga0070689_100000797 Ga0070689_1000007973 359
317 3300005365 Ga0070688_100077384 Ga0070688_1000773842 359
318 3300005563 Ga0068855_100226959 Ga0068855_1002269592 359
319 3300005841 Ga0068863_100017951 Ga0068863_1000179513 359
320 3300014326 Ga0157380_10178839 Ga0157380_101788392 359
321 3300025304 Ga0209257_1000005 Ga0209257_1000005903 359
322 3300025936 Ga0207670_10002207 Ga0207670_100022076 359
323 3300025949 Ga0207667_10211102 Ga0207667_102111022 359
324 3300028379 Ga0268266_10133298 Ga0268266_101332981 359
325 3300031240 Ga0265320_10001749 Ga0265320_100017492 359
326 3300031507 Ga0307509_10060648 Ga0307509_100606484 359
327 3300031616 Ga0307508_10000052 Ga0307508_1000005249 359
328 3300031901 Ga0307406_10064141 Ga0307406_100641413 359
329 3300035695 Ga0373927_0019622 Ga0373927_0019622_1471_2559 359
330 3300049580 Ga0501046_0002099 Ga0501046_0002099_12556_13647 359
331 3300049581 Ga0501047_0005561 Ga0501047_0005561_5102_6193 359
332 3300049761 Ga0501264_000050 Ga0501264_000050_6806_7894 359
333 3300049822 Ga0501035_0000115 Ga0501035_0000115_48534_49625 359
334 3300049823 Ga0501044_0000027 Ga0501044_0000027_16990_18081 359
335 3300003316 rootH1_10033439 rootH1_1003343929 360
336 3300003320 rootH2_10010010 rootH2_100100102 360
337 3300003322 rootL2_10058065 rootL2_100580657 360
338 3300003322 rootL2_10068274 rootL2_1006827418 360
339 3300003323 rootH1_10008265 rootH1_100082652 360
340 3300003323 rootH1_10023828 rootH1_100238287 360
341 3300003323 rootH1_10096985 rootH1_100969851 360
342 3300003323 rootH1_10119811 rootH1_101198115 360
343 3300005262 Ga0065165_1000043 Ga0065165_100004344 360
344 3300005334 Ga0068869_100017422 Ga0068869_1000174223 360
345 3300005334 Ga0068869_100239344 Ga0068869_1002393441 360
346 3300005338 Ga0068868_100165677 Ga0068868_1001656772 360
347 3300005347 Ga0070668_100193559 Ga0070668_1001935591 360
348 3300005353 Ga0070669_100028232 Ga0070669_1000282322 360
349 3300005356 Ga0070674_100099853 Ga0070674_1000998533 360
350 3300005364 Ga0070673_100012837 Ga0070673_1000128374 360
351 3300005364 Ga0070673_100375445 Ga0070673_1003754451 360
352 3300005367 Ga0070667_100145082 Ga0070667_1001450821 360
353 3300005459 Ga0068867_100026116 Ga0068867_1000261162 360
354 3300005718 Ga0068866_10049789 Ga0068866_100497891 360
355 3300005719 Ga0068861_100057903 Ga0068861_1000579031 360
356 3300005719 Ga0068861_100086968 Ga0068861_1000869682 360
357 3300006237 Ga0097621_100008063 Ga0097621_1000080637 360
358 3300006358 Ga0068871_100019167 Ga0068871_1000191674 360
359 3300006844 Ga0075428_100045822 Ga0075428_1000458222 360
360 3300006881 Ga0068865_100130575 Ga0068865_1001305752 360
361 3300009094 Ga0111539_10005241 Ga0111539_100052418 360
362 3300009094 Ga0111539_10012104 Ga0111539_100121045 360
363 3300009148 Ga0105243_10125853 Ga0105243_101258532 360
364 3300009174 Ga0105241_10175695 Ga0105241_101756952 360
365 3300009176 Ga0105242_10271125 Ga0105242_102711252 360
366 3300009553 Ga0105249_10101072 Ga0105249_101010722 360
367 3300013296 Ga0157374_10228827 Ga0157374_102288272 360
368 3300013297 Ga0157378_10195028 Ga0157378_101950282 360
369 3300013308 Ga0157375_10000207 Ga0157375_100002073 360
370 3300013308 Ga0157375_10127200 Ga0157375_101272002 360
371 3300014745 Ga0157377_10025096 Ga0157377_100250964 360
372 3300017792 Ga0163161_10004778 Ga0163161_100047781 360
373 3300025292 Ga0209676_1000584 Ga0209676_100058426 360
374 3300025899 Ga0207642_10078093 Ga0207642_100780931 360
375 3300025907 Ga0207645_10000279 Ga0207645_1000027940 360
376 3300025907 Ga0207645_10007389 Ga0207645_100073897 360
377 3300025908 Ga0207643_10008261 Ga0207643_100082612 360
378 3300025923 Ga0207681_10018827 Ga0207681_100188275 360
379 3300025933 Ga0207706_10037886 Ga0207706_100378865 360
380 3300025938 Ga0207704_10159396 Ga0207704_101593962 360
381 3300025940 Ga0207691_10034558 Ga0207691_100345582 360
382 3300025942 Ga0207689_10005101 Ga0207689_100051011 360
383 3300025942 Ga0207689_10027543 Ga0207689_100275433 360
384 3300025942 Ga0207689_10051265 Ga0207689_100512653 360
385 3300025961 Ga0207712_10064471 Ga0207712_100644712 360
386 3300025972 Ga0207668_10032790 Ga0207668_100327902 360
387 3300026078 Ga0207702_10011501 Ga0207702_100115012 360
388 3300026089 Ga0207648_10099073 Ga0207648_100990732 360
389 3300026089 Ga0207648_10203134 Ga0207648_102031343 360
390 3300026116 Ga0207674_10069011 Ga0207674_100690113 360
391 3300026118 Ga0207675_100003242 Ga0207675_1000032423 360
392 3300026118 Ga0207675_100038225 Ga0207675_1000382254 360
393 3300026121 Ga0207683_10002587 Ga0207683_1000258715 360
394 3300028381 Ga0268264_10005438 Ga0268264_100054389 360
395 3300031911 Ga0307412_10231195 Ga0307412_102311951 360
396 3300032004 Ga0307414_10009337 Ga0307414_100093373 360
397 3300042002 Ga0439442_007186 Ga0439442_007186_150_1238 360
398 3300042134 Ga0450898_014017 Ga0450898_014017_145_1239 360
399 3300042135 Ga0450899_003069 Ga0450899_003069_444_1538 360
400 3300044712 Ga0453684_0076844 Ga0453684_0076844_370_1461 360
401 3300050511 nmdc:mga08y16_48682_c1 nmdc:mga08y16_48682_c1_1454_2545 360
402 3300050511 nmdc:mga08y16_8382_c1 nmdc:mga08y16_8382_c1_4234_5325 360
403 3300053092 Ga0500583_0036919 Ga0500583_0036919_663_1760 360
404 3300053153 Ga0500616_0000007 Ga0500616_0000007_803815_804903 360
405 3300053156 Ga0500622_0006324 Ga0500622_0006324_3037_4125 360
406 3300006051 Ga0075364_10000088 Ga0075364_100000884 361
407 3300013307 Ga0157372_10035569 Ga0157372_100355693 361
408 3300032004 Ga0307414_10168513 Ga0307414_101685131 361
409 3300050491 nmdc:mga00v17_582_c2 nmdc:mga00v17_582_c2_6352_7467 361
410 iso_pu_bacteria 2919692658 2919692801 361
411 3300003322 rootL2_10155085 rootL2_101550852 362
412 3300005329 Ga0070683_100074968 Ga0070683_1000749681 362
413 3300005335 Ga0070666_10045688 Ga0070666_100456882 362
414 3300005336 Ga0070680_100072172 Ga0070680_1000721723 362
415 3300005338 Ga0068868_100014395 Ga0068868_1000143953 362
416 3300005338 Ga0068868_100080951 Ga0068868_1000809512 362
417 3300005339 Ga0070660_100128464 Ga0070660_1001284641 362
418 3300005344 Ga0070661_100010000 Ga0070661_1000100003 362
419 3300005354 Ga0070675_100006161 Ga0070675_1000061618 362
420 3300005366 Ga0070659_100010682 Ga0070659_1000106823 362
421 3300005456 Ga0070678_100204861 Ga0070678_1002048612 362
422 3300005457 Ga0070662_100066547 Ga0070662_1000665472 362
423 3300005530 Ga0070679_100032976 Ga0070679_1000329763 362
424 3300005535 Ga0070684_100043586 Ga0070684_1000435863 362
425 3300005539 Ga0068853_100070352 Ga0068853_1000703522 362
426 3300005548 Ga0070665_100362309 Ga0070665_1003623092 362
427 3300005563 Ga0068855_100013738 Ga0068855_1000137388 362
428 3300005564 Ga0070664_100011247 Ga0070664_1000112474 362
429 3300005616 Ga0068852_100433798 Ga0068852_1004337981 362
430 3300005834 Ga0068851_10005291 Ga0068851_100052911 362
431 3300005985 Ga0081539_10000816 Ga0081539_100008167 362
432 3300006237 Ga0097621_100029627 Ga0097621_1000296273 362
433 3300010375 Ga0105239_10478336 Ga0105239_104783361 362
434 3300013100 Ga0157373_10003137 Ga0157373_100031372 362
435 3300013102 Ga0157371_10182197 Ga0157371_101821971 362
436 3300013105 Ga0157369_10029201 Ga0157369_100292012 362
437 3300013296 Ga0157374_10009357 Ga0157374_100093576 362
438 3300013297 Ga0157378_10014684 Ga0157378_100146843 362
439 3300013306 Ga0163162_10032916 Ga0163162_100329163 362
440 3300014326 Ga0157380_10000443 Ga0157380_100004431 362
441 3300014745 Ga0157377_10072696 Ga0157377_100726961 362
442 3300025919 Ga0207657_10005188 Ga0207657_100051883 362
443 3300025933 Ga0207706_10082970 Ga0207706_100829703 362
444 3300025945 Ga0207679_10006182 Ga0207679_100061825 362
445 3300025949 Ga0207667_10134411 Ga0207667_101344112 362
446 3300026078 Ga0207702_10146011 Ga0207702_101460112 362
447 iso_pu_bacteria 2738541278 2738726859 362
448 iso_pu_bacteria 2910245624 2910250516 362
449 iso_pu_bacteria 2929921140 2929926459 362
450 iso_pu_bacteria 8003151029 8003156813 362
451 3300005347 Ga0070668_100063629 Ga0070668_1000636292 363
452 3300005841 Ga0068863_100128733 Ga0068863_1001287332 363
453 3300005843 Ga0068860_100024871 Ga0068860_1000248713 363
454 3300005844 Ga0068862_100013075 Ga0068862_1000130754 363
455 3300026095 Ga0207676_10265381 Ga0207676_102653812 363
456 3300028380 Ga0268265_10169008 Ga0268265_101690081 363
457 3300028381 Ga0268264_10040678 Ga0268264_100406783 363
458 3300049851 Ga0501212_011777 Ga0501212_011777_121_1227 363
459 3300005334 Ga0068869_100042642 Ga0068869_1000426424 364
460 3300005335 Ga0070666_10000138 Ga0070666_1000013830 364
461 3300005338 Ga0068868_100182786 Ga0068868_1001827862 364
462 3300005356 Ga0070674_100009539 Ga0070674_1000095394 364
463 3300005456 Ga0070678_100224535 Ga0070678_1002245352 364
464 3300005539 Ga0068853_100232818 Ga0068853_1002328181 364
465 3300005543 Ga0070672_100061580 Ga0070672_1000615802 364
466 3300005718 Ga0068866_10054269 Ga0068866_100542692 364
467 3300006237 Ga0097621_100115064 Ga0097621_1001150642 364
468 3300009101 Ga0105247_10004124 Ga0105247_100041247 364
469 3300009174 Ga0105241_10000403 Ga0105241_1000040325 364
470 3300009545 Ga0105237_10002164 Ga0105237_1000216425 364
471 3300011119 Ga0105246_10033670 Ga0105246_100336703 364
472 3300013306 Ga0163162_10003500 Ga0163162_100035008 364
473 3300013308 Ga0157375_10142343 Ga0157375_101423432 364
474 3300014325 Ga0163163_10075457 Ga0163163_100754571 364
475 3300014968 Ga0157379_10024379 Ga0157379_100243796 364
476 3300014969 Ga0157376_10164905 Ga0157376_101649051 364
477 3300025907 Ga0207645_10001124 Ga0207645_100011245 364
478 3300025914 Ga0207671_10003963 Ga0207671_1000396313 364
479 3300025934 Ga0207686_10175111 Ga0207686_101751111 364
480 3300025936 Ga0207670_10280269 Ga0207670_102802692 364
481 3300025942 Ga0207689_10041176 Ga0207689_100411764 364
482 3300025961 Ga0207712_10007096 Ga0207712_100070961 364
483 3300026118 Ga0207675_100096291 Ga0207675_1000962912 364
484 3300026121 Ga0207683_10028416 Ga0207683_100284163 364
485 3300026142 Ga0207698_10075351 Ga0207698_100753512 364
486 3300032004 Ga0307414_10028590 Ga0307414_100285904 364
487 3300048907 Ga0496104_0171454 Ga0496104_0171454_392_1564 364
488 3300049521 Ga0501298_016836 Ga0501298_016836_81_1190 364
489 3300049571 Ga0501034_0019490 Ga0501034_0019490_2951_4048 364
490 3300049573 Ga0501037_0002859 Ga0501037_0002859_4283_5380 364
491 3300049574 Ga0501038_0015182 Ga0501038_0015182_4648_5745 364
492 3300049579 Ga0501043_0009431 Ga0501043_0009431_1092_2189 364
493 3300049579 Ga0501043_0010043 Ga0501043_0010043_1214_2311 364
494 3300049581 Ga0501047_0141165 Ga0501047_0141165_769_1866 364
495 3300049663 Ga0501223_016989 Ga0501223_016989_285_1394 364
496 3300049664 Ga0501224_004619 Ga0501224_004619_377_1486 364
497 3300049705 Ga0501225_0005591 Ga0501225_0005591_480_1589 364
498 3300049822 Ga0501035_0068866 Ga0501035_0068866_800_1897 364
499 3300049823 Ga0501044_0007409 Ga0501044_0007409_6152_7249 364
500 3300050511 nmdc:mga08y16_198554_c1 nmdc:mga08y16_198554_c1_720_1853 364
501 iso_pu_bacteria 2911138879 2911142416 364
502 3300005338 Ga0068868_100002592 Ga0068868_10000259210 365
503 3300005366 Ga0070659_100049299 Ga0070659_1000492994 365
504 3300005367 Ga0070667_100001467 Ga0070667_10000146715 365
505 3300005616 Ga0068852_100062071 Ga0068852_1000620713 365
506 3300005617 Ga0068859_100019258 Ga0068859_1000192583 365
507 3300005618 Ga0068864_100074765 Ga0068864_1000747653 365
508 3300005841 Ga0068863_100010890 Ga0068863_1000108907 365
509 3300005843 Ga0068860_100085545 Ga0068860_1000855452 365
510 3300005843 Ga0068860_100154901 Ga0068860_1001549012 365
511 3300006844 Ga0075428_100106726 Ga0075428_1001067263 365
512 3300006847 Ga0075431_100018946 Ga0075431_1000189463 365
513 3300006931 Ga0097620_100019258 Ga0097620_1000192583 365
514 3300009093 Ga0105240_10008271 Ga0105240_1000827110 365
515 3300009093 Ga0105240_10016663 Ga0105240_100166637 365
516 3300009093 Ga0105240_10023977 Ga0105240_100239776 365
517 3300009147 Ga0114129_10112735 Ga0114129_101127352 365
518 3300009148 Ga0105243_10069969 Ga0105243_100699693 365
519 3300009174 Ga0105241_10001753 Ga0105241_100017532 365
520 3300009174 Ga0105241_10196839 Ga0105241_101968392 365
521 3300009545 Ga0105237_10002660 Ga0105237_100026604 365
522 3300009545 Ga0105237_10007945 Ga0105237_100079456 365
523 3300009545 Ga0105237_10036552 Ga0105237_100365522 365
524 3300009545 Ga0105237_10113106 Ga0105237_101131062 365
525 3300009551 Ga0105238_10127922 Ga0105238_101279223 365
526 3300009551 Ga0105238_10286858 Ga0105238_102868582 365
527 3300010375 Ga0105239_10015372 Ga0105239_100153724 365
528 3300011119 Ga0105246_10018901 Ga0105246_100189013 365
529 3300013104 Ga0157370_10015201 Ga0157370_100152018 365
530 3300013105 Ga0157369_10036494 Ga0157369_100364945 365
531 3300013296 Ga0157374_10229327 Ga0157374_102293272 365
532 3300013296 Ga0157374_10274678 Ga0157374_102746782 365
533 3300013297 Ga0157378_10002981 Ga0157378_100029819 365
534 3300013297 Ga0157378_10279760 Ga0157378_102797602 365
535 3300013306 Ga0163162_10101459 Ga0163162_101014592 365
536 3300013307 Ga0157372_10006751 Ga0157372_100067512 365
537 3300013307 Ga0157372_10220850 Ga0157372_102208502 365
538 3300014969 Ga0157376_10021073 Ga0157376_100210733 365
539 3300025302 Ga0207426_1000093 Ga0207426_1000093161 365
540 3300025913 Ga0207695_10001513 Ga0207695_1000151321 365
541 3300025913 Ga0207695_10044421 Ga0207695_100444214 365
542 3300025913 Ga0207695_10046762 Ga0207695_100467624 365
543 3300025914 Ga0207671_10002804 Ga0207671_100028044 365
544 3300025914 Ga0207671_10005605 Ga0207671_100056056 365
545 3300025914 Ga0207671_10008668 Ga0207671_100086683 365
546 3300025924 Ga0207694_10206118 Ga0207694_102061182 365
547 3300025960 Ga0207651_10011488 Ga0207651_100114884 365
548 3300025981 Ga0207640_10201131 Ga0207640_102011311 365
549 3300025986 Ga0207658_10008348 Ga0207658_100083488 365
550 3300026078 Ga0207702_10229277 Ga0207702_102292772 365
551 3300026142 Ga0207698_10032736 Ga0207698_100327362 365
552 3300026142 Ga0207698_10053125 Ga0207698_100531253 365
553 3300028381 Ga0268264_10037388 Ga0268264_100373882 365
554 3300028381 Ga0268264_10128374 Ga0268264_101283743 365
555 3300031507 Ga0307509_10128864 Ga0307509_101288642 365
556 3300041512 Ga0451853_2458528 Ga0451853_2458528_147_1244 365
557 3300042014 Ga0439457_014352 Ga0439457_014352_330_1427 365
558 3300044658 Ga0466972_0001168 Ga0466972_0001168_1347_2444 365
559 3300047320 Ga0495672_0013741 Ga0495672_0013741_2860_3957 365
560 3300049571 Ga0501034_0291970 Ga0501034_0291970_340_1440 365
561 3300049742 Ga0501080_0206044 Ga0501080_0206044_166_1293 365
562 3300049763 Ga0501266_003291 Ga0501266_003291_461_1597 365
563 3300050510 nmdc:mga06r32_84417_c1 nmdc:mga06r32_84417_c1_876_1988 365
564 3300001989 JGI24739J22299_10007776 JGI24739J22299_100077762 366
565 3300003215 JGI25153J46596_10000766 JGI25153J46596_100007668 366
566 3300003215 JGI25153J46596_10018149 JGI25153J46596_100181492 366
567 3300003322 rootL2_10077131 rootL2_100771312 366
568 3300003323 rootH1_10003268 rootH1_100032687 366
569 3300003323 rootH1_10102452 rootH1_101024525 366
570 3300003323 rootH1_10105715 rootH1_101057152 366
571 3300003354 JGI25160J50197_1000863 JGI25160J50197_10008631 366
572 3300003354 JGI25160J50197_1021239 JGI25160J50197_10212392 366
573 3300003771 Ga0055526_1018304 Ga0055526_10183041 366
574 3300003790 Ga0055528_1002478 Ga0055528_10024781 366
575 3300003791 Ga0055530_10009262 Ga0055530_100092621 366
576 3300005262 Ga0065165_1000219 Ga0065165_100021956 366
577 3300005290 Ga0065712_10145165 Ga0065712_101451651 366
578 3300005327 Ga0070658_10081100 Ga0070658_100811001 366
579 3300005331 Ga0070670_100156661 Ga0070670_1001566612 366
580 3300005334 Ga0068869_100015239 Ga0068869_1000152392 366
581 3300005340 Ga0070689_100057636 Ga0070689_1000576362 366
582 3300005343 Ga0070687_100082748 Ga0070687_1000827482 366
583 3300005365 Ga0070688_100036747 Ga0070688_1000367472 366
584 3300005366 Ga0070659_100032648 Ga0070659_1000326483 366
585 3300005456 Ga0070678_100341033 Ga0070678_1003410331 366
586 3300005535 Ga0070684_100002054 Ga0070684_1000020543 366
587 3300005535 Ga0070684_100290550 Ga0070684_1002905502 366
588 3300005539 Ga0068853_100048688 Ga0068853_1000486882 366
589 3300005543 Ga0070672_100211327 Ga0070672_1002113273 366
590 3300005547 Ga0070693_100043222 Ga0070693_1000432222 366
591 3300005548 Ga0070665_100000016 Ga0070665_10000001697 366
592 3300005564 Ga0070664_100182491 Ga0070664_1001824911 366
593 3300005577 Ga0068857_100103626 Ga0068857_1001036262 366
594 3300005577 Ga0068857_100216660 Ga0068857_1002166601 366
595 3300005615 Ga0070702_100002295 Ga0070702_1000022953 366
596 3300005618 Ga0068864_100013839 Ga0068864_1000138391 366
597 3300005843 Ga0068860_100000006 Ga0068860_100000006137 366
598 3300005985 Ga0081539_10008031 Ga0081539_100080319 366
599 3300006195 Ga0075366_10070479 Ga0075366_100704792 366
600 3300006358 Ga0068871_100028555 Ga0068871_1000285551 366
601 3300006358 Ga0068871_100206891 Ga0068871_1002068912 366
602 3300006358 Ga0068871_100259740 Ga0068871_1002597401 366
603 3300006844 Ga0075428_100013628 Ga0075428_1000136285 366
604 3300006844 Ga0075428_100199519 Ga0075428_1001995192 366
605 3300006846 Ga0075430_100014626 Ga0075430_1000146263 366
606 3300006847 Ga0075431_100014855 Ga0075431_1000148554 366
607 3300006880 Ga0075429_100000105 Ga0075429_1000001054 366
608 3300006880 Ga0075429_100181704 Ga0075429_1001817042 366
609 3300009093 Ga0105240_10000328 Ga0105240_1000032819 366
610 3300009093 Ga0105240_10039408 Ga0105240_100394084 366
611 3300009147 Ga0114129_10055251 Ga0114129_100552515 366
612 3300009176 Ga0105242_10238637 Ga0105242_102386371 366
613 3300009177 Ga0105248_10665160 Ga0105248_106651601 366
614 3300009545 Ga0105237_10015760 Ga0105237_100157603 366
615 3300009545 Ga0105237_10018209 Ga0105237_100182093 366
616 3300009545 Ga0105237_10068168 Ga0105237_100681683 366
617 3300009553 Ga0105249_10009844 Ga0105249_100098442 366
618 3300009553 Ga0105249_10013748 Ga0105249_100137483 366
619 3300009553 Ga0105249_10218971 Ga0105249_102189712 366
620 3300010375 Ga0105239_10000101 Ga0105239_1000010187 366
621 3300010375 Ga0105239_10020208 Ga0105239_100202083 366
622 3300010375 Ga0105239_10023231 Ga0105239_100232315 366
623 3300013296 Ga0157374_10000029 Ga0157374_1000002973 366
624 3300013296 Ga0157374_10002518 Ga0157374_100025188 366
625 3300013296 Ga0157374_10022675 Ga0157374_100226754 366
626 3300013297 Ga0157378_10036566 Ga0157378_100365662 366
627 3300013297 Ga0157378_10045202 Ga0157378_100452022 366
628 3300013306 Ga0163162_10000355 Ga0163162_1000035527 366
629 3300013306 Ga0163162_10236468 Ga0163162_102364681 366
630 3300013307 Ga0157372_10235796 Ga0157372_102357962 366
631 3300013308 Ga0157375_10066270 Ga0157375_100662702 366
632 3300013308 Ga0157375_10159336 Ga0157375_101593361 366
633 3300014325 Ga0163163_10192403 Ga0163163_101924031 366
634 3300014326 Ga0157380_10002654 Ga0157380_100026546 366
635 3300014326 Ga0157380_10450270 Ga0157380_104502701 366
636 3300014968 Ga0157379_10216518 Ga0157379_102165181 366
637 3300014968 Ga0157379_10323816 Ga0157379_103238161 366
638 3300014968 Ga0157379_10329740 Ga0157379_103297401 366
639 3300014969 Ga0157376_10002108 Ga0157376_100021086 366
640 3300014969 Ga0157376_10088629 Ga0157376_100886293 366
641 3300017792 Ga0163161_10144685 Ga0163161_101446851 366
642 3300025246 Ga0209646_1000003 Ga0209646_1000003277 366
643 3300025246 Ga0209646_1001862 Ga0209646_10018623 366
644 3300025250 Ga0209026_1000614 Ga0209026_10006149 366
645 3300025273 Ga0209673_1000962 Ga0209673_10009621 366
646 3300025295 Ga0209564_1003078 Ga0209564_10030789 366
647 3300025297 Ga0209758_1002110 Ga0209758_100211013 366
648 3300025297 Ga0209758_1011568 Ga0209758_10115683 366
649 3300025298 Ga0209050_1000561 Ga0209050_10005612 366
650 3300025302 Ga0207426_1000187 Ga0207426_100018713 366
651 3300025302 Ga0207426_1015489 Ga0207426_10154892 366
652 3300025304 Ga0209257_1010390 Ga0209257_10103902 366
653 3300025899 Ga0207642_10016957 Ga0207642_100169572 366
654 3300025913 Ga0207695_10002144 Ga0207695_100021447 366
655 3300025913 Ga0207695_10137474 Ga0207695_101374742 366
656 3300025914 Ga0207671_10019962 Ga0207671_100199623 366
657 3300025914 Ga0207671_10130845 Ga0207671_101308452 366
658 3300025919 Ga0207657_10167202 Ga0207657_101672021 366
659 3300025923 Ga0207681_10258681 Ga0207681_102586812 366
660 3300025932 Ga0207690_10014232 Ga0207690_100142323 366
661 3300025934 Ga0207686_10002379 Ga0207686_100023793 366
662 3300025937 Ga0207669_10019354 Ga0207669_100193542 366
663 3300025940 Ga0207691_10033523 Ga0207691_100335235 366
664 3300025940 Ga0207691_10078777 Ga0207691_100787773 366
665 3300025942 Ga0207689_10016558 Ga0207689_100165582 366
666 3300025942 Ga0207689_10029959 Ga0207689_100299593 366
667 3300025944 Ga0207661_10016817 Ga0207661_100168173 366
668 3300025944 Ga0207661_10017076 Ga0207661_100170764 366
669 3300025945 Ga0207679_10040417 Ga0207679_100404173 366
670 3300025945 Ga0207679_10298365 Ga0207679_102983651 366
671 3300025960 Ga0207651_10099594 Ga0207651_100995943 366
672 3300025961 Ga0207712_10008345 Ga0207712_100083452 366
673 3300025961 Ga0207712_10349203 Ga0207712_103492031 366
674 3300026088 Ga0207641_10001165 Ga0207641_1000116510 366
675 3300026089 Ga0207648_10077588 Ga0207648_100775884 366
676 3300026116 Ga0207674_10006014 Ga0207674_100060146 366
677 3300026116 Ga0207674_10121792 Ga0207674_101217922 366
678 3300026118 Ga0207675_100153605 Ga0207675_1001536052 366
679 3300028379 Ga0268266_10000149 Ga0268266_1000014997 366
680 3300028381 Ga0268264_10000064 Ga0268264_1000006457 366
681 3300028381 Ga0268264_10135630 Ga0268264_101356301 366
682 3300031456 Ga0307513_10158870 Ga0307513_101588701 366
683 3300032004 Ga0307414_10000021 Ga0307414_10000021157 366
684 3300032004 Ga0307414_10191614 Ga0307414_101916142 366
685 3300041486 Ga0451807_1542018 Ga0451807_1542018_40_1140 366
686 3300042876 Ga0451577_0007245 Ga0451577_0007245_1827_2930 366
687 3300044658 Ga0466972_0000027 Ga0466972_0000027_167655_168755 366
688 3300044658 Ga0466972_0012027 Ga0466972_0012027_3238_4338 366
689 3300044712 Ga0453684_0000549 Ga0453684_0000549_140371_141474 366
690 3300046453 Ga0495627_017509 Ga0495627_017509_1134_2237 366
691 3300046477 Ga0495664_0062271 Ga0495664_0062271_743_1879 366
692 3300046524 Ga0495648_0001120 Ga0495648_0001120_19255_20355 366
693 3300046558 Ga0495633_0018045 Ga0495633_0018045_1067_2170 366
694 3300046616 Ga0495668_0007170 Ga0495668_0007170_2731_3831 366
695 3300046648 Ga0495611_0000099 Ga0495611_0000099_373_1473 366
696 3300046660 Ga0495625_0114616 Ga0495625_0114616_624_1724 366
697 3300047320 Ga0495672_0010307 Ga0495672_0010307_2981_4081 366
698 3300047443 Ga0495687_000158 Ga0495687_000158_60788_61888 366
699 3300049581 Ga0501047_0035937 Ga0501047_0035937_731_1834 366
700 3300049661 Ga0501217_029450 Ga0501217_029450_168_1319 366
701 3300049663 Ga0501223_003903 Ga0501223_003903_1154_2305 366
702 3300049669 Ga0501235_004698 Ga0501235_004698_1654_2805 366
703 3300049674 Ga0501242_004225 Ga0501242_004225_288_1439 366
704 3300049675 Ga0501243_000060 Ga0501243_000060_3393_4544 366
705 3300049686 Ga0501257_032032 Ga0501257_032032_40_1179 366
706 3300049705 Ga0501225_0001832 Ga0501225_0001832_1409_2509 366
707 3300049707 Ga0501234_003841 Ga0501234_003841_791_1942 366
708 3300049823 Ga0501044_0272675 Ga0501044_0272675_50_1153 366
709 3300050507 nmdc:mga05p37_42353_c1 nmdc:mga05p37_42353_c1_950_2050 366
710 3300050510 nmdc:mga06r32_57778_c1 nmdc:mga06r32_57778_c1_2539_3642 366
711 3300053086 Ga0500578_0000009 Ga0500578_0000009_49854_50954 366
712 3300053092 Ga0500583_0000036 Ga0500583_0000036_89121_90221 366
713 3300053092 Ga0500583_0000666 Ga0500583_0000666_3331_4431 366
714 3300053093 Ga0500651_0019024 Ga0500651_0019024_2831_3934 366
715 3300053139 Ga0500568_0000346 Ga0500568_0000346_29925_31028 366
716 3300053156 Ga0500622_0001640 Ga0500622_0001640_3597_4697 366
717 3300053156 Ga0500622_0026835 Ga0500622_0026835_533_1633 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

87

211

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

219

340

0.93

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

224

415

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a06-assembly1.cif.gz_C crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol 0.9431 35 365
1evj-assembly1.cif.gz_C crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d 0.9427 37 364
1h6d-assembly3.cif.gz_I oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol 0.9393 33 364
1evj-assembly2.cif.gz_B crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d 0.9362 37 364
1rye-assembly1.cif.gz_C crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis 0.9345 37 365
ID Description Score Start End Superfamily
1h6aA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9646 33 165 3.40.50.720
3moiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9263 37 161 3.40.50.720
3rbvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9201 37 162 3.40.50.720
af_P42599_1_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9138 38 169 3.40.50.720
4hadB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9108 38 158 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A059EDH1-F1-model_v4 Glucose-fructose oxidoreductase 0.9557 33 365 GO:0000166
GO:0016491
AF-A0A6L9L9A7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9475 33 365 GO:0000166
GO:0016491
AF-A0A4Q6BVG7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9404 52 365 GO:0000166
GO:0016491
AF-A0A2V6G7H8-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9344 35 365 GO:0000166
GO:0016491
AF-A0A1G7HBR9-F1-model_v4 Predicted dehydrogenase 0.9332 32 365 GO:0000166
GO:0016491

Feature Viewer

pLDDT pTM Quality
93.21 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map