F477100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 717 | 307 | 708 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10015760|Ga0105237_100157603 |
| Length | 415 |
| Sequence | MQLSACRHPNVLIILFINFIHSRNDCPAAFTIAALRFIKTFSNTKNPVTMSLTSRREVLKTLALASGAACFSPNVLLAATRRKKEKLGIALVGLGYYSTDLLSPALQQTKNCYLAGIVTGTPAKAEAWKAKYNIPDKNIYNYESFDKIANNDDIDVIYVVLPPSMHKEYVIRAANAGKHVFCEKPMAITAVECKAMIDACNKNKRSLAIGYRLHHEPNTQEYTRIINNKLLGKVKKMSCAAGYTENRTNHWKQKKEMGGGVLYDMGVYAIQGARLGTGMEPVEIVSAKTSTTRPEIYKNGLDETTVAQLEFPGGVLADIKTSFGENINFLTVNCEKGDIKMEPYSGYNGLQGSSPLGSINYPYDVPWQQAKQLDDDTMAIMQGKPMLVPGEEGLRDIRIVEAIYKCAGSGQRVTI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 3 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 4 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 5 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 6 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 7 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 185 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 191 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 201 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 205 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 220 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 221 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 222 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 223 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 226 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 227 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 228 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 229 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 230 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 231 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 232 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 251 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 275 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 277 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 279 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 280 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 281 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 287 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 288 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 291 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 298 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 299 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 300 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 301 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 303 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 304 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 305 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.47 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.58 |
| Nodule | 0 |
| Rhizoplane | 0.98 |
| Rhizosphere | 87.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10007776 | 3300001989 | Bacteria | 4011 |
| 2 | JGI25153J46596_10000766 | 3300003215 | Bacteria | 19670 |
| 3 | JGI25153J46596_10018149 | 3300003215 | Bacteria | 2743 |
| 4 | rootH1_10033439 | 3300003316 | Bacteria | 30115 |
| 5 | rootH2_10010010 | 3300003320 | Bacteria | 6137 |
| 6 | rootH2_10217225 | 3300003320 | Bacteria | 3628 |
| 7 | rootL2_10005471 | 3300003322 | Bacteria | 3464 |
| 8 | rootL2_10058065 | 3300003322 | Bacteria | 10287 |
| 9 | rootL2_10068274 | 3300003322 | Bacteria | 19040 |
| 10 | rootL2_10077131 | 3300003322 | Bacteria | 2174 |
| 11 | rootL2_10155085 | 3300003322 | Bacteria | 6787 |
| 12 | rootL2_10235208 | 3300003322 | Bacteria | 5534 |
| 13 | rootL2_10282538 | 3300003322 | Archaea | 2105 |
| 14 | rootL2_10302482 | 3300003322 | Unclassified | 2801 |
| 15 | rootH1_10003268 | 3300003323 | Bacteria | 19976 |
| 16 | rootH1_10008265 | 3300003323 | Bacteria | 10217 |
| 17 | rootH1_10011937 | 3300003316 | Bacteria | 5065 |
| 18 | rootH1_10011937 | 3300003323 | Bacteria | 7280 |
| 19 | rootH1_10023828 | 3300003323 | Bacteria | 9527 |
| 20 | rootH1_10096985 | 3300003323 | Bacteria | 3864 |
| 21 | rootH1_10102452 | 3300003323 | Bacteria | 4655 |
| 22 | rootH1_10105715 | 3300003323 | Bacteria | 2411 |
| 23 | rootH1_10119811 | 3300003323 | Bacteria | 7048 |
| 24 | rootH1_10387958 | 3300003323 | Unclassified | 1660 |
| 25 | JGI25160J50197_1000863 | 3300003354 | Bacteria | 16119 |
| 26 | JGI25160J50197_1021239 | 3300003354 | Bacteria | 1936 |
| 27 | Ga0055526_1018304 | 3300003771 | Bacteria | 2620 |
| 28 | Ga0055528_1002478 | 3300003790 | Bacteria | 9868 |
| 29 | Ga0055530_10009262 | 3300003791 | Bacteria | 3812 |
| 30 | Ga0055531_10000435 | 3300003794 | Bacteria | 39538 |
| 31 | Ga0058863_11707405 | 3300004799 | Bacteria | 2848 |
| 32 | Ga0065165_1000043 | 3300005262 | Bacteria | 203850 |
| 33 | Ga0065165_1000219 | 3300005262 | Bacteria | 100119 |
| 34 | Ga0065712_10145165 | 3300005290 | Bacteria | 1415 |
| 35 | Ga0070658_10081100 | 3300005327 | Bacteria | 2665 |
| 36 | Ga0070676_10198100 | 3300005328 | Bacteria | 1315 |
| 37 | Ga0070683_100074968 | 3300005329 | Unclassified | 3160 |
| 38 | Ga0070683_100340248 | 3300005329 | Bacteria | 1429 |
| 39 | Ga0070690_100009302 | 3300005330 | Bacteria | 5689 |
| 40 | Ga0070670_100032495 | 3300005331 | Bacteria | 4494 |
| 41 | Ga0070670_100133952 | 3300005331 | Unclassified | 2141 |
| 42 | Ga0070670_100156661 | 3300005331 | Bacteria | 1973 |
| 43 | Ga0070677_10000400 | 3300005333 | Bacteria | 15144 |
| 44 | Ga0068869_100015239 | 3300005334 | Bacteria | 5152 |
| 45 | Ga0068869_100017422 | 3300005334 | Bacteria | 4868 |
| 46 | Ga0068869_100021471 | 3300005334 | Unclassified | 4442 |
| 47 | Ga0068869_100042642 | 3300005334 | Bacteria | 3254 |
| 48 | Ga0068869_100239344 | 3300005334 | Bacteria | 1445 |
| 49 | Ga0070666_10000138 | 3300005335 | Bacteria | 50719 |
| 50 | Ga0070666_10045688 | 3300005335 | Bacteria | 2936 |
| 51 | Ga0070680_100072172 | 3300005336 | Unclassified | 2837 |
| 52 | Ga0070682_100037733 | 3300005337 | Bacteria | 2960 |
| 53 | Ga0070682_100158626 | 3300005337 | Bacteria | 1560 |
| 54 | Ga0068868_100002592 | 3300005338 | Bacteria | 12529 |
| 55 | Ga0068868_100014395 | 3300005338 | Bacteria | 5831 |
| 56 | Ga0068868_100080951 | 3300005338 | Bacteria | 2603 |
| 57 | Ga0068868_100083152 | 3300005338 | Unclassified | 2569 |
| 58 | Ga0068868_100165677 | 3300005338 | Bacteria | 1828 |
| 59 | Ga0068868_100182786 | 3300005338 | Bacteria | 1740 |
| 60 | Ga0070660_100128464 | 3300005339 | Bacteria | 2026 |
| 61 | Ga0070660_100136450 | 3300005339 | Bacteria | 1966 |
| 62 | Ga0070689_100000797 | 3300005340 | Bacteria | 19388 |
| 63 | Ga0070689_100057636 | 3300005340 | Bacteria | 3015 |
| 64 | Ga0070689_100140712 | 3300005340 | Bacteria | 1940 |
| 65 | Ga0070689_100345343 | 3300005340 | Bacteria | 1247 |
| 66 | Ga0070687_100082748 | 3300005343 | Unclassified | 1756 |
| 67 | Ga0070661_100010000 | 3300005344 | Bacteria | 6583 |
| 68 | Ga0070668_100052230 | 3300005347 | Unclassified | 3150 |
| 69 | Ga0070668_100063629 | 3300005347 | Bacteria | 2860 |
| 70 | Ga0070668_100069315 | 3300005347 | Bacteria | 2743 |
| 71 | Ga0070668_100193559 | 3300005347 | Bacteria | 1666 |
| 72 | Ga0070669_100028232 | 3300005353 | Bacteria | 4041 |
| 73 | Ga0070669_100037494 | 3300005353 | Bacteria | 3517 |
| 74 | Ga0070675_100006161 | 3300005354 | Bacteria | 9195 |
| 75 | Ga0070675_100080373 | 3300005354 | Bacteria | 2717 |
| 76 | Ga0070675_100130221 | 3300005354 | Bacteria | 2143 |
| 77 | Ga0070671_100164849 | 3300005355 | Bacteria | 1874 |
| 78 | Ga0070674_100009539 | 3300005356 | Bacteria | 5813 |
| 79 | Ga0070674_100051483 | 3300005356 | Bacteria | 2838 |
| 80 | Ga0070674_100083274 | 3300005356 | Unclassified | 2290 |
| 81 | Ga0070674_100099853 | 3300005356 | Bacteria | 2112 |
| 82 | Ga0070674_100141716 | 3300005356 | Bacteria | 1804 |
| 83 | Ga0070673_100012837 | 3300005364 | Bacteria | 5767 |
| 84 | Ga0070673_100014554 | 3300005364 | Bacteria | 5485 |
| 85 | Ga0070673_100047596 | 3300005364 | Bacteria | 3337 |
| 86 | Ga0070673_100375445 | 3300005364 | Bacteria | 1267 |
| 87 | Ga0070688_100036747 | 3300005365 | Unclassified | 2980 |
| 88 | Ga0070688_100077384 | 3300005365 | Unclassified | 2143 |
| 89 | Ga0070659_100010682 | 3300005366 | Bacteria | 6763 |
| 90 | Ga0070659_100032648 | 3300005366 | Unclassified | 4039 |
| 91 | Ga0070659_100049299 | 3300005366 | Bacteria | 3311 |
| 92 | Ga0070667_100001467 | 3300005367 | Bacteria | 21123 |
| 93 | Ga0070667_100145082 | 3300005367 | Bacteria | 2081 |
| 94 | Ga0070700_100048188 | 3300005441 | Bacteria | 2640 |
| 95 | Ga0070700_100112425 | 3300005441 | Bacteria | 1813 |
| 96 | Ga0070678_100048685 | 3300005456 | Bacteria | 3054 |
| 97 | Ga0070678_100204861 | 3300005456 | Bacteria | 1631 |
| 98 | Ga0070678_100224535 | 3300005456 | Bacteria | 1563 |
| 99 | Ga0070678_100341033 | 3300005456 | Unclassified | 1285 |
| 100 | Ga0070662_100066547 | 3300005457 | Bacteria | 2644 |
| 101 | Ga0070681_10043616 | 3300005458 | Unclassified | 4491 |
| 102 | Ga0068867_100009217 | 3300005459 | Bacteria | 6968 |
| 103 | Ga0068867_100026116 | 3300005459 | Bacteria | 4192 |
| 104 | Ga0068867_100252211 | 3300005459 | Bacteria | 1435 |
| 105 | Ga0070685_10022566 | 3300005466 | Bacteria | 3432 |
| 106 | Ga0070685_10034947 | 3300005466 | Bacteria | 2834 |
| 107 | Ga0070699_100107997 | 3300005518 | Bacteria | 2442 |
| 108 | Ga0070679_100032976 | 3300005530 | Bacteria | 5125 |
| 109 | Ga0070684_100002054 | 3300005535 | Bacteria | 14821 |
| 110 | Ga0070684_100043586 | 3300005535 | Bacteria | 3875 |
| 111 | Ga0070684_100290550 | 3300005535 | Bacteria | 1499 |
| 112 | Ga0068853_100048688 | 3300005539 | Unclassified | 3642 |
| 113 | Ga0068853_100070352 | 3300005539 | Bacteria | 3046 |
| 114 | Ga0068853_100232818 | 3300005539 | Bacteria | 1686 |
| 115 | Ga0070672_100036103 | 3300005543 | Bacteria | 3763 |
| 116 | Ga0070672_100045621 | 3300005543 | Bacteria | 3391 |
| 117 | Ga0070672_100061580 | 3300005543 | Bacteria | 2959 |
| 118 | Ga0070672_100211327 | 3300005543 | Unclassified | 1625 |
| 119 | Ga0070672_100261311 | 3300005543 | Bacteria | 1460 |
| 120 | Ga0070686_100058855 | 3300005544 | Bacteria | 2474 |
| 121 | Ga0070696_100172879 | 3300005546 | Bacteria | 1598 |
| 122 | Ga0070693_100043222 | 3300005547 | Bacteria | 2544 |
| 123 | Ga0070665_100000016 | 3300005548 | Bacteria | 451538 |
| 124 | Ga0070665_100003454 | 3300005548 | Bacteria | 16836 |
| 125 | Ga0070665_100052967 | 3300005548 | Bacteria | 4070 |
| 126 | Ga0070665_100362309 | 3300005548 | Bacteria | 1456 |
| 127 | Ga0070704_100258070 | 3300005549 | Bacteria | 1434 |
| 128 | Ga0068855_100002311 | 3300005563 | Bacteria | 23570 |
| 129 | Ga0068855_100013738 | 3300005563 | Bacteria | 9760 |
| 130 | Ga0068855_100076505 | 3300005563 | Unclassified | 3884 |
| 131 | Ga0068855_100226959 | 3300005563 | Unclassified | 2093 |
| 132 | Ga0070664_100011247 | 3300005564 | Bacteria | 7260 |
| 133 | Ga0070664_100013959 | 3300005564 | Bacteria | 6550 |
| 134 | Ga0070664_100182491 | 3300005564 | Bacteria | 1866 |
| 135 | Ga0068857_100103626 | 3300005577 | Bacteria | 2554 |
| 136 | Ga0068857_100216660 | 3300005577 | Bacteria | 1748 |
| 137 | Ga0068854_100028862 | 3300005578 | Unclassified | 3837 |
| 138 | Ga0070702_100002295 | 3300005615 | Bacteria | 8198 |
| 139 | Ga0070702_100013127 | 3300005615 | Bacteria | 4174 |
| 140 | Ga0068852_100062071 | 3300005616 | Bacteria | 3249 |
| 141 | Ga0068852_100433798 | 3300005616 | Bacteria | 1298 |
| 142 | Ga0068859_100000086 | 3300005617 | Bacteria | 85696 |
| 143 | Ga0068859_100019258 | 3300005617 | Bacteria | 6857 |
| 144 | Ga0068859_100058356 | 3300005617 | Bacteria | 3887 |
| 145 | Ga0068859_100328809 | 3300005617 | Bacteria | 1623 |
| 146 | Ga0068864_100013839 | 3300005618 | Bacteria | 6685 |
| 147 | Ga0068864_100017294 | 3300005618 | Bacteria | 6010 |
| 148 | Ga0068864_100053363 | 3300005618 | Bacteria | 3487 |
| 149 | Ga0068864_100074765 | 3300005618 | Unclassified | 2956 |
| 150 | Ga0068866_10049789 | 3300005718 | Bacteria | 2125 |
| 151 | Ga0068866_10053909 | 3300005718 | Bacteria | 2058 |
| 152 | Ga0068866_10054269 | 3300005718 | Bacteria | 2053 |
| 153 | Ga0068861_100003410 | 3300005719 | Bacteria | 10545 |
| 154 | Ga0068861_100003537 | 3300005719 | Bacteria | 10386 |
| 155 | Ga0068861_100033659 | 3300005719 | Unclassified | 3783 |
| 156 | Ga0068861_100046232 | 3300005719 | Bacteria | 3281 |
| 157 | Ga0068861_100057903 | 3300005719 | Bacteria | 2961 |
| 158 | Ga0068861_100086968 | 3300005719 | Bacteria | 2458 |
| 159 | Ga0068861_100413759 | 3300005719 | Bacteria | 1200 |
| 160 | Ga0068851_10005291 | 3300005834 | Bacteria | 5857 |
| 161 | Ga0068870_10029303 | 3300005840 | Bacteria | 2771 |
| 162 | Ga0068863_100009150 | 3300005841 | Bacteria | 9667 |
| 163 | Ga0068863_100010890 | 3300005841 | Bacteria | 8818 |
| 164 | Ga0068863_100017951 | 3300005841 | Bacteria | 6771 |
| 165 | Ga0068863_100041315 | 3300005841 | Bacteria | 4384 |
| 166 | Ga0068863_100124869 | 3300005841 | Bacteria | 2455 |
| 167 | Ga0068863_100128733 | 3300005841 | Bacteria | 2416 |
| 168 | Ga0068863_100301641 | 3300005841 | Bacteria | 1554 |
| 169 | Ga0068858_100017405 | 3300005842 | Bacteria | 6742 |
| 170 | Ga0068860_100000006 | 3300005843 | Bacteria | 461966 |
| 171 | Ga0068860_100002840 | 3300005843 | Bacteria | 17998 |
| 172 | Ga0068860_100012354 | 3300005843 | Bacteria | 8413 |
| 173 | Ga0068860_100024871 | 3300005843 | Bacteria | 5781 |
| 174 | Ga0068860_100085545 | 3300005843 | Bacteria | 3001 |
| 175 | Ga0068860_100154901 | 3300005843 | Bacteria | 2208 |
| 176 | Ga0068860_100205263 | 3300005843 | Unclassified | 1911 |
| 177 | Ga0068862_100013075 | 3300005844 | Bacteria | 6866 |
| 178 | Ga0068862_100188425 | 3300005844 | Bacteria | 1855 |
| 179 | Ga0068862_100360587 | 3300005844 | Bacteria | 1351 |
| 180 | Ga0081455_10008109 | 3300005937 | Bacteria | 10962 |
| 181 | Ga0081539_10000816 | 3300005985 | Bacteria | 60353 |
| 182 | Ga0081539_10008031 | 3300005985 | Bacteria | 9351 |
| 183 | Ga0075364_10000088 | 3300006051 | Bacteria | 36693 |
| 184 | Ga0075366_10070479 | 3300006195 | Unclassified | 2082 |
| 185 | Ga0097621_100006601 | 3300006237 | Bacteria | 8240 |
| 186 | Ga0097621_100008063 | 3300006237 | Bacteria | 7563 |
| 187 | Ga0097621_100029627 | 3300006237 | Bacteria | 4325 |
| 188 | Ga0097621_100070868 | 3300006237 | Unclassified | 2879 |
| 189 | Ga0097621_100110567 | 3300006237 | Bacteria | 2321 |
| 190 | Ga0097621_100115064 | 3300006237 | Bacteria | 2276 |
| 191 | Ga0068871_100001606 | 3300006358 | Bacteria | 15201 |
| 192 | Ga0068871_100019167 | 3300006358 | Bacteria | 5221 |
| 193 | Ga0068871_100028555 | 3300006358 | Bacteria | 4374 |
| 194 | Ga0068871_100177883 | 3300006358 | Bacteria | 1827 |
| 195 | Ga0068871_100206891 | 3300006358 | Bacteria | 1696 |
| 196 | Ga0068871_100215039 | 3300006358 | Bacteria | 1664 |
| 197 | Ga0068871_100229040 | 3300006358 | Bacteria | 1612 |
| 198 | Ga0068871_100259740 | 3300006358 | Bacteria | 1515 |
| 199 | Ga0075428_100013628 | 3300006844 | Bacteria | 9053 |
| 200 | Ga0075428_100045822 | 3300006844 | Bacteria | 4805 |
| 201 | Ga0075428_100106726 | 3300006844 | Bacteria | 3053 |
| 202 | Ga0075428_100186233 | 3300006844 | Bacteria | 2246 |
| 203 | Ga0075428_100199519 | 3300006844 | Bacteria | 2163 |
| 204 | Ga0075430_100014626 | 3300006846 | Bacteria | 6684 |
| 205 | Ga0075431_100014855 | 3300006847 | Bacteria | 7882 |
| 206 | Ga0075431_100018946 | 3300006847 | Bacteria | 7012 |
| 207 | Ga0075429_100000105 | 3300006880 | Bacteria | 47284 |
| 208 | Ga0075429_100000606 | 3300006880 | Bacteria | 27574 |
| 209 | Ga0075429_100181704 | 3300006880 | Unclassified | 1843 |
| 210 | Ga0068865_100028700 | 3300006881 | Bacteria | 3685 |
| 211 | Ga0068865_100045075 | 3300006881 | Bacteria | 3022 |
| 212 | Ga0068865_100130124 | 3300006881 | Bacteria | 1885 |
| 213 | Ga0068865_100130575 | 3300006881 | Bacteria | 1882 |
| 214 | Ga0097620_100000086 | 3300006931 | Bacteria | 85696 |
| 215 | Ga0097620_100019258 | 3300006931 | Bacteria | 6857 |
| 216 | Ga0097620_100058359 | 3300006931 | Bacteria | 3887 |
| 217 | Ga0097620_100328781 | 3300006931 | Bacteria | 1623 |
| 218 | Ga0105240_10000328 | 3300009093 | Bacteria | 89466 |
| 219 | Ga0105240_10008271 | 3300009093 | Bacteria | 14892 |
| 220 | Ga0105240_10016663 | 3300009093 | Bacteria | 9940 |
| 221 | Ga0105240_10023977 | 3300009093 | Bacteria | 8060 |
| 222 | Ga0105240_10039408 | 3300009093 | Bacteria | 6050 |
| 223 | Ga0111539_10005241 | 3300009094 | Bacteria | 16795 |
| 224 | Ga0111539_10012104 | 3300009094 | Bacteria | 10823 |
| 225 | Ga0111539_10033434 | 3300009094 | Bacteria | 6242 |
| 226 | Ga0111539_10057540 | 3300009094 | Bacteria | 4616 |
| 227 | Ga0111539_10446284 | 3300009094 | Bacteria | 1506 |
| 228 | Ga0105247_10004124 | 3300009101 | Bacteria | 9325 |
| 229 | Ga0114129_10002392 | 3300009147 | Bacteria | 26071 |
| 230 | Ga0114129_10055251 | 3300009147 | Bacteria | 5566 |
| 231 | Ga0114129_10112735 | 3300009147 | Bacteria | 3750 |
| 232 | Ga0105243_10069969 | 3300009148 | Unclassified | 2832 |
| 233 | Ga0105243_10125853 | 3300009148 | Bacteria | 2168 |
| 234 | Ga0105241_10000403 | 3300009174 | Bacteria | 32619 |
| 235 | Ga0105241_10001753 | 3300009174 | Bacteria | 16461 |
| 236 | Ga0105241_10097566 | 3300009174 | Bacteria | 2330 |
| 237 | Ga0105241_10175695 | 3300009174 | Bacteria | 1772 |
| 238 | Ga0105241_10196839 | 3300009174 | Bacteria | 1681 |
| 239 | Ga0105242_10238637 | 3300009176 | Unclassified | 1633 |
| 240 | Ga0105242_10271125 | 3300009176 | Unclassified | 1537 |
| 241 | Ga0105248_10665160 | 3300009177 | Unclassified | 1175 |
| 242 | Ga0105237_10002164 | 3300009545 | Bacteria | 24675 |
| 243 | Ga0105237_10002660 | 3300009545 | Bacteria | 21961 |
| 244 | Ga0105237_10007945 | 3300009545 | Bacteria | 11560 |
| 245 | Ga0105237_10015760 | 3300009545 | Bacteria | 7860 |
| 246 | Ga0105237_10018209 | 3300009545 | Bacteria | 7269 |
| 247 | Ga0105237_10036552 | 3300009545 | Bacteria | 4971 |
| 248 | Ga0105237_10068168 | 3300009545 | Bacteria | 3552 |
| 249 | Ga0105237_10113106 | 3300009545 | Bacteria | 2707 |
| 250 | Ga0105238_10127922 | 3300009551 | Bacteria | 2518 |
| 251 | Ga0105238_10286858 | 3300009551 | Bacteria | 1628 |
| 252 | Ga0105249_10009844 | 3300009553 | Bacteria | 8378 |
| 253 | Ga0105249_10013748 | 3300009553 | Bacteria | 7148 |
| 254 | Ga0105249_10101072 | 3300009553 | Bacteria | 2712 |
| 255 | Ga0105249_10168166 | 3300009553 | Bacteria | 2124 |
| 256 | Ga0105249_10218971 | 3300009553 | Bacteria | 1872 |
| 257 | Ga0105239_10000101 | 3300010375 | Bacteria | 119610 |
| 258 | Ga0105239_10005300 | 3300010375 | Bacteria | 15146 |
| 259 | Ga0105239_10015372 | 3300010375 | Bacteria | 8479 |
| 260 | Ga0105239_10020208 | 3300010375 | Bacteria | 7346 |
| 261 | Ga0105239_10023231 | 3300010375 | Bacteria | 6833 |
| 262 | Ga0105239_10478336 | 3300010375 | Bacteria | 1415 |
| 263 | Ga0105246_10007061 | 3300011119 | Bacteria | 6875 |
| 264 | Ga0105246_10018901 | 3300011119 | Bacteria | 4395 |
| 265 | Ga0105246_10033670 | 3300011119 | Bacteria | 3408 |
| 266 | Ga0157373_10003137 | 3300013100 | Bacteria | 12489 |
| 267 | Ga0157373_10019920 | 3300013100 | Bacteria | 4880 |
| 268 | Ga0157373_10038045 | 3300013100 | Unclassified | 3448 |
| 269 | Ga0157371_10182197 | 3300013102 | Bacteria | 1502 |
| 270 | Ga0157370_10015201 | 3300013104 | Bacteria | 7838 |
| 271 | Ga0157370_10015874 | 3300013104 | Bacteria | 7641 |
| 272 | Ga0157369_10029201 | 3300013105 | Bacteria | 6096 |
| 273 | Ga0157369_10036494 | 3300013105 | Bacteria | 5384 |
| 274 | Ga0157374_10000029 | 3300013296 | Bacteria | 211547 |
| 275 | Ga0157374_10002518 | 3300013296 | Bacteria | 15459 |
| 276 | Ga0157374_10009357 | 3300013296 | Bacteria | 8407 |
| 277 | Ga0157374_10022675 | 3300013296 | Bacteria | 5603 |
| 278 | Ga0157374_10228827 | 3300013296 | Bacteria | 1826 |
| 279 | Ga0157374_10229327 | 3300013296 | Unclassified | 1824 |
| 280 | Ga0157374_10274678 | 3300013296 | Bacteria | 1662 |
| 281 | Ga0157374_10457765 | 3300013296 | Unclassified | 1278 |
| 282 | Ga0157378_10002981 | 3300013297 | Bacteria | 15034 |
| 283 | Ga0157378_10014684 | 3300013297 | Bacteria | 6861 |
| 284 | Ga0157378_10036566 | 3300013297 | Bacteria | 4346 |
| 285 | Ga0157378_10045202 | 3300013297 | Bacteria | 3912 |
| 286 | Ga0157378_10062832 | 3300013297 | Bacteria | 3317 |
| 287 | Ga0157378_10195028 | 3300013297 | Unclassified | 1913 |
| 288 | Ga0157378_10279760 | 3300013297 | Unclassified | 1608 |
| 289 | Ga0163162_10000355 | 3300013306 | Bacteria | 41762 |
| 290 | Ga0163162_10003500 | 3300013306 | Bacteria | 15011 |
| 291 | Ga0163162_10006493 | 3300013306 | Bacteria | 11324 |
| 292 | Ga0163162_10032916 | 3300013306 | Bacteria | 5149 |
| 293 | Ga0163162_10101459 | 3300013306 | Bacteria | 2969 |
| 294 | Ga0163162_10190355 | 3300013306 | Bacteria | 2179 |
| 295 | Ga0163162_10236468 | 3300013306 | Bacteria | 1957 |
| 296 | Ga0157372_10006751 | 3300013307 | Bacteria | 12201 |
| 297 | Ga0157372_10035569 | 3300013307 | Bacteria | 5484 |
| 298 | Ga0157372_10105613 | 3300013307 | Bacteria | 3221 |
| 299 | Ga0157372_10220850 | 3300013307 | Bacteria | 2197 |
| 300 | Ga0157372_10235796 | 3300013307 | Bacteria | 2122 |
| 301 | Ga0157375_10000207 | 3300013308 | Bacteria | 54636 |
| 302 | Ga0157375_10046071 | 3300013308 | Bacteria | 4249 |
| 303 | Ga0157375_10066270 | 3300013308 | Bacteria | 3604 |
| 304 | Ga0157375_10106141 | 3300013308 | Bacteria | 2900 |
| 305 | Ga0157375_10127200 | 3300013308 | Bacteria | 2664 |
| 306 | Ga0157375_10142343 | 3300013308 | Bacteria | 2526 |
| 307 | Ga0157375_10159336 | 3300013308 | Unclassified | 2398 |
| 308 | Ga0157375_10167901 | 3300013308 | Bacteria | 2340 |
| 309 | Ga0157375_10184107 | 3300013308 | Bacteria | 2241 |
| 310 | Ga0157375_10235105 | 3300013308 | Bacteria | 1992 |
| 311 | Ga0163163_10075457 | 3300014325 | Bacteria | 3365 |
| 312 | Ga0163163_10177947 | 3300014325 | Unclassified | 2174 |
| 313 | Ga0163163_10192403 | 3300014325 | Bacteria | 2088 |
| 314 | Ga0157380_10000443 | 3300014326 | Bacteria | 25341 |
| 315 | Ga0157380_10002654 | 3300014326 | Bacteria | 12120 |
| 316 | Ga0157380_10011948 | 3300014326 | Bacteria | 6282 |
| 317 | Ga0157380_10013569 | 3300014326 | Bacteria | 5948 |
| 318 | Ga0157380_10048129 | 3300014326 | Bacteria | 3357 |
| 319 | Ga0157380_10172883 | 3300014326 | Bacteria | 1890 |
| 320 | Ga0157380_10178839 | 3300014326 | Unclassified | 1862 |
| 321 | Ga0157380_10261892 | 3300014326 | Bacteria | 1571 |
| 322 | Ga0157380_10450270 | 3300014326 | Bacteria | 1236 |
| 323 | Ga0157377_10025096 | 3300014745 | Bacteria | 3176 |
| 324 | Ga0157377_10072696 | 3300014745 | Bacteria | 1991 |
| 325 | Ga0157379_10024379 | 3300014968 | Bacteria | 5371 |
| 326 | Ga0157379_10216518 | 3300014968 | Bacteria | 1735 |
| 327 | Ga0157379_10323816 | 3300014968 | Bacteria | 1407 |
| 328 | Ga0157379_10329740 | 3300014968 | Unclassified | 1394 |
| 329 | Ga0157376_10002108 | 3300014969 | Bacteria | 13383 |
| 330 | Ga0157376_10021073 | 3300014969 | Bacteria | 5057 |
| 331 | Ga0157376_10088629 | 3300014969 | Bacteria | 2673 |
| 332 | Ga0157376_10164905 | 3300014969 | Bacteria | 2012 |
| 333 | Ga0157376_10311592 | 3300014969 | Bacteria | 1493 |
| 334 | Ga0157376_10330992 | 3300014969 | Bacteria | 1451 |
| 335 | Ga0182005_1000280 | 3300015265 | Bacteria | 32088 |
| 336 | Ga0163161_10004389 | 3300017792 | Bacteria | 9834 |
| 337 | Ga0163161_10004778 | 3300017792 | Bacteria | 9431 |
| 338 | Ga0163161_10144685 | 3300017792 | Bacteria | 1802 |
| 339 | Ga0213876_10005477 | 3300021384 | Bacteria | 6969 |
| 340 | Ga0209436_101063 | 3300025208 | Bacteria | 10401 |
| 341 | Ga0209646_1000003 | 3300025246 | Bacteria | 1160860 |
| 342 | Ga0209646_1001862 | 3300025246 | Bacteria | 5193 |
| 343 | Ga0209026_1000614 | 3300025250 | Bacteria | 22834 |
| 344 | Ga0209673_1000962 | 3300025273 | Bacteria | 35913 |
| 345 | Ga0209676_1000584 | 3300025292 | Bacteria | 54694 |
| 346 | Ga0209564_1003078 | 3300025295 | Bacteria | 11823 |
| 347 | Ga0209758_1002110 | 3300025297 | Bacteria | 21061 |
| 348 | Ga0209758_1011568 | 3300025297 | Bacteria | 5085 |
| 349 | Ga0209050_1000561 | 3300025298 | Bacteria | 60726 |
| 350 | Ga0207426_1000093 | 3300025302 | Bacteria | 277663 |
| 351 | Ga0207426_1000187 | 3300025302 | Bacteria | 153809 |
| 352 | Ga0207426_1015489 | 3300025302 | Bacteria | 2761 |
| 353 | Ga0209257_1000005 | 3300025304 | Bacteria | 1592528 |
| 354 | Ga0209257_1010390 | 3300025304 | Bacteria | 4720 |
| 355 | Ga0207682_10013064 | 3300025893 | Bacteria | 3237 |
| 356 | Ga0207682_10069148 | 3300025893 | Bacteria | 1493 |
| 357 | Ga0207642_10016957 | 3300025899 | Bacteria | 2758 |
| 358 | Ga0207642_10078093 | 3300025899 | Bacteria | 1599 |
| 359 | Ga0207688_10014165 | 3300025901 | Bacteria | 4338 |
| 360 | Ga0207680_10193039 | 3300025903 | Bacteria | 1383 |
| 361 | Ga0207647_10020994 | 3300025904 | Bacteria | 4367 |
| 362 | Ga0207645_10000193 | 3300025907 | Bacteria | 49552 |
| 363 | Ga0207645_10000279 | 3300025907 | Bacteria | 42459 |
| 364 | Ga0207645_10001124 | 3300025907 | Bacteria | 22129 |
| 365 | Ga0207645_10007389 | 3300025907 | Bacteria | 7770 |
| 366 | Ga0207643_10002695 | 3300025908 | Bacteria | 9596 |
| 367 | Ga0207643_10008261 | 3300025908 | Bacteria | 5588 |
| 368 | Ga0207643_10022145 | 3300025908 | Bacteria | 3497 |
| 369 | Ga0207643_10022803 | 3300025908 | Bacteria | 3450 |
| 370 | Ga0207643_10038307 | 3300025908 | Bacteria | 2692 |
| 371 | Ga0207654_10028214 | 3300025911 | Bacteria | 3059 |
| 372 | Ga0207695_10001513 | 3300025913 | Bacteria | 38611 |
| 373 | Ga0207695_10002144 | 3300025913 | Bacteria | 29897 |
| 374 | Ga0207695_10044421 | 3300025913 | Unclassified | 4726 |
| 375 | Ga0207695_10046762 | 3300025913 | Bacteria | 4584 |
| 376 | Ga0207695_10137474 | 3300025913 | Bacteria | 2395 |
| 377 | Ga0207671_10002804 | 3300025914 | Bacteria | 18168 |
| 378 | Ga0207671_10003963 | 3300025914 | Bacteria | 14397 |
| 379 | Ga0207671_10005605 | 3300025914 | Bacteria | 11520 |
| 380 | Ga0207671_10008668 | 3300025914 | Bacteria | 8586 |
| 381 | Ga0207671_10019962 | 3300025914 | Bacteria | 5111 |
| 382 | Ga0207671_10025430 | 3300025914 | Bacteria | 4447 |
| 383 | Ga0207671_10130845 | 3300025914 | Bacteria | 1926 |
| 384 | Ga0207662_10049696 | 3300025918 | Bacteria | 2488 |
| 385 | Ga0207657_10005188 | 3300025919 | Bacteria | 13665 |
| 386 | Ga0207657_10092518 | 3300025919 | Bacteria | 2520 |
| 387 | Ga0207657_10167202 | 3300025919 | Bacteria | 1783 |
| 388 | Ga0207649_10068462 | 3300025920 | Bacteria | 2257 |
| 389 | Ga0207649_10112130 | 3300025920 | Bacteria | 1824 |
| 390 | Ga0207652_10000093 | 3300025921 | Bacteria | 98248 |
| 391 | Ga0207681_10018827 | 3300025923 | Bacteria | 4355 |
| 392 | Ga0207681_10122224 | 3300025923 | Bacteria | 1911 |
| 393 | Ga0207681_10258681 | 3300025923 | Bacteria | 1362 |
| 394 | Ga0207694_10206118 | 3300025924 | Bacteria | 1601 |
| 395 | Ga0207650_10106496 | 3300025925 | Bacteria | 2165 |
| 396 | Ga0207659_10006163 | 3300025926 | Bacteria | 7334 |
| 397 | Ga0207659_10031482 | 3300025926 | Unclassified | 3632 |
| 398 | Ga0207659_10283410 | 3300025926 | Bacteria | 1355 |
| 399 | Ga0207659_10300091 | 3300025926 | Bacteria | 1319 |
| 400 | Ga0207700_10078365 | 3300025928 | Bacteria | 2570 |
| 401 | Ga0207690_10014232 | 3300025932 | Bacteria | 4801 |
| 402 | Ga0207706_10037886 | 3300025933 | Bacteria | 4279 |
| 403 | Ga0207706_10082970 | 3300025933 | Unclassified | 2817 |
| 404 | Ga0207686_10002379 | 3300025934 | Bacteria | 10261 |
| 405 | Ga0207686_10175111 | 3300025934 | Bacteria | 1516 |
| 406 | Ga0207670_10002207 | 3300025936 | Bacteria | 10177 |
| 407 | Ga0207670_10034377 | 3300025936 | Bacteria | 3275 |
| 408 | Ga0207670_10280269 | 3300025936 | Bacteria | 1299 |
| 409 | Ga0207669_10019354 | 3300025937 | Unclassified | 3543 |
| 410 | Ga0207704_10013780 | 3300025938 | Bacteria | 4061 |
| 411 | Ga0207704_10062827 | 3300025938 | Bacteria | 2311 |
| 412 | Ga0207704_10072127 | 3300025938 | Bacteria | 2194 |
| 413 | Ga0207704_10124733 | 3300025938 | Unclassified | 1770 |
| 414 | Ga0207704_10159396 | 3300025938 | Bacteria | 1604 |
| 415 | Ga0207691_10020637 | 3300025940 | Bacteria | 6228 |
| 416 | Ga0207691_10033523 | 3300025940 | Unclassified | 4780 |
| 417 | Ga0207691_10034558 | 3300025940 | Bacteria | 4700 |
| 418 | Ga0207691_10063680 | 3300025940 | Bacteria | 3344 |
| 419 | Ga0207691_10065070 | 3300025940 | Bacteria | 3302 |
| 420 | Ga0207691_10066517 | 3300025940 | Bacteria | 3260 |
| 421 | Ga0207691_10078777 | 3300025940 | Unclassified | 2966 |
| 422 | Ga0207691_10107322 | 3300025940 | Bacteria | 2486 |
| 423 | Ga0207689_10001574 | 3300025942 | Bacteria | 21618 |
| 424 | Ga0207689_10005101 | 3300025942 | Bacteria | 11812 |
| 425 | Ga0207689_10006249 | 3300025942 | Bacteria | 10556 |
| 426 | Ga0207689_10016558 | 3300025942 | Bacteria | 6239 |
| 427 | Ga0207689_10027543 | 3300025942 | Bacteria | 4755 |
| 428 | Ga0207689_10029959 | 3300025942 | Bacteria | 4538 |
| 429 | Ga0207689_10041176 | 3300025942 | Bacteria | 3822 |
| 430 | Ga0207689_10046666 | 3300025942 | Bacteria | 3580 |
| 431 | Ga0207689_10051265 | 3300025942 | Bacteria | 3402 |
| 432 | Ga0207689_10114379 | 3300025942 | Bacteria | 2218 |
| 433 | Ga0207661_10016817 | 3300025944 | Bacteria | 5400 |
| 434 | Ga0207661_10017076 | 3300025944 | Bacteria | 5362 |
| 435 | Ga0207661_10050302 | 3300025944 | Bacteria | 3320 |
| 436 | Ga0207679_10006182 | 3300025945 | Bacteria | 7560 |
| 437 | Ga0207679_10040417 | 3300025945 | Bacteria | 3338 |
| 438 | Ga0207679_10298365 | 3300025945 | Bacteria | 1388 |
| 439 | Ga0207667_10003174 | 3300025949 | Bacteria | 20328 |
| 440 | Ga0207667_10134411 | 3300025949 | Bacteria | 2547 |
| 441 | Ga0207667_10211102 | 3300025949 | Unclassified | 1990 |
| 442 | Ga0207651_10011488 | 3300025960 | Bacteria | 4961 |
| 443 | Ga0207651_10037260 | 3300025960 | Bacteria | 3185 |
| 444 | Ga0207651_10099594 | 3300025960 | Unclassified | 2153 |
| 445 | Ga0207712_10007096 | 3300025961 | Bacteria | 7066 |
| 446 | Ga0207712_10008345 | 3300025961 | Bacteria | 6543 |
| 447 | Ga0207712_10064471 | 3300025961 | Bacteria | 2612 |
| 448 | Ga0207712_10349203 | 3300025961 | Bacteria | 1229 |
| 449 | Ga0207668_10032790 | 3300025972 | Bacteria | 3437 |
| 450 | Ga0207640_10201131 | 3300025981 | Bacteria | 1510 |
| 451 | Ga0207658_10008348 | 3300025986 | Bacteria | 7052 |
| 452 | Ga0207677_10193738 | 3300026023 | Bacteria | 1610 |
| 453 | Ga0207703_10013272 | 3300026035 | Bacteria | 6417 |
| 454 | Ga0207639_10036027 | 3300026041 | Unclassified | 3664 |
| 455 | Ga0207639_10185266 | 3300026041 | Bacteria | 1774 |
| 456 | Ga0207678_10016529 | 3300026067 | Bacteria | 6479 |
| 457 | Ga0207708_10014031 | 3300026075 | Bacteria | 5985 |
| 458 | Ga0207708_10030440 | 3300026075 | Bacteria | 4092 |
| 459 | Ga0207708_10050880 | 3300026075 | Bacteria | 3154 |
| 460 | Ga0207702_10011501 | 3300026078 | Bacteria | 7373 |
| 461 | Ga0207702_10146011 | 3300026078 | Bacteria | 2146 |
| 462 | Ga0207702_10229277 | 3300026078 | Bacteria | 1735 |
| 463 | Ga0207641_10000061 | 3300026088 | Bacteria | 160161 |
| 464 | Ga0207641_10001165 | 3300026088 | Bacteria | 26454 |
| 465 | Ga0207641_10107164 | 3300026088 | Bacteria | 2471 |
| 466 | Ga0207641_10409354 | 3300026088 | Bacteria | 1304 |
| 467 | Ga0207648_10004327 | 3300026089 | Bacteria | 14627 |
| 468 | Ga0207648_10007665 | 3300026089 | Bacteria | 10566 |
| 469 | Ga0207648_10066730 | 3300026089 | Bacteria | 3137 |
| 470 | Ga0207648_10077588 | 3300026089 | Unclassified | 2896 |
| 471 | Ga0207648_10099073 | 3300026089 | Bacteria | 2552 |
| 472 | Ga0207648_10198308 | 3300026089 | Bacteria | 1780 |
| 473 | Ga0207648_10203134 | 3300026089 | Bacteria | 1758 |
| 474 | Ga0207676_10012851 | 3300026095 | Bacteria | 6012 |
| 475 | Ga0207676_10265381 | 3300026095 | Bacteria | 1552 |
| 476 | Ga0207674_10006014 | 3300026116 | Bacteria | 14353 |
| 477 | Ga0207674_10069011 | 3300026116 | Bacteria | 3555 |
| 478 | Ga0207674_10094746 | 3300026116 | Bacteria | 2972 |
| 479 | Ga0207674_10121792 | 3300026116 | Bacteria | 2575 |
| 480 | Ga0207674_10147747 | 3300026116 | Unclassified | 2308 |
| 481 | Ga0207675_100003242 | 3300026118 | Bacteria | 15948 |
| 482 | Ga0207675_100013361 | 3300026118 | Bacteria | 7661 |
| 483 | Ga0207675_100034715 | 3300026118 | Bacteria | 4704 |
| 484 | Ga0207675_100038225 | 3300026118 | Bacteria | 4478 |
| 485 | Ga0207675_100096291 | 3300026118 | Unclassified | 2786 |
| 486 | Ga0207675_100105919 | 3300026118 | Bacteria | 2651 |
| 487 | Ga0207675_100153605 | 3300026118 | Bacteria | 2192 |
| 488 | Ga0207683_10001985 | 3300026121 | Bacteria | 18106 |
| 489 | Ga0207683_10002587 | 3300026121 | Bacteria | 15805 |
| 490 | Ga0207683_10005259 | 3300026121 | Bacteria | 11109 |
| 491 | Ga0207683_10028416 | 3300026121 | Bacteria | 4836 |
| 492 | Ga0207698_10032736 | 3300026142 | Bacteria | 3769 |
| 493 | Ga0207698_10053125 | 3300026142 | Bacteria | 3108 |
| 494 | Ga0207698_10075351 | 3300026142 | Bacteria | 2696 |
| 495 | Ga0209974_10024879 | 3300027876 | Bacteria | 1981 |
| 496 | Ga0207428_10186678 | 3300027907 | Unclassified | 1564 |
| 497 | Ga0207428_10212738 | 3300027907 | Bacteria | 1452 |
| 498 | Ga0268266_10000149 | 3300028379 | Bacteria | 134809 |
| 499 | Ga0268266_10081142 | 3300028379 | Bacteria | 2827 |
| 500 | Ga0268266_10133298 | 3300028379 | Bacteria | 2224 |
| 501 | Ga0268265_10049918 | 3300028380 | Bacteria | 3150 |
| 502 | Ga0268265_10169008 | 3300028380 | Bacteria | 1866 |
| 503 | Ga0268265_10357801 | 3300028380 | Bacteria | 1335 |
| 504 | Ga0268264_10000064 | 3300028381 | Bacteria | 301274 |
| 505 | Ga0268264_10005438 | 3300028381 | Bacteria | 10791 |
| 506 | Ga0268264_10017824 | 3300028381 | Bacteria | 5812 |
| 507 | Ga0268264_10037388 | 3300028381 | Bacteria | 4003 |
| 508 | Ga0268264_10040678 | 3300028381 | Bacteria | 3841 |
| 509 | Ga0268264_10128374 | 3300028381 | Bacteria | 2244 |
| 510 | Ga0268264_10135630 | 3300028381 | Bacteria | 2188 |
| 511 | Ga0268264_10274058 | 3300028381 | Bacteria | 1577 |
| 512 | Ga0265336_10041509 | 3300028666 | Bacteria | 1406 |
| 513 | Ga0307515_10031913 | 3300028794 | Bacteria | 8750 |
| 514 | Ga0307515_10072264 | 3300028794 | Bacteria | 4660 |
| 515 | Ga0265320_10001749 | 3300031240 | Bacteria | 15394 |
| 516 | Ga0307513_10017090 | 3300031456 | Bacteria | 8717 |
| 517 | Ga0307513_10021862 | 3300031456 | Bacteria | 7538 |
| 518 | Ga0307513_10158870 | 3300031456 | Bacteria | 2156 |
| 519 | Ga0307509_10032616 | 3300031507 | Bacteria | 5739 |
| 520 | Ga0307509_10060648 | 3300031507 | Bacteria | 3997 |
| 521 | Ga0307509_10097570 | 3300031507 | Bacteria | 2987 |
| 522 | Ga0307509_10128864 | 3300031507 | Bacteria | 2490 |
| 523 | Ga0307408_100065279 | 3300031548 | Bacteria | 2669 |
| 524 | Ga0307508_10000052 | 3300031616 | Bacteria | 129344 |
| 525 | Ga0307508_10000425 | 3300031616 | Bacteria | 50122 |
| 526 | Ga0316576_10025408 | 3300031727 | Unclassified | 4147 |
| 527 | Ga0316576_10059748 | 3300031727 | Unclassified | 2791 |
| 528 | Ga0316578_10138094 | 3300031728 | Bacteria | 1468 |
| 529 | Ga0307405_10151283 | 3300031731 | Unclassified | 1632 |
| 530 | Ga0307413_10001643 | 3300031824 | Bacteria | 8666 |
| 531 | Ga0307410_10128870 | 3300031852 | Unclassified | 1856 |
| 532 | Ga0307406_10064141 | 3300031901 | Bacteria | 2383 |
| 533 | Ga0307406_10110878 | 3300031901 | Bacteria | 1889 |
| 534 | Ga0307407_10004105 | 3300031903 | Bacteria | 6127 |
| 535 | Ga0307407_10044350 | 3300031903 | Bacteria | 2506 |
| 536 | Ga0307407_10053432 | 3300031903 | Bacteria | 2324 |
| 537 | Ga0307412_10031068 | 3300031911 | Bacteria | 3369 |
| 538 | Ga0307412_10231195 | 3300031911 | Unclassified | 1424 |
| 539 | Ga0307409_100008128 | 3300031995 | Bacteria | 6338 |
| 540 | Ga0307409_100008129 | 3300031995 | Bacteria | 6338 |
| 541 | Ga0307416_100002761 | 3300032002 | Bacteria | 10193 |
| 542 | Ga0307416_100129054 | 3300032002 | Bacteria | 2271 |
| 543 | Ga0307416_100328727 | 3300032002 | Unclassified | 1535 |
| 544 | Ga0307414_10000021 | 3300032004 | Bacteria | 213521 |
| 545 | Ga0307414_10009337 | 3300032004 | Bacteria | 5629 |
| 546 | Ga0307414_10028590 | 3300032004 | Bacteria | 3618 |
| 547 | Ga0307414_10168513 | 3300032004 | Bacteria | 1748 |
| 548 | Ga0307414_10191614 | 3300032004 | Bacteria | 1655 |
| 549 | Ga0307411_10173876 | 3300032005 | Unclassified | 1627 |
| 550 | Ga0307415_100075560 | 3300032126 | Bacteria | 2385 |
| 551 | Ga0373928_0000580 | 3300035084 | Bacteria | 7191 |
| 552 | Ga0373953_0074295 | 3300035117 | Bacteria | 1406 |
| 553 | Ga0373943_0100061 | 3300035170 | Bacteria | 1515 |
| 554 | Ga0373927_0019622 | 3300035695 | Bacteria | 4432 |
| 555 | Ga0373947_0047085 | 3300035725 | Bacteria | 2583 |
| 556 | Ga0316582_0008001 | 3300036647 | Archaea | 5657 |
| 557 | Ga0395899_0000001 | 3300037312 | Bacteria | 1750322 |
| 558 | Ga0395900_0055523 | 3300037418 | Unclassified | 4078 |
| 559 | Ga0395905_0000737 | 3300037471 | Bacteria | 43081 |
| 560 | Ga0395905_0080252 | 3300037471 | Bacteria | 3058 |
| 561 | Ga0395905_0097874 | 3300037471 | Unclassified | 2755 |
| 562 | Ga0436365_1354401 | 3300039437 | Bacteria | 12100 |
| 563 | Ga0451789_0136231 | 3300041443 | Bacteria | 1215 |
| 564 | Ga0451791_1150138 | 3300041451 | Bacteria | 3013 |
| 565 | Ga0451797_0598084 | 3300041453 | Bacteria | 1185 |
| 566 | Ga0451798_0094830 | 3300041458 | Bacteria | 1867 |
| 567 | Ga0451807_1542018 | 3300041486 | Bacteria | 2092 |
| 568 | Ga0451807_2585360 | 3300041486 | Bacteria | 5257 |
| 569 | Ga0451853_2458528 | 3300041512 | Bacteria | 1580 |
| 570 | Ga0439442_007186 | 3300042002 | Bacteria | 2240 |
| 571 | Ga0439449_0023577 | 3300042007 | Bacteria | 2301 |
| 572 | Ga0439457_014352 | 3300042014 | Unclassified | 1773 |
| 573 | Ga0450898_014017 | 3300042134 | Bacteria | 1343 |
| 574 | Ga0450899_003069 | 3300042135 | Bacteria | 1801 |
| 575 | Ga0451577_0007245 | 3300042876 | Bacteria | 10930 |
| 576 | Ga0451577_0011066 | 3300042876 | Bacteria | 8569 |
| 577 | Ga0451577_0479263 | 3300042876 | Bacteria | 1129 |
| 578 | Ga0466969_0000399 | 3300044656 | Bacteria | 23843 |
| 579 | Ga0466972_0000027 | 3300044658 | Bacteria | 174082 |
| 580 | Ga0466972_0000038 | 3300044658 | Bacteria | 135937 |
| 581 | Ga0466972_0001168 | 3300044658 | Bacteria | 12577 |
| 582 | Ga0466972_0012027 | 3300044658 | Bacteria | 4348 |
| 583 | Ga0466972_0051935 | 3300044658 | Bacteria | 1977 |
| 584 | Ga0466966_0019820 | 3300044684 | Bacteria | 4423 |
| 585 | Ga0453684_0000549 | 3300044712 | Bacteria | 141927 |
| 586 | Ga0453684_0028193 | 3300044712 | Bacteria | 8024 |
| 587 | Ga0453684_0076844 | 3300044712 | Unclassified | 4190 |
| 588 | Ga0453684_0122492 | 3300044712 | Bacteria | 3137 |
| 589 | Ga0453684_0147300 | 3300044712 | Bacteria | 2802 |
| 590 | Ga0466968_0039794 | 3300044735 | Bacteria | 1980 |
| 591 | Ga0466959_0000011 | 3300045049 | Bacteria | 173387 |
| 592 | Ga0451576_0003363 | 3300045051 | Bacteria | 22150 |
| 593 | Ga0495627_017509 | 3300046453 | Bacteria | 2433 |
| 594 | Ga0495590_0003661 | 3300046457 | Bacteria | 6257 |
| 595 | Ga0495638_0000020 | 3300046460 | Bacteria | 372434 |
| 596 | Ga0495638_0108767 | 3300046460 | Bacteria | 1649 |
| 597 | Ga0495664_0062271 | 3300046477 | Unclassified | 2222 |
| 598 | Ga0495664_0132110 | 3300046477 | Bacteria | 1512 |
| 599 | Ga0495616_0003820 | 3300046513 | Bacteria | 9602 |
| 600 | Ga0495632_0153839 | 3300046519 | Bacteria | 1062 |
| 601 | Ga0495648_0001120 | 3300046524 | Bacteria | 27151 |
| 602 | Ga0495587_0019757 | 3300046536 | Bacteria | 4165 |
| 603 | Ga0495587_0073474 | 3300046536 | Bacteria | 1987 |
| 604 | Ga0495633_0018045 | 3300046558 | Bacteria | 3589 |
| 605 | Ga0495668_0007170 | 3300046616 | Bacteria | 7165 |
| 606 | Ga0495611_0000099 | 3300046648 | Bacteria | 60428 |
| 607 | Ga0495625_0084319 | 3300046660 | Bacteria | 2207 |
| 608 | Ga0495625_0114616 | 3300046660 | Bacteria | 1840 |
| 609 | Ga0495604_0091570 | 3300047317 | Unclassified | 2255 |
| 610 | Ga0495672_0010307 | 3300047320 | Bacteria | 6677 |
| 611 | Ga0495672_0013741 | 3300047320 | Bacteria | 5571 |
| 612 | Ga0495672_0128448 | 3300047320 | Bacteria | 1337 |
| 613 | Ga0495687_000158 | 3300047443 | Bacteria | 103129 |
| 614 | Ga0495675_0069091 | 3300047444 | Unclassified | 2231 |
| 615 | Ga0495684_0070533 | 3300047471 | Bacteria | 2657 |
| 616 | Ga0496104_0171454 | 3300048907 | Bacteria | 2081 |
| 617 | Ga0496124_0162877 | 3300048927 | Bacteria | 1737 |
| 618 | Ga0501298_016836 | 3300049521 | Bacteria | 1329 |
| 619 | Ga0501031_0116488 | 3300049568 | Bacteria | 1745 |
| 620 | Ga0501032_0002056 | 3300049569 | Bacteria | 15891 |
| 621 | Ga0501033_0000748 | 3300049570 | Bacteria | 29907 |
| 622 | Ga0501034_0019490 | 3300049571 | Bacteria | 6938 |
| 623 | Ga0501034_0142306 | 3300049571 | Bacteria | 2377 |
| 624 | Ga0501034_0291970 | 3300049571 | Unclassified | 1568 |
| 625 | Ga0501036_0034543 | 3300049572 | Bacteria | 4277 |
| 626 | Ga0501037_0002859 | 3300049573 | Bacteria | 12519 |
| 627 | Ga0501037_0153501 | 3300049573 | Bacteria | 1644 |
| 628 | Ga0501038_0001234 | 3300049574 | Bacteria | 23204 |
| 629 | Ga0501038_0015182 | 3300049574 | Bacteria | 7007 |
| 630 | Ga0501042_0031920 | 3300049578 | Bacteria | 3727 |
| 631 | Ga0501043_0009431 | 3300049579 | Bacteria | 7661 |
| 632 | Ga0501043_0010043 | 3300049579 | Bacteria | 7425 |
| 633 | Ga0501043_0195902 | 3300049579 | Bacteria | 1569 |
| 634 | Ga0501046_0002099 | 3300049580 | Bacteria | 18888 |
| 635 | Ga0501047_0005561 | 3300049581 | Bacteria | 11865 |
| 636 | Ga0501047_0035937 | 3300049581 | Bacteria | 4787 |
| 637 | Ga0501047_0098430 | 3300049581 | Bacteria | 2803 |
| 638 | Ga0501047_0141165 | 3300049581 | Bacteria | 2287 |
| 639 | Ga0501047_0190767 | 3300049581 | Bacteria | 1913 |
| 640 | Ga0501048_0053093 | 3300049582 | Bacteria | 2883 |
| 641 | Ga0501067_0006365 | 3300049583 | Bacteria | 6540 |
| 642 | Ga0501068_0000585 | 3300049584 | Bacteria | 18482 |
| 643 | Ga0501070_0016579 | 3300049586 | Bacteria | 6188 |
| 644 | Ga0501071_0008837 | 3300049587 | Bacteria | 6678 |
| 645 | Ga0501072_0144945 | 3300049588 | Bacteria | 1894 |
| 646 | Ga0501073_0011782 | 3300049589 | Bacteria | 6383 |
| 647 | Ga0501074_0009290 | 3300049590 | Bacteria | 7140 |
| 648 | Ga0501076_0052809 | 3300049592 | Bacteria | 3220 |
| 649 | Ga0501077_0000980 | 3300049593 | Bacteria | 17208 |
| 650 | Ga0501202_000294 | 3300049652 | Bacteria | 6851 |
| 651 | Ga0501217_029450 | 3300049661 | Bacteria | 1343 |
| 652 | Ga0501223_003903 | 3300049663 | Bacteria | 3219 |
| 653 | Ga0501223_016989 | 3300049663 | Bacteria | 1437 |
| 654 | Ga0501224_004619 | 3300049664 | Bacteria | 1959 |
| 655 | Ga0501235_004698 | 3300049669 | Bacteria | 2955 |
| 656 | Ga0501242_004225 | 3300049674 | Bacteria | 1589 |
| 657 | Ga0501243_000060 | 3300049675 | Bacteria | 10743 |
| 658 | Ga0501257_025025 | 3300049686 | Bacteria | 1419 |
| 659 | Ga0501257_032032 | 3300049686 | Bacteria | 1270 |
| 660 | Ga0501225_0001832 | 3300049705 | Bacteria | 6659 |
| 661 | Ga0501225_0003149 | 3300049705 | Bacteria | 5040 |
| 662 | Ga0501225_0005591 | 3300049705 | Bacteria | 3683 |
| 663 | Ga0501234_003841 | 3300049707 | Unclassified | 2363 |
| 664 | Ga0501079_0000653 | 3300049741 | Bacteria | 23159 |
| 665 | Ga0501080_0001948 | 3300049742 | Bacteria | 17823 |
| 666 | Ga0501080_0206044 | 3300049742 | Bacteria | 1804 |
| 667 | Ga0501083_0093390 | 3300049744 | Bacteria | 1986 |
| 668 | Ga0501264_000050 | 3300049761 | Bacteria | 16836 |
| 669 | Ga0501266_003291 | 3300049763 | Bacteria | 2009 |
| 670 | Ga0501035_0000115 | 3300049822 | Bacteria | 98344 |
| 671 | Ga0501035_0017694 | 3300049822 | Bacteria | 6573 |
| 672 | Ga0501035_0068866 | 3300049822 | Bacteria | 3137 |
| 673 | Ga0501035_0285520 | 3300049822 | Bacteria | 1394 |
| 674 | Ga0501044_0000027 | 3300049823 | Bacteria | 181388 |
| 675 | Ga0501044_0007409 | 3300049823 | Bacteria | 12068 |
| 676 | Ga0501044_0165502 | 3300049823 | Bacteria | 2185 |
| 677 | Ga0501044_0272675 | 3300049823 | Bacteria | 1627 |
| 678 | Ga0501212_011777 | 3300049851 | Bacteria | 1265 |
| 679 | nmdc:mga00v17_582_c2 | 3300050491 | Bacteria | 10150 |
| 680 | nmdc:mga05p37_2387_c1 | 3300050507 | Bacteria | 21852 |
| 681 | nmdc:mga05p37_42353_c1 | 3300050507 | Bacteria | 5594 |
| 682 | nmdc:mga09592_236206_c1 | 3300050508 | Bacteria | 1584 |
| 683 | nmdc:mga09592_46734_c1 | 3300050508 | Unclassified | 3647 |
| 684 | nmdc:mga0qj67_25750_c1 | 3300050509 | Bacteria | 4549 |
| 685 | nmdc:mga06r32_57778_c1 | 3300050510 | Unclassified | 3727 |
| 686 | nmdc:mga06r32_84417_c1 | 3300050510 | Bacteria | 3095 |
| 687 | nmdc:mga08y16_160734_c1 | 3300050511 | Bacteria | 2334 |
| 688 | nmdc:mga08y16_198554_c1 | 3300050511 | Bacteria | 2079 |
| 689 | nmdc:mga08y16_205082_c1 | 3300050511 | Bacteria | 2043 |
| 690 | nmdc:mga08y16_48682_c1 | 3300050511 | Unclassified | 4435 |
| 691 | nmdc:mga08y16_8382_c1 | 3300050511 | Bacteria | 10814 |
| 692 | Ga0500578_0000009 | 3300053086 | Bacteria | 219807 |
| 693 | Ga0500646_0043331 | 3300053090 | Bacteria | 1274 |
| 694 | Ga0500583_0000036 | 3300053092 | Bacteria | 95404 |
| 695 | Ga0500583_0000666 | 3300053092 | Bacteria | 10123 |
| 696 | Ga0500583_0001637 | 3300053092 | Bacteria | 6517 |
| 697 | Ga0500583_0036919 | 3300053092 | Bacteria | 2191 |
| 698 | Ga0500651_0019024 | 3300053093 | Bacteria | 4260 |
| 699 | Ga0500568_0000346 | 3300053139 | Bacteria | 36068 |
| 700 | Ga0500568_0098148 | 3300053139 | Bacteria | 1100 |
| 701 | Ga0500588_0057524 | 3300053146 | Bacteria | 1234 |
| 702 | Ga0500616_0000007 | 3300053153 | Bacteria | 836875 |
| 703 | Ga0500616_0008695 | 3300053153 | Bacteria | 6269 |
| 704 | Ga0500622_0001640 | 3300053156 | Bacteria | 17525 |
| 705 | Ga0500622_0006324 | 3300053156 | Bacteria | 6908 |
| 706 | Ga0500622_0026835 | 3300053156 | Bacteria | 3038 |
| 707 | Ga0501084_0044840 | 3300054114 | Bacteria | 3702 |
| 708 | Ga0501082_0020527 | 3300060353 | Bacteria | 5694 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046519 | Ga0495632_0153839 | Ga0495632_0153839_17_958 | 305 |
| 2 | 3300039437 | Ga0436365_1354401 | Ga0436365_1354401_801_1781 | 318 |
| 3 | 3300044684 | Ga0466966_0019820 | Ga0466966_0019820_3421_4401 | 318 |
| 4 | 3300042876 | Ga0451577_0011066 | Ga0451577_0011066_1965_3098 | 331 |
| 5 | 3300044712 | Ga0453684_0028193 | Ga0453684_0028193_1866_2999 | 331 |
| 6 | 3300045051 | Ga0451576_0003363 | Ga0451576_0003363_15739_16872 | 331 |
| 7 | 3300014325 | Ga0163163_10177947 | Ga0163163_101779472 | 333 |
| 8 | 3300025908 | Ga0207643_10038307 | Ga0207643_100383072 | 334 |
| 9 | 3300050508 | nmdc:mga09592_46734_c1 | nmdc:mga09592_46734_c1_330_1340 | 335 |
| 10 | 3300050509 | nmdc:mga0qj67_25750_c1 | nmdc:mga0qj67_25750_c1_296_1306 | 335 |
| 11 | iso_pu_bacteria | 2818991442 | 2819576038 | 335 |
| 12 | 3300049822 | Ga0501035_0285520 | Ga0501035_0285520_326_1366 | 336 |
| 13 | 3300041443 | Ga0451789_0136231 | Ga0451789_0136231_17_1054 | 337 |
| 14 | 3300014326 | Ga0157380_10013569 | Ga0157380_100135692 | 338 |
| 15 | 3300027907 | Ga0207428_10186678 | Ga0207428_101866781 | 338 |
| 16 | 3300009094 | Ga0111539_10033434 | Ga0111539_100334344 | 339 |
| 17 | 3300050511 | nmdc:mga08y16_160734_c1 | nmdc:mga08y16_160734_c1_625_1794 | 339 |
| 18 | 3300046460 | Ga0495638_0108767 | Ga0495638_0108767_460_1530 | 341 |
| 19 | 3300046477 | Ga0495664_0132110 | Ga0495664_0132110_352_1413 | 341 |
| 20 | 3300046536 | Ga0495587_0019757 | Ga0495587_0019757_1009_2070 | 341 |
| 21 | 3300047444 | Ga0495675_0069091 | Ga0495675_0069091_265_1326 | 341 |
| 22 | 3300053092 | Ga0500583_0001637 | Ga0500583_0001637_4373_5443 | 341 |
| 23 | 3300042876 | Ga0451577_0479263 | Ga0451577_0479263_27_1067 | 342 |
| 24 | 3300044712 | Ga0453684_0122492 | Ga0453684_0122492_669_1709 | 342 |
| 25 | 3300047317 | Ga0495604_0091570 | Ga0495604_0091570_902_1960 | 342 |
| 26 | 3300053153 | Ga0500616_0008695 | Ga0500616_0008695_441_1487 | 343 |
| 27 | 3300037471 | Ga0395905_0000737 | Ga0395905_0000737_13693_14757 | 344 |
| 28 | 3300025926 | Ga0207659_10283410 | Ga0207659_102834102 | 346 |
| 29 | 3300026041 | Ga0207639_10036027 | Ga0207639_100360272 | 347 |
| 30 | 3300026116 | Ga0207674_10147747 | Ga0207674_101477472 | 347 |
| 31 | 3300031903 | Ga0307407_10044350 | Ga0307407_100443502 | 347 |
| 32 | 3300003322 | rootL2_10282538 | rootL2_102825383 | 348 |
| 33 | 3300053139 | Ga0500568_0098148 | Ga0500568_0098148_29_1075 | 348 |
| 34 | 3300035725 | Ga0373947_0047085 | Ga0373947_0047085_1050_2117 | 349 |
| 35 | 3300003322 | rootL2_10302482 | rootL2_103024821 | 350 |
| 36 | 3300003323 | rootH1_10387958 | rootH1_103879581 | 350 |
| 37 | 3300031727 | Ga0316576_10025408 | Ga0316576_100254086 | 350 |
| 38 | 3300036647 | Ga0316582_0008001 | Ga0316582_0008001_202_1362 | 350 |
| 39 | 3300005340 | Ga0070689_100345343 | Ga0070689_1003453431 | 351 |
| 40 | 3300005617 | Ga0068859_100000086 | Ga0068859_10000008656 | 351 |
| 41 | 3300005841 | Ga0068863_100009150 | Ga0068863_1000091508 | 351 |
| 42 | 3300005842 | Ga0068858_100017405 | Ga0068858_10001740511 | 351 |
| 43 | 3300005843 | Ga0068860_100002840 | Ga0068860_10000284014 | 351 |
| 44 | 3300006237 | Ga0097621_100070868 | Ga0097621_1000708682 | 351 |
| 45 | 3300006358 | Ga0068871_100001606 | Ga0068871_10000160611 | 351 |
| 46 | 3300006881 | Ga0068865_100028700 | Ga0068865_1000287003 | 351 |
| 47 | 3300006931 | Ga0097620_100000086 | Ga0097620_10000008628 | 351 |
| 48 | 3300013308 | Ga0157375_10167901 | Ga0157375_101679012 | 351 |
| 49 | 3300015265 | Ga0182005_1000280 | Ga0182005_100028027 | 351 |
| 50 | 3300025911 | Ga0207654_10028214 | Ga0207654_100282144 | 351 |
| 51 | 3300025938 | Ga0207704_10013780 | Ga0207704_100137803 | 351 |
| 52 | 3300026035 | Ga0207703_10013272 | Ga0207703_100132722 | 351 |
| 53 | 3300026088 | Ga0207641_10000061 | Ga0207641_10000061101 | 351 |
| 54 | 3300028381 | Ga0268264_10017824 | Ga0268264_100178245 | 351 |
| 55 | 3300028666 | Ga0265336_10041509 | Ga0265336_100415091 | 351 |
| 56 | 3300028794 | Ga0307515_10072264 | Ga0307515_100722642 | 351 |
| 57 | 3300032126 | Ga0307415_100075560 | Ga0307415_1000755602 | 351 |
| 58 | 3300046513 | Ga0495616_0003820 | Ga0495616_0003820_3179_4264 | 351 |
| 59 | 3300046660 | Ga0495625_0084319 | Ga0495625_0084319_607_1692 | 351 |
| 60 | 3300005337 | Ga0070682_100037733 | Ga0070682_1000377332 | 352 |
| 61 | 3300005466 | Ga0070685_10022566 | Ga0070685_100225662 | 352 |
| 62 | 3300005466 | Ga0070685_10034947 | Ga0070685_100349473 | 352 |
| 63 | 3300005578 | Ga0068854_100028862 | Ga0068854_1000288621 | 352 |
| 64 | 3300005844 | Ga0068862_100188425 | Ga0068862_1001884251 | 352 |
| 65 | 3300005937 | Ga0081455_10008109 | Ga0081455_100081092 | 352 |
| 66 | 3300028380 | Ga0268265_10357801 | Ga0268265_103578011 | 352 |
| 67 | 3300031507 | Ga0307509_10032616 | Ga0307509_100326166 | 352 |
| 68 | 3300031727 | Ga0316576_10059748 | Ga0316576_100597482 | 352 |
| 69 | 3300031728 | Ga0316578_10138094 | Ga0316578_101380941 | 352 |
| 70 | 3300041453 | Ga0451797_0598084 | Ga0451797_0598084_55_1146 | 352 |
| 71 | 3300041486 | Ga0451807_2585360 | Ga0451807_2585360_975_2066 | 352 |
| 72 | 3300046457 | Ga0495590_0003661 | Ga0495590_0003661_4312_5397 | 352 |
| 73 | 3300049581 | Ga0501047_0190767 | Ga0501047_0190767_341_1432 | 352 |
| 74 | iso_pu_bacteria | 2919692658 | 2919697628 | 352 |
| 75 | 3300025208 | Ga0209436_101063 | Ga0209436_10106310 | 353 |
| 76 | 3300046460 | Ga0495638_0000020 | Ga0495638_0000020_66954_68021 | 353 |
| 77 | 3300049568 | Ga0501031_0116488 | Ga0501031_0116488_222_1331 | 353 |
| 78 | 3300049569 | Ga0501032_0002056 | Ga0501032_0002056_4532_5779 | 353 |
| 79 | 3300049570 | Ga0501033_0000748 | Ga0501033_0000748_24108_25355 | 353 |
| 80 | 3300049571 | Ga0501034_0142306 | Ga0501034_0142306_753_1862 | 353 |
| 81 | 3300049572 | Ga0501036_0034543 | Ga0501036_0034543_2533_3780 | 353 |
| 82 | 3300049573 | Ga0501037_0153501 | Ga0501037_0153501_184_1431 | 353 |
| 83 | 3300049574 | Ga0501038_0001234 | Ga0501038_0001234_18329_19576 | 353 |
| 84 | 3300049578 | Ga0501042_0031920 | Ga0501042_0031920_2421_3530 | 353 |
| 85 | 3300049579 | Ga0501043_0195902 | Ga0501043_0195902_450_1559 | 353 |
| 86 | 3300049581 | Ga0501047_0098430 | Ga0501047_0098430_631_1740 | 353 |
| 87 | 3300049582 | Ga0501048_0053093 | Ga0501048_0053093_758_1867 | 353 |
| 88 | 3300049652 | Ga0501202_000294 | Ga0501202_000294_4034_5146 | 353 |
| 89 | 3300049822 | Ga0501035_0017694 | Ga0501035_0017694_490_1737 | 353 |
| 90 | 3300049823 | Ga0501044_0165502 | Ga0501044_0165502_563_1810 | 353 |
| 91 | 3300005328 | Ga0070676_10198100 | Ga0070676_101981001 | 354 |
| 92 | 3300005331 | Ga0070670_100032495 | Ga0070670_1000324953 | 354 |
| 93 | 3300005331 | Ga0070670_100133952 | Ga0070670_1001339522 | 354 |
| 94 | 3300005333 | Ga0070677_10000400 | Ga0070677_100004006 | 354 |
| 95 | 3300005338 | Ga0068868_100083152 | Ga0068868_1000831522 | 354 |
| 96 | 3300005340 | Ga0070689_100140712 | Ga0070689_1001407122 | 354 |
| 97 | 3300005347 | Ga0070668_100069315 | Ga0070668_1000693154 | 354 |
| 98 | 3300005353 | Ga0070669_100037494 | Ga0070669_1000374942 | 354 |
| 99 | 3300005354 | Ga0070675_100080373 | Ga0070675_1000803732 | 354 |
| 100 | 3300005354 | Ga0070675_100130221 | Ga0070675_1001302212 | 354 |
| 101 | 3300005356 | Ga0070674_100051483 | Ga0070674_1000514832 | 354 |
| 102 | 3300005356 | Ga0070674_100083274 | Ga0070674_1000832741 | 354 |
| 103 | 3300005356 | Ga0070674_100141716 | Ga0070674_1001417162 | 354 |
| 104 | 3300005364 | Ga0070673_100014554 | Ga0070673_1000145542 | 354 |
| 105 | 3300005364 | Ga0070673_100047596 | Ga0070673_1000475963 | 354 |
| 106 | 3300005441 | Ga0070700_100112425 | Ga0070700_1001124251 | 354 |
| 107 | 3300005456 | Ga0070678_100048685 | Ga0070678_1000486852 | 354 |
| 108 | 3300005459 | Ga0068867_100252211 | Ga0068867_1002522112 | 354 |
| 109 | 3300005543 | Ga0070672_100036103 | Ga0070672_1000361032 | 354 |
| 110 | 3300005543 | Ga0070672_100045621 | Ga0070672_1000456212 | 354 |
| 111 | 3300005543 | Ga0070672_100261311 | Ga0070672_1002613111 | 354 |
| 112 | 3300005544 | Ga0070686_100058855 | Ga0070686_1000588552 | 354 |
| 113 | 3300005548 | Ga0070665_100003454 | Ga0070665_1000034549 | 354 |
| 114 | 3300005548 | Ga0070665_100052967 | Ga0070665_1000529672 | 354 |
| 115 | 3300005617 | Ga0068859_100328809 | Ga0068859_1003288092 | 354 |
| 116 | 3300005719 | Ga0068861_100033659 | Ga0068861_1000336593 | 354 |
| 117 | 3300005719 | Ga0068861_100413759 | Ga0068861_1004137591 | 354 |
| 118 | 3300005840 | Ga0068870_10029303 | Ga0068870_100293032 | 354 |
| 119 | 3300005841 | Ga0068863_100041315 | Ga0068863_1000413153 | 354 |
| 120 | 3300005843 | Ga0068860_100012354 | Ga0068860_1000123548 | 354 |
| 121 | 3300005844 | Ga0068862_100360587 | Ga0068862_1003605872 | 354 |
| 122 | 3300006237 | Ga0097621_100006601 | Ga0097621_1000066018 | 354 |
| 123 | 3300006237 | Ga0097621_100110567 | Ga0097621_1001105672 | 354 |
| 124 | 3300006358 | Ga0068871_100215039 | Ga0068871_1002150391 | 354 |
| 125 | 3300006358 | Ga0068871_100229040 | Ga0068871_1002290402 | 354 |
| 126 | 3300006881 | Ga0068865_100130124 | Ga0068865_1001301242 | 354 |
| 127 | 3300006931 | Ga0097620_100328781 | Ga0097620_1003287812 | 354 |
| 128 | 3300009094 | Ga0111539_10446284 | Ga0111539_104462841 | 354 |
| 129 | 3300009174 | Ga0105241_10097566 | Ga0105241_100975662 | 354 |
| 130 | 3300011119 | Ga0105246_10007061 | Ga0105246_100070618 | 354 |
| 131 | 3300013297 | Ga0157378_10062832 | Ga0157378_100628323 | 354 |
| 132 | 3300013306 | Ga0163162_10190355 | Ga0163162_101903552 | 354 |
| 133 | 3300013308 | Ga0157375_10046071 | Ga0157375_100460713 | 354 |
| 134 | 3300013308 | Ga0157375_10184107 | Ga0157375_101841072 | 354 |
| 135 | 3300014326 | Ga0157380_10048129 | Ga0157380_100481293 | 354 |
| 136 | 3300014326 | Ga0157380_10261892 | Ga0157380_102618922 | 354 |
| 137 | 3300014969 | Ga0157376_10311592 | Ga0157376_103115921 | 354 |
| 138 | 3300014969 | Ga0157376_10330992 | Ga0157376_103309921 | 354 |
| 139 | 3300021384 | Ga0213876_10005477 | Ga0213876_100054772 | 354 |
| 140 | 3300025893 | Ga0207682_10013064 | Ga0207682_100130642 | 354 |
| 141 | 3300025893 | Ga0207682_10069148 | Ga0207682_100691482 | 354 |
| 142 | 3300025901 | Ga0207688_10014165 | Ga0207688_100141653 | 354 |
| 143 | 3300025903 | Ga0207680_10193039 | Ga0207680_101930391 | 354 |
| 144 | 3300025907 | Ga0207645_10000193 | Ga0207645_1000019312 | 354 |
| 145 | 3300025908 | Ga0207643_10002695 | Ga0207643_100026959 | 354 |
| 146 | 3300025908 | Ga0207643_10022145 | Ga0207643_100221451 | 354 |
| 147 | 3300025908 | Ga0207643_10022803 | Ga0207643_100228032 | 354 |
| 148 | 3300025918 | Ga0207662_10049696 | Ga0207662_100496963 | 354 |
| 149 | 3300025920 | Ga0207649_10068462 | Ga0207649_100684622 | 354 |
| 150 | 3300025920 | Ga0207649_10112130 | Ga0207649_101121302 | 354 |
| 151 | 3300025925 | Ga0207650_10106496 | Ga0207650_101064962 | 354 |
| 152 | 3300025926 | Ga0207659_10006163 | Ga0207659_100061634 | 354 |
| 153 | 3300025926 | Ga0207659_10031482 | Ga0207659_100314822 | 354 |
| 154 | 3300025928 | Ga0207700_10078365 | Ga0207700_100783652 | 354 |
| 155 | 3300025936 | Ga0207670_10034377 | Ga0207670_100343772 | 354 |
| 156 | 3300025938 | Ga0207704_10072127 | Ga0207704_100721272 | 354 |
| 157 | 3300025938 | Ga0207704_10124733 | Ga0207704_101247332 | 354 |
| 158 | 3300025940 | Ga0207691_10020637 | Ga0207691_100206376 | 354 |
| 159 | 3300025940 | Ga0207691_10063680 | Ga0207691_100636802 | 354 |
| 160 | 3300025940 | Ga0207691_10065070 | Ga0207691_100650702 | 354 |
| 161 | 3300025940 | Ga0207691_10066517 | Ga0207691_100665171 | 354 |
| 162 | 3300025942 | Ga0207689_10006249 | Ga0207689_100062495 | 354 |
| 163 | 3300025942 | Ga0207689_10046666 | Ga0207689_100466661 | 354 |
| 164 | 3300025942 | Ga0207689_10114379 | Ga0207689_101143791 | 354 |
| 165 | 3300025960 | Ga0207651_10037260 | Ga0207651_100372603 | 354 |
| 166 | 3300026023 | Ga0207677_10193738 | Ga0207677_101937381 | 354 |
| 167 | 3300026075 | Ga0207708_10030440 | Ga0207708_100304403 | 354 |
| 168 | 3300026075 | Ga0207708_10050880 | Ga0207708_100508801 | 354 |
| 169 | 3300026088 | Ga0207641_10107164 | Ga0207641_101071643 | 354 |
| 170 | 3300026089 | Ga0207648_10004327 | Ga0207648_100043278 | 354 |
| 171 | 3300026089 | Ga0207648_10066730 | Ga0207648_100667303 | 354 |
| 172 | 3300026089 | Ga0207648_10198308 | Ga0207648_101983081 | 354 |
| 173 | 3300026118 | Ga0207675_100013361 | Ga0207675_1000133615 | 354 |
| 174 | 3300026121 | Ga0207683_10001985 | Ga0207683_100019853 | 354 |
| 175 | 3300026121 | Ga0207683_10005259 | Ga0207683_1000525912 | 354 |
| 176 | 3300028379 | Ga0268266_10081142 | Ga0268266_100811421 | 354 |
| 177 | 3300031456 | Ga0307513_10017090 | Ga0307513_100170905 | 354 |
| 178 | 3300031456 | Ga0307513_10021862 | Ga0307513_100218627 | 354 |
| 179 | 3300031507 | Ga0307509_10097570 | Ga0307509_100975702 | 354 |
| 180 | 3300031548 | Ga0307408_100065279 | Ga0307408_1000652793 | 354 |
| 181 | 3300031731 | Ga0307405_10151283 | Ga0307405_101512831 | 354 |
| 182 | 3300031824 | Ga0307413_10001643 | Ga0307413_100016435 | 354 |
| 183 | 3300031852 | Ga0307410_10128870 | Ga0307410_101288702 | 354 |
| 184 | 3300031903 | Ga0307407_10004105 | Ga0307407_100041052 | 354 |
| 185 | 3300031995 | Ga0307409_100008129 | Ga0307409_1000081294 | 354 |
| 186 | 3300032002 | Ga0307416_100129054 | Ga0307416_1001290541 | 354 |
| 187 | 3300032002 | Ga0307416_100328727 | Ga0307416_1003287272 | 354 |
| 188 | 3300032005 | Ga0307411_10173876 | Ga0307411_101738762 | 354 |
| 189 | 3300047320 | Ga0495672_0128448 | Ga0495672_0128448_67_1161 | 354 |
| 190 | 3300048927 | Ga0496124_0162877 | Ga0496124_0162877_340_1425 | 354 |
| 191 | 3300005339 | Ga0070660_100136450 | Ga0070660_1001364502 | 355 |
| 192 | 3300005355 | Ga0070671_100164849 | Ga0070671_1001648492 | 355 |
| 193 | 3300005441 | Ga0070700_100048188 | Ga0070700_1000481883 | 355 |
| 194 | 3300005458 | Ga0070681_10043616 | Ga0070681_100436162 | 355 |
| 195 | 3300005459 | Ga0068867_100009217 | Ga0068867_1000092176 | 355 |
| 196 | 3300005546 | Ga0070696_100172879 | Ga0070696_1001728791 | 355 |
| 197 | 3300005549 | Ga0070704_100258070 | Ga0070704_1002580701 | 355 |
| 198 | 3300005563 | Ga0068855_100002311 | Ga0068855_10000231113 | 355 |
| 199 | 3300005615 | Ga0070702_100013127 | Ga0070702_1000131274 | 355 |
| 200 | 3300005617 | Ga0068859_100058356 | Ga0068859_1000583561 | 355 |
| 201 | 3300005618 | Ga0068864_100053363 | Ga0068864_1000533631 | 355 |
| 202 | 3300005719 | Ga0068861_100003410 | Ga0068861_1000034102 | 355 |
| 203 | 3300005719 | Ga0068861_100046232 | Ga0068861_1000462323 | 355 |
| 204 | 3300005841 | Ga0068863_100124869 | Ga0068863_1001248691 | 355 |
| 205 | 3300005841 | Ga0068863_100301641 | Ga0068863_1003016411 | 355 |
| 206 | 3300005843 | Ga0068860_100205263 | Ga0068860_1002052632 | 355 |
| 207 | 3300006881 | Ga0068865_100045075 | Ga0068865_1000450752 | 355 |
| 208 | 3300006931 | Ga0097620_100058359 | Ga0097620_1000583591 | 355 |
| 209 | 3300009094 | Ga0111539_10057540 | Ga0111539_100575405 | 355 |
| 210 | 3300010375 | Ga0105239_10005300 | Ga0105239_100053009 | 355 |
| 211 | 3300013100 | Ga0157373_10038045 | Ga0157373_100380452 | 355 |
| 212 | 3300013308 | Ga0157375_10106141 | Ga0157375_101061413 | 355 |
| 213 | 3300014326 | Ga0157380_10011948 | Ga0157380_100119483 | 355 |
| 214 | 3300014326 | Ga0157380_10172883 | Ga0157380_101728832 | 355 |
| 215 | 3300025904 | Ga0207647_10020994 | Ga0207647_100209942 | 355 |
| 216 | 3300025914 | Ga0207671_10025430 | Ga0207671_100254303 | 355 |
| 217 | 3300025919 | Ga0207657_10092518 | Ga0207657_100925182 | 355 |
| 218 | 3300025921 | Ga0207652_10000093 | Ga0207652_1000009326 | 355 |
| 219 | 3300025923 | Ga0207681_10122224 | Ga0207681_101222242 | 355 |
| 220 | 3300025926 | Ga0207659_10300091 | Ga0207659_103000911 | 355 |
| 221 | 3300025938 | Ga0207704_10062827 | Ga0207704_100628272 | 355 |
| 222 | 3300025940 | Ga0207691_10107322 | Ga0207691_101073221 | 355 |
| 223 | 3300025944 | Ga0207661_10050302 | Ga0207661_100503023 | 355 |
| 224 | 3300025949 | Ga0207667_10003174 | Ga0207667_100031747 | 355 |
| 225 | 3300026041 | Ga0207639_10185266 | Ga0207639_101852662 | 355 |
| 226 | 3300026067 | Ga0207678_10016529 | Ga0207678_100165294 | 355 |
| 227 | 3300026075 | Ga0207708_10014031 | Ga0207708_100140315 | 355 |
| 228 | 3300026088 | Ga0207641_10409354 | Ga0207641_104093542 | 355 |
| 229 | 3300026089 | Ga0207648_10007665 | Ga0207648_100076659 | 355 |
| 230 | 3300026116 | Ga0207674_10094746 | Ga0207674_100947463 | 355 |
| 231 | 3300026118 | Ga0207675_100034715 | Ga0207675_1000347153 | 355 |
| 232 | 3300026118 | Ga0207675_100105919 | Ga0207675_1001059192 | 355 |
| 233 | 3300027907 | Ga0207428_10212738 | Ga0207428_102127381 | 355 |
| 234 | 3300028380 | Ga0268265_10049918 | Ga0268265_100499183 | 355 |
| 235 | 3300028794 | Ga0307515_10031913 | Ga0307515_100319136 | 355 |
| 236 | 3300031616 | Ga0307508_10000425 | Ga0307508_1000042517 | 355 |
| 237 | 3300031903 | Ga0307407_10053432 | Ga0307407_100534323 | 355 |
| 238 | 3300031995 | Ga0307409_100008128 | Ga0307409_1000081283 | 355 |
| 239 | 3300037418 | Ga0395900_0055523 | Ga0395900_0055523_2538_3647 | 355 |
| 240 | 3300037471 | Ga0395905_0080252 | Ga0395905_0080252_318_1427 | 355 |
| 241 | 3300044656 | Ga0466969_0000399 | Ga0466969_0000399_22713_23828 | 355 |
| 242 | 3300044658 | Ga0466972_0051935 | Ga0466972_0051935_693_1829 | 355 |
| 243 | 3300044735 | Ga0466968_0039794 | Ga0466968_0039794_769_1884 | 355 |
| 244 | 3300045049 | Ga0466959_0000011 | Ga0466959_0000011_169503_170618 | 355 |
| 245 | 3300049583 | Ga0501067_0006365 | Ga0501067_0006365_4987_6087 | 355 |
| 246 | 3300049584 | Ga0501068_0000585 | Ga0501068_0000585_9434_10534 | 355 |
| 247 | 3300049586 | Ga0501070_0016579 | Ga0501070_0016579_4888_5988 | 355 |
| 248 | 3300049587 | Ga0501071_0008837 | Ga0501071_0008837_224_1324 | 355 |
| 249 | 3300049589 | Ga0501073_0011782 | Ga0501073_0011782_4708_5808 | 355 |
| 250 | 3300049590 | Ga0501074_0009290 | Ga0501074_0009290_5579_6679 | 355 |
| 251 | 3300049592 | Ga0501076_0052809 | Ga0501076_0052809_1787_2887 | 355 |
| 252 | 3300049593 | Ga0501077_0000980 | Ga0501077_0000980_15862_16962 | 355 |
| 253 | 3300049741 | Ga0501079_0000653 | Ga0501079_0000653_10288_11388 | 355 |
| 254 | 3300049742 | Ga0501080_0001948 | Ga0501080_0001948_12627_13727 | 355 |
| 255 | 3300049744 | Ga0501083_0093390 | Ga0501083_0093390_400_1500 | 355 |
| 256 | 3300050511 | nmdc:mga08y16_205082_c1 | nmdc:mga08y16_205082_c1_336_1436 | 355 |
| 257 | 3300054114 | Ga0501084_0044840 | Ga0501084_0044840_867_1967 | 355 |
| 258 | 3300060353 | Ga0501082_0020527 | Ga0501082_0020527_906_2006 | 355 |
| 259 | iso_pu_bacteria | 2911138879 | 2911142533 | 355 |
| 260 | 3300003320 | rootH2_10217225 | rootH2_102172254 | 356 |
| 261 | 3300003323 | rootH1_10011937 | rootH1_100119379 | 356 |
| 262 | 3300005329 | Ga0070683_100340248 | Ga0070683_1003402481 | 356 |
| 263 | 3300005334 | Ga0068869_100021471 | Ga0068869_1000214718 | 356 |
| 264 | 3300005347 | Ga0070668_100052230 | Ga0070668_1000522305 | 356 |
| 265 | 3300005564 | Ga0070664_100013959 | Ga0070664_1000139596 | 356 |
| 266 | 3300005718 | Ga0068866_10053909 | Ga0068866_100539093 | 356 |
| 267 | 3300005719 | Ga0068861_100003537 | Ga0068861_1000035377 | 356 |
| 268 | 3300006358 | Ga0068871_100177883 | Ga0068871_1001778831 | 356 |
| 269 | 3300009147 | Ga0114129_10002392 | Ga0114129_1000239213 | 356 |
| 270 | 3300013100 | Ga0157373_10019920 | Ga0157373_100199203 | 356 |
| 271 | 3300013104 | Ga0157370_10015874 | Ga0157370_100158749 | 356 |
| 272 | 3300013296 | Ga0157374_10457765 | Ga0157374_104577651 | 356 |
| 273 | 3300013306 | Ga0163162_10006493 | Ga0163162_100064931 | 356 |
| 274 | 3300013307 | Ga0157372_10105613 | Ga0157372_101056134 | 356 |
| 275 | 3300025942 | Ga0207689_10001574 | Ga0207689_1000157412 | 356 |
| 276 | 3300027876 | Ga0209974_10024879 | Ga0209974_100248792 | 356 |
| 277 | 3300028381 | Ga0268264_10274058 | Ga0268264_102740582 | 356 |
| 278 | 3300031901 | Ga0307406_10110878 | Ga0307406_101108783 | 356 |
| 279 | 3300031911 | Ga0307412_10031068 | Ga0307412_100310683 | 356 |
| 280 | 3300032002 | Ga0307416_100002761 | Ga0307416_1000027611 | 356 |
| 281 | 3300035117 | Ga0373953_0074295 | Ga0373953_0074295_31_1134 | 356 |
| 282 | 3300037312 | Ga0395899_0000001 | Ga0395899_0000001_1614736_1615851 | 356 |
| 283 | 3300041451 | Ga0451791_1150138 | Ga0451791_1150138_295_1392 | 356 |
| 284 | 3300046536 | Ga0495587_0073474 | Ga0495587_0073474_163_1266 | 356 |
| 285 | 3300047471 | Ga0495684_0070533 | Ga0495684_0070533_159_1262 | 356 |
| 286 | 3300049686 | Ga0501257_025025 | Ga0501257_025025_170_1288 | 356 |
| 287 | 3300050507 | nmdc:mga05p37_2387_c1 | nmdc:mga05p37_2387_c1_7592_8707 | 356 |
| 288 | 3300053090 | Ga0500646_0043331 | Ga0500646_0043331_96_1214 | 356 |
| 289 | 3300053146 | Ga0500588_0057524 | Ga0500588_0057524_25_1131 | 356 |
| 290 | iso_pu_bacteria | 2522125168 | 2522550415 | 356 |
| 291 | 3300005330 | Ga0070690_100009302 | Ga0070690_1000093023 | 357 |
| 292 | 3300005518 | Ga0070699_100107997 | Ga0070699_1001079973 | 357 |
| 293 | 3300005563 | Ga0068855_100076505 | Ga0068855_1000765052 | 357 |
| 294 | 3300005618 | Ga0068864_100017294 | Ga0068864_1000172942 | 357 |
| 295 | 3300006844 | Ga0075428_100186233 | Ga0075428_1001862332 | 357 |
| 296 | 3300006880 | Ga0075429_100000606 | Ga0075429_10000060611 | 357 |
| 297 | 3300009553 | Ga0105249_10168166 | Ga0105249_101681662 | 357 |
| 298 | 3300013308 | Ga0157375_10235105 | Ga0157375_102351052 | 357 |
| 299 | 3300017792 | Ga0163161_10004389 | Ga0163161_100043896 | 357 |
| 300 | 3300026095 | Ga0207676_10012851 | Ga0207676_100128514 | 357 |
| 301 | 3300035084 | Ga0373928_0000580 | Ga0373928_0000580_5890_6987 | 357 |
| 302 | 3300037471 | Ga0395905_0097874 | Ga0395905_0097874_1659_2744 | 357 |
| 303 | 3300044712 | Ga0453684_0147300 | Ga0453684_0147300_1368_2489 | 357 |
| 304 | 3300049705 | Ga0501225_0003149 | Ga0501225_0003149_1617_2780 | 357 |
| 305 | 3300050508 | nmdc:mga09592_236206_c1 | nmdc:mga09592_236206_c1_88_1242 | 357 |
| 306 | 3300003322 | rootL2_10005471 | rootL2_100054712 | 358 |
| 307 | 3300004799 | Ga0058863_11707405 | Ga0058863_117074051 | 358 |
| 308 | 3300035170 | Ga0373943_0100061 | Ga0373943_0100061_372_1448 | 358 |
| 309 | 3300041458 | Ga0451798_0094830 | Ga0451798_0094830_435_1616 | 358 |
| 310 | 3300042007 | Ga0439449_0023577 | Ga0439449_0023577_475_1614 | 358 |
| 311 | 3300044658 | Ga0466972_0000038 | Ga0466972_0000038_8034_9110 | 358 |
| 312 | 3300049588 | Ga0501072_0144945 | Ga0501072_0144945_533_1717 | 358 |
| 313 | 3300003322 | rootL2_10235208 | rootL2_102352083 | 359 |
| 314 | 3300003794 | Ga0055531_10000435 | Ga0055531_1000043515 | 359 |
| 315 | 3300005337 | Ga0070682_100158626 | Ga0070682_1001586261 | 359 |
| 316 | 3300005340 | Ga0070689_100000797 | Ga0070689_1000007973 | 359 |
| 317 | 3300005365 | Ga0070688_100077384 | Ga0070688_1000773842 | 359 |
| 318 | 3300005563 | Ga0068855_100226959 | Ga0068855_1002269592 | 359 |
| 319 | 3300005841 | Ga0068863_100017951 | Ga0068863_1000179513 | 359 |
| 320 | 3300014326 | Ga0157380_10178839 | Ga0157380_101788392 | 359 |
| 321 | 3300025304 | Ga0209257_1000005 | Ga0209257_1000005903 | 359 |
| 322 | 3300025936 | Ga0207670_10002207 | Ga0207670_100022076 | 359 |
| 323 | 3300025949 | Ga0207667_10211102 | Ga0207667_102111022 | 359 |
| 324 | 3300028379 | Ga0268266_10133298 | Ga0268266_101332981 | 359 |
| 325 | 3300031240 | Ga0265320_10001749 | Ga0265320_100017492 | 359 |
| 326 | 3300031507 | Ga0307509_10060648 | Ga0307509_100606484 | 359 |
| 327 | 3300031616 | Ga0307508_10000052 | Ga0307508_1000005249 | 359 |
| 328 | 3300031901 | Ga0307406_10064141 | Ga0307406_100641413 | 359 |
| 329 | 3300035695 | Ga0373927_0019622 | Ga0373927_0019622_1471_2559 | 359 |
| 330 | 3300049580 | Ga0501046_0002099 | Ga0501046_0002099_12556_13647 | 359 |
| 331 | 3300049581 | Ga0501047_0005561 | Ga0501047_0005561_5102_6193 | 359 |
| 332 | 3300049761 | Ga0501264_000050 | Ga0501264_000050_6806_7894 | 359 |
| 333 | 3300049822 | Ga0501035_0000115 | Ga0501035_0000115_48534_49625 | 359 |
| 334 | 3300049823 | Ga0501044_0000027 | Ga0501044_0000027_16990_18081 | 359 |
| 335 | 3300003316 | rootH1_10033439 | rootH1_1003343929 | 360 |
| 336 | 3300003320 | rootH2_10010010 | rootH2_100100102 | 360 |
| 337 | 3300003322 | rootL2_10058065 | rootL2_100580657 | 360 |
| 338 | 3300003322 | rootL2_10068274 | rootL2_1006827418 | 360 |
| 339 | 3300003323 | rootH1_10008265 | rootH1_100082652 | 360 |
| 340 | 3300003323 | rootH1_10023828 | rootH1_100238287 | 360 |
| 341 | 3300003323 | rootH1_10096985 | rootH1_100969851 | 360 |
| 342 | 3300003323 | rootH1_10119811 | rootH1_101198115 | 360 |
| 343 | 3300005262 | Ga0065165_1000043 | Ga0065165_100004344 | 360 |
| 344 | 3300005334 | Ga0068869_100017422 | Ga0068869_1000174223 | 360 |
| 345 | 3300005334 | Ga0068869_100239344 | Ga0068869_1002393441 | 360 |
| 346 | 3300005338 | Ga0068868_100165677 | Ga0068868_1001656772 | 360 |
| 347 | 3300005347 | Ga0070668_100193559 | Ga0070668_1001935591 | 360 |
| 348 | 3300005353 | Ga0070669_100028232 | Ga0070669_1000282322 | 360 |
| 349 | 3300005356 | Ga0070674_100099853 | Ga0070674_1000998533 | 360 |
| 350 | 3300005364 | Ga0070673_100012837 | Ga0070673_1000128374 | 360 |
| 351 | 3300005364 | Ga0070673_100375445 | Ga0070673_1003754451 | 360 |
| 352 | 3300005367 | Ga0070667_100145082 | Ga0070667_1001450821 | 360 |
| 353 | 3300005459 | Ga0068867_100026116 | Ga0068867_1000261162 | 360 |
| 354 | 3300005718 | Ga0068866_10049789 | Ga0068866_100497891 | 360 |
| 355 | 3300005719 | Ga0068861_100057903 | Ga0068861_1000579031 | 360 |
| 356 | 3300005719 | Ga0068861_100086968 | Ga0068861_1000869682 | 360 |
| 357 | 3300006237 | Ga0097621_100008063 | Ga0097621_1000080637 | 360 |
| 358 | 3300006358 | Ga0068871_100019167 | Ga0068871_1000191674 | 360 |
| 359 | 3300006844 | Ga0075428_100045822 | Ga0075428_1000458222 | 360 |
| 360 | 3300006881 | Ga0068865_100130575 | Ga0068865_1001305752 | 360 |
| 361 | 3300009094 | Ga0111539_10005241 | Ga0111539_100052418 | 360 |
| 362 | 3300009094 | Ga0111539_10012104 | Ga0111539_100121045 | 360 |
| 363 | 3300009148 | Ga0105243_10125853 | Ga0105243_101258532 | 360 |
| 364 | 3300009174 | Ga0105241_10175695 | Ga0105241_101756952 | 360 |
| 365 | 3300009176 | Ga0105242_10271125 | Ga0105242_102711252 | 360 |
| 366 | 3300009553 | Ga0105249_10101072 | Ga0105249_101010722 | 360 |
| 367 | 3300013296 | Ga0157374_10228827 | Ga0157374_102288272 | 360 |
| 368 | 3300013297 | Ga0157378_10195028 | Ga0157378_101950282 | 360 |
| 369 | 3300013308 | Ga0157375_10000207 | Ga0157375_100002073 | 360 |
| 370 | 3300013308 | Ga0157375_10127200 | Ga0157375_101272002 | 360 |
| 371 | 3300014745 | Ga0157377_10025096 | Ga0157377_100250964 | 360 |
| 372 | 3300017792 | Ga0163161_10004778 | Ga0163161_100047781 | 360 |
| 373 | 3300025292 | Ga0209676_1000584 | Ga0209676_100058426 | 360 |
| 374 | 3300025899 | Ga0207642_10078093 | Ga0207642_100780931 | 360 |
| 375 | 3300025907 | Ga0207645_10000279 | Ga0207645_1000027940 | 360 |
| 376 | 3300025907 | Ga0207645_10007389 | Ga0207645_100073897 | 360 |
| 377 | 3300025908 | Ga0207643_10008261 | Ga0207643_100082612 | 360 |
| 378 | 3300025923 | Ga0207681_10018827 | Ga0207681_100188275 | 360 |
| 379 | 3300025933 | Ga0207706_10037886 | Ga0207706_100378865 | 360 |
| 380 | 3300025938 | Ga0207704_10159396 | Ga0207704_101593962 | 360 |
| 381 | 3300025940 | Ga0207691_10034558 | Ga0207691_100345582 | 360 |
| 382 | 3300025942 | Ga0207689_10005101 | Ga0207689_100051011 | 360 |
| 383 | 3300025942 | Ga0207689_10027543 | Ga0207689_100275433 | 360 |
| 384 | 3300025942 | Ga0207689_10051265 | Ga0207689_100512653 | 360 |
| 385 | 3300025961 | Ga0207712_10064471 | Ga0207712_100644712 | 360 |
| 386 | 3300025972 | Ga0207668_10032790 | Ga0207668_100327902 | 360 |
| 387 | 3300026078 | Ga0207702_10011501 | Ga0207702_100115012 | 360 |
| 388 | 3300026089 | Ga0207648_10099073 | Ga0207648_100990732 | 360 |
| 389 | 3300026089 | Ga0207648_10203134 | Ga0207648_102031343 | 360 |
| 390 | 3300026116 | Ga0207674_10069011 | Ga0207674_100690113 | 360 |
| 391 | 3300026118 | Ga0207675_100003242 | Ga0207675_1000032423 | 360 |
| 392 | 3300026118 | Ga0207675_100038225 | Ga0207675_1000382254 | 360 |
| 393 | 3300026121 | Ga0207683_10002587 | Ga0207683_1000258715 | 360 |
| 394 | 3300028381 | Ga0268264_10005438 | Ga0268264_100054389 | 360 |
| 395 | 3300031911 | Ga0307412_10231195 | Ga0307412_102311951 | 360 |
| 396 | 3300032004 | Ga0307414_10009337 | Ga0307414_100093373 | 360 |
| 397 | 3300042002 | Ga0439442_007186 | Ga0439442_007186_150_1238 | 360 |
| 398 | 3300042134 | Ga0450898_014017 | Ga0450898_014017_145_1239 | 360 |
| 399 | 3300042135 | Ga0450899_003069 | Ga0450899_003069_444_1538 | 360 |
| 400 | 3300044712 | Ga0453684_0076844 | Ga0453684_0076844_370_1461 | 360 |
| 401 | 3300050511 | nmdc:mga08y16_48682_c1 | nmdc:mga08y16_48682_c1_1454_2545 | 360 |
| 402 | 3300050511 | nmdc:mga08y16_8382_c1 | nmdc:mga08y16_8382_c1_4234_5325 | 360 |
| 403 | 3300053092 | Ga0500583_0036919 | Ga0500583_0036919_663_1760 | 360 |
| 404 | 3300053153 | Ga0500616_0000007 | Ga0500616_0000007_803815_804903 | 360 |
| 405 | 3300053156 | Ga0500622_0006324 | Ga0500622_0006324_3037_4125 | 360 |
| 406 | 3300006051 | Ga0075364_10000088 | Ga0075364_100000884 | 361 |
| 407 | 3300013307 | Ga0157372_10035569 | Ga0157372_100355693 | 361 |
| 408 | 3300032004 | Ga0307414_10168513 | Ga0307414_101685131 | 361 |
| 409 | 3300050491 | nmdc:mga00v17_582_c2 | nmdc:mga00v17_582_c2_6352_7467 | 361 |
| 410 | iso_pu_bacteria | 2919692658 | 2919692801 | 361 |
| 411 | 3300003322 | rootL2_10155085 | rootL2_101550852 | 362 |
| 412 | 3300005329 | Ga0070683_100074968 | Ga0070683_1000749681 | 362 |
| 413 | 3300005335 | Ga0070666_10045688 | Ga0070666_100456882 | 362 |
| 414 | 3300005336 | Ga0070680_100072172 | Ga0070680_1000721723 | 362 |
| 415 | 3300005338 | Ga0068868_100014395 | Ga0068868_1000143953 | 362 |
| 416 | 3300005338 | Ga0068868_100080951 | Ga0068868_1000809512 | 362 |
| 417 | 3300005339 | Ga0070660_100128464 | Ga0070660_1001284641 | 362 |
| 418 | 3300005344 | Ga0070661_100010000 | Ga0070661_1000100003 | 362 |
| 419 | 3300005354 | Ga0070675_100006161 | Ga0070675_1000061618 | 362 |
| 420 | 3300005366 | Ga0070659_100010682 | Ga0070659_1000106823 | 362 |
| 421 | 3300005456 | Ga0070678_100204861 | Ga0070678_1002048612 | 362 |
| 422 | 3300005457 | Ga0070662_100066547 | Ga0070662_1000665472 | 362 |
| 423 | 3300005530 | Ga0070679_100032976 | Ga0070679_1000329763 | 362 |
| 424 | 3300005535 | Ga0070684_100043586 | Ga0070684_1000435863 | 362 |
| 425 | 3300005539 | Ga0068853_100070352 | Ga0068853_1000703522 | 362 |
| 426 | 3300005548 | Ga0070665_100362309 | Ga0070665_1003623092 | 362 |
| 427 | 3300005563 | Ga0068855_100013738 | Ga0068855_1000137388 | 362 |
| 428 | 3300005564 | Ga0070664_100011247 | Ga0070664_1000112474 | 362 |
| 429 | 3300005616 | Ga0068852_100433798 | Ga0068852_1004337981 | 362 |
| 430 | 3300005834 | Ga0068851_10005291 | Ga0068851_100052911 | 362 |
| 431 | 3300005985 | Ga0081539_10000816 | Ga0081539_100008167 | 362 |
| 432 | 3300006237 | Ga0097621_100029627 | Ga0097621_1000296273 | 362 |
| 433 | 3300010375 | Ga0105239_10478336 | Ga0105239_104783361 | 362 |
| 434 | 3300013100 | Ga0157373_10003137 | Ga0157373_100031372 | 362 |
| 435 | 3300013102 | Ga0157371_10182197 | Ga0157371_101821971 | 362 |
| 436 | 3300013105 | Ga0157369_10029201 | Ga0157369_100292012 | 362 |
| 437 | 3300013296 | Ga0157374_10009357 | Ga0157374_100093576 | 362 |
| 438 | 3300013297 | Ga0157378_10014684 | Ga0157378_100146843 | 362 |
| 439 | 3300013306 | Ga0163162_10032916 | Ga0163162_100329163 | 362 |
| 440 | 3300014326 | Ga0157380_10000443 | Ga0157380_100004431 | 362 |
| 441 | 3300014745 | Ga0157377_10072696 | Ga0157377_100726961 | 362 |
| 442 | 3300025919 | Ga0207657_10005188 | Ga0207657_100051883 | 362 |
| 443 | 3300025933 | Ga0207706_10082970 | Ga0207706_100829703 | 362 |
| 444 | 3300025945 | Ga0207679_10006182 | Ga0207679_100061825 | 362 |
| 445 | 3300025949 | Ga0207667_10134411 | Ga0207667_101344112 | 362 |
| 446 | 3300026078 | Ga0207702_10146011 | Ga0207702_101460112 | 362 |
| 447 | iso_pu_bacteria | 2738541278 | 2738726859 | 362 |
| 448 | iso_pu_bacteria | 2910245624 | 2910250516 | 362 |
| 449 | iso_pu_bacteria | 2929921140 | 2929926459 | 362 |
| 450 | iso_pu_bacteria | 8003151029 | 8003156813 | 362 |
| 451 | 3300005347 | Ga0070668_100063629 | Ga0070668_1000636292 | 363 |
| 452 | 3300005841 | Ga0068863_100128733 | Ga0068863_1001287332 | 363 |
| 453 | 3300005843 | Ga0068860_100024871 | Ga0068860_1000248713 | 363 |
| 454 | 3300005844 | Ga0068862_100013075 | Ga0068862_1000130754 | 363 |
| 455 | 3300026095 | Ga0207676_10265381 | Ga0207676_102653812 | 363 |
| 456 | 3300028380 | Ga0268265_10169008 | Ga0268265_101690081 | 363 |
| 457 | 3300028381 | Ga0268264_10040678 | Ga0268264_100406783 | 363 |
| 458 | 3300049851 | Ga0501212_011777 | Ga0501212_011777_121_1227 | 363 |
| 459 | 3300005334 | Ga0068869_100042642 | Ga0068869_1000426424 | 364 |
| 460 | 3300005335 | Ga0070666_10000138 | Ga0070666_1000013830 | 364 |
| 461 | 3300005338 | Ga0068868_100182786 | Ga0068868_1001827862 | 364 |
| 462 | 3300005356 | Ga0070674_100009539 | Ga0070674_1000095394 | 364 |
| 463 | 3300005456 | Ga0070678_100224535 | Ga0070678_1002245352 | 364 |
| 464 | 3300005539 | Ga0068853_100232818 | Ga0068853_1002328181 | 364 |
| 465 | 3300005543 | Ga0070672_100061580 | Ga0070672_1000615802 | 364 |
| 466 | 3300005718 | Ga0068866_10054269 | Ga0068866_100542692 | 364 |
| 467 | 3300006237 | Ga0097621_100115064 | Ga0097621_1001150642 | 364 |
| 468 | 3300009101 | Ga0105247_10004124 | Ga0105247_100041247 | 364 |
| 469 | 3300009174 | Ga0105241_10000403 | Ga0105241_1000040325 | 364 |
| 470 | 3300009545 | Ga0105237_10002164 | Ga0105237_1000216425 | 364 |
| 471 | 3300011119 | Ga0105246_10033670 | Ga0105246_100336703 | 364 |
| 472 | 3300013306 | Ga0163162_10003500 | Ga0163162_100035008 | 364 |
| 473 | 3300013308 | Ga0157375_10142343 | Ga0157375_101423432 | 364 |
| 474 | 3300014325 | Ga0163163_10075457 | Ga0163163_100754571 | 364 |
| 475 | 3300014968 | Ga0157379_10024379 | Ga0157379_100243796 | 364 |
| 476 | 3300014969 | Ga0157376_10164905 | Ga0157376_101649051 | 364 |
| 477 | 3300025907 | Ga0207645_10001124 | Ga0207645_100011245 | 364 |
| 478 | 3300025914 | Ga0207671_10003963 | Ga0207671_1000396313 | 364 |
| 479 | 3300025934 | Ga0207686_10175111 | Ga0207686_101751111 | 364 |
| 480 | 3300025936 | Ga0207670_10280269 | Ga0207670_102802692 | 364 |
| 481 | 3300025942 | Ga0207689_10041176 | Ga0207689_100411764 | 364 |
| 482 | 3300025961 | Ga0207712_10007096 | Ga0207712_100070961 | 364 |
| 483 | 3300026118 | Ga0207675_100096291 | Ga0207675_1000962912 | 364 |
| 484 | 3300026121 | Ga0207683_10028416 | Ga0207683_100284163 | 364 |
| 485 | 3300026142 | Ga0207698_10075351 | Ga0207698_100753512 | 364 |
| 486 | 3300032004 | Ga0307414_10028590 | Ga0307414_100285904 | 364 |
| 487 | 3300048907 | Ga0496104_0171454 | Ga0496104_0171454_392_1564 | 364 |
| 488 | 3300049521 | Ga0501298_016836 | Ga0501298_016836_81_1190 | 364 |
| 489 | 3300049571 | Ga0501034_0019490 | Ga0501034_0019490_2951_4048 | 364 |
| 490 | 3300049573 | Ga0501037_0002859 | Ga0501037_0002859_4283_5380 | 364 |
| 491 | 3300049574 | Ga0501038_0015182 | Ga0501038_0015182_4648_5745 | 364 |
| 492 | 3300049579 | Ga0501043_0009431 | Ga0501043_0009431_1092_2189 | 364 |
| 493 | 3300049579 | Ga0501043_0010043 | Ga0501043_0010043_1214_2311 | 364 |
| 494 | 3300049581 | Ga0501047_0141165 | Ga0501047_0141165_769_1866 | 364 |
| 495 | 3300049663 | Ga0501223_016989 | Ga0501223_016989_285_1394 | 364 |
| 496 | 3300049664 | Ga0501224_004619 | Ga0501224_004619_377_1486 | 364 |
| 497 | 3300049705 | Ga0501225_0005591 | Ga0501225_0005591_480_1589 | 364 |
| 498 | 3300049822 | Ga0501035_0068866 | Ga0501035_0068866_800_1897 | 364 |
| 499 | 3300049823 | Ga0501044_0007409 | Ga0501044_0007409_6152_7249 | 364 |
| 500 | 3300050511 | nmdc:mga08y16_198554_c1 | nmdc:mga08y16_198554_c1_720_1853 | 364 |
| 501 | iso_pu_bacteria | 2911138879 | 2911142416 | 364 |
| 502 | 3300005338 | Ga0068868_100002592 | Ga0068868_10000259210 | 365 |
| 503 | 3300005366 | Ga0070659_100049299 | Ga0070659_1000492994 | 365 |
| 504 | 3300005367 | Ga0070667_100001467 | Ga0070667_10000146715 | 365 |
| 505 | 3300005616 | Ga0068852_100062071 | Ga0068852_1000620713 | 365 |
| 506 | 3300005617 | Ga0068859_100019258 | Ga0068859_1000192583 | 365 |
| 507 | 3300005618 | Ga0068864_100074765 | Ga0068864_1000747653 | 365 |
| 508 | 3300005841 | Ga0068863_100010890 | Ga0068863_1000108907 | 365 |
| 509 | 3300005843 | Ga0068860_100085545 | Ga0068860_1000855452 | 365 |
| 510 | 3300005843 | Ga0068860_100154901 | Ga0068860_1001549012 | 365 |
| 511 | 3300006844 | Ga0075428_100106726 | Ga0075428_1001067263 | 365 |
| 512 | 3300006847 | Ga0075431_100018946 | Ga0075431_1000189463 | 365 |
| 513 | 3300006931 | Ga0097620_100019258 | Ga0097620_1000192583 | 365 |
| 514 | 3300009093 | Ga0105240_10008271 | Ga0105240_1000827110 | 365 |
| 515 | 3300009093 | Ga0105240_10016663 | Ga0105240_100166637 | 365 |
| 516 | 3300009093 | Ga0105240_10023977 | Ga0105240_100239776 | 365 |
| 517 | 3300009147 | Ga0114129_10112735 | Ga0114129_101127352 | 365 |
| 518 | 3300009148 | Ga0105243_10069969 | Ga0105243_100699693 | 365 |
| 519 | 3300009174 | Ga0105241_10001753 | Ga0105241_100017532 | 365 |
| 520 | 3300009174 | Ga0105241_10196839 | Ga0105241_101968392 | 365 |
| 521 | 3300009545 | Ga0105237_10002660 | Ga0105237_100026604 | 365 |
| 522 | 3300009545 | Ga0105237_10007945 | Ga0105237_100079456 | 365 |
| 523 | 3300009545 | Ga0105237_10036552 | Ga0105237_100365522 | 365 |
| 524 | 3300009545 | Ga0105237_10113106 | Ga0105237_101131062 | 365 |
| 525 | 3300009551 | Ga0105238_10127922 | Ga0105238_101279223 | 365 |
| 526 | 3300009551 | Ga0105238_10286858 | Ga0105238_102868582 | 365 |
| 527 | 3300010375 | Ga0105239_10015372 | Ga0105239_100153724 | 365 |
| 528 | 3300011119 | Ga0105246_10018901 | Ga0105246_100189013 | 365 |
| 529 | 3300013104 | Ga0157370_10015201 | Ga0157370_100152018 | 365 |
| 530 | 3300013105 | Ga0157369_10036494 | Ga0157369_100364945 | 365 |
| 531 | 3300013296 | Ga0157374_10229327 | Ga0157374_102293272 | 365 |
| 532 | 3300013296 | Ga0157374_10274678 | Ga0157374_102746782 | 365 |
| 533 | 3300013297 | Ga0157378_10002981 | Ga0157378_100029819 | 365 |
| 534 | 3300013297 | Ga0157378_10279760 | Ga0157378_102797602 | 365 |
| 535 | 3300013306 | Ga0163162_10101459 | Ga0163162_101014592 | 365 |
| 536 | 3300013307 | Ga0157372_10006751 | Ga0157372_100067512 | 365 |
| 537 | 3300013307 | Ga0157372_10220850 | Ga0157372_102208502 | 365 |
| 538 | 3300014969 | Ga0157376_10021073 | Ga0157376_100210733 | 365 |
| 539 | 3300025302 | Ga0207426_1000093 | Ga0207426_1000093161 | 365 |
| 540 | 3300025913 | Ga0207695_10001513 | Ga0207695_1000151321 | 365 |
| 541 | 3300025913 | Ga0207695_10044421 | Ga0207695_100444214 | 365 |
| 542 | 3300025913 | Ga0207695_10046762 | Ga0207695_100467624 | 365 |
| 543 | 3300025914 | Ga0207671_10002804 | Ga0207671_100028044 | 365 |
| 544 | 3300025914 | Ga0207671_10005605 | Ga0207671_100056056 | 365 |
| 545 | 3300025914 | Ga0207671_10008668 | Ga0207671_100086683 | 365 |
| 546 | 3300025924 | Ga0207694_10206118 | Ga0207694_102061182 | 365 |
| 547 | 3300025960 | Ga0207651_10011488 | Ga0207651_100114884 | 365 |
| 548 | 3300025981 | Ga0207640_10201131 | Ga0207640_102011311 | 365 |
| 549 | 3300025986 | Ga0207658_10008348 | Ga0207658_100083488 | 365 |
| 550 | 3300026078 | Ga0207702_10229277 | Ga0207702_102292772 | 365 |
| 551 | 3300026142 | Ga0207698_10032736 | Ga0207698_100327362 | 365 |
| 552 | 3300026142 | Ga0207698_10053125 | Ga0207698_100531253 | 365 |
| 553 | 3300028381 | Ga0268264_10037388 | Ga0268264_100373882 | 365 |
| 554 | 3300028381 | Ga0268264_10128374 | Ga0268264_101283743 | 365 |
| 555 | 3300031507 | Ga0307509_10128864 | Ga0307509_101288642 | 365 |
| 556 | 3300041512 | Ga0451853_2458528 | Ga0451853_2458528_147_1244 | 365 |
| 557 | 3300042014 | Ga0439457_014352 | Ga0439457_014352_330_1427 | 365 |
| 558 | 3300044658 | Ga0466972_0001168 | Ga0466972_0001168_1347_2444 | 365 |
| 559 | 3300047320 | Ga0495672_0013741 | Ga0495672_0013741_2860_3957 | 365 |
| 560 | 3300049571 | Ga0501034_0291970 | Ga0501034_0291970_340_1440 | 365 |
| 561 | 3300049742 | Ga0501080_0206044 | Ga0501080_0206044_166_1293 | 365 |
| 562 | 3300049763 | Ga0501266_003291 | Ga0501266_003291_461_1597 | 365 |
| 563 | 3300050510 | nmdc:mga06r32_84417_c1 | nmdc:mga06r32_84417_c1_876_1988 | 365 |
| 564 | 3300001989 | JGI24739J22299_10007776 | JGI24739J22299_100077762 | 366 |
| 565 | 3300003215 | JGI25153J46596_10000766 | JGI25153J46596_100007668 | 366 |
| 566 | 3300003215 | JGI25153J46596_10018149 | JGI25153J46596_100181492 | 366 |
| 567 | 3300003322 | rootL2_10077131 | rootL2_100771312 | 366 |
| 568 | 3300003323 | rootH1_10003268 | rootH1_100032687 | 366 |
| 569 | 3300003323 | rootH1_10102452 | rootH1_101024525 | 366 |
| 570 | 3300003323 | rootH1_10105715 | rootH1_101057152 | 366 |
| 571 | 3300003354 | JGI25160J50197_1000863 | JGI25160J50197_10008631 | 366 |
| 572 | 3300003354 | JGI25160J50197_1021239 | JGI25160J50197_10212392 | 366 |
| 573 | 3300003771 | Ga0055526_1018304 | Ga0055526_10183041 | 366 |
| 574 | 3300003790 | Ga0055528_1002478 | Ga0055528_10024781 | 366 |
| 575 | 3300003791 | Ga0055530_10009262 | Ga0055530_100092621 | 366 |
| 576 | 3300005262 | Ga0065165_1000219 | Ga0065165_100021956 | 366 |
| 577 | 3300005290 | Ga0065712_10145165 | Ga0065712_101451651 | 366 |
| 578 | 3300005327 | Ga0070658_10081100 | Ga0070658_100811001 | 366 |
| 579 | 3300005331 | Ga0070670_100156661 | Ga0070670_1001566612 | 366 |
| 580 | 3300005334 | Ga0068869_100015239 | Ga0068869_1000152392 | 366 |
| 581 | 3300005340 | Ga0070689_100057636 | Ga0070689_1000576362 | 366 |
| 582 | 3300005343 | Ga0070687_100082748 | Ga0070687_1000827482 | 366 |
| 583 | 3300005365 | Ga0070688_100036747 | Ga0070688_1000367472 | 366 |
| 584 | 3300005366 | Ga0070659_100032648 | Ga0070659_1000326483 | 366 |
| 585 | 3300005456 | Ga0070678_100341033 | Ga0070678_1003410331 | 366 |
| 586 | 3300005535 | Ga0070684_100002054 | Ga0070684_1000020543 | 366 |
| 587 | 3300005535 | Ga0070684_100290550 | Ga0070684_1002905502 | 366 |
| 588 | 3300005539 | Ga0068853_100048688 | Ga0068853_1000486882 | 366 |
| 589 | 3300005543 | Ga0070672_100211327 | Ga0070672_1002113273 | 366 |
| 590 | 3300005547 | Ga0070693_100043222 | Ga0070693_1000432222 | 366 |
| 591 | 3300005548 | Ga0070665_100000016 | Ga0070665_10000001697 | 366 |
| 592 | 3300005564 | Ga0070664_100182491 | Ga0070664_1001824911 | 366 |
| 593 | 3300005577 | Ga0068857_100103626 | Ga0068857_1001036262 | 366 |
| 594 | 3300005577 | Ga0068857_100216660 | Ga0068857_1002166601 | 366 |
| 595 | 3300005615 | Ga0070702_100002295 | Ga0070702_1000022953 | 366 |
| 596 | 3300005618 | Ga0068864_100013839 | Ga0068864_1000138391 | 366 |
| 597 | 3300005843 | Ga0068860_100000006 | Ga0068860_100000006137 | 366 |
| 598 | 3300005985 | Ga0081539_10008031 | Ga0081539_100080319 | 366 |
| 599 | 3300006195 | Ga0075366_10070479 | Ga0075366_100704792 | 366 |
| 600 | 3300006358 | Ga0068871_100028555 | Ga0068871_1000285551 | 366 |
| 601 | 3300006358 | Ga0068871_100206891 | Ga0068871_1002068912 | 366 |
| 602 | 3300006358 | Ga0068871_100259740 | Ga0068871_1002597401 | 366 |
| 603 | 3300006844 | Ga0075428_100013628 | Ga0075428_1000136285 | 366 |
| 604 | 3300006844 | Ga0075428_100199519 | Ga0075428_1001995192 | 366 |
| 605 | 3300006846 | Ga0075430_100014626 | Ga0075430_1000146263 | 366 |
| 606 | 3300006847 | Ga0075431_100014855 | Ga0075431_1000148554 | 366 |
| 607 | 3300006880 | Ga0075429_100000105 | Ga0075429_1000001054 | 366 |
| 608 | 3300006880 | Ga0075429_100181704 | Ga0075429_1001817042 | 366 |
| 609 | 3300009093 | Ga0105240_10000328 | Ga0105240_1000032819 | 366 |
| 610 | 3300009093 | Ga0105240_10039408 | Ga0105240_100394084 | 366 |
| 611 | 3300009147 | Ga0114129_10055251 | Ga0114129_100552515 | 366 |
| 612 | 3300009176 | Ga0105242_10238637 | Ga0105242_102386371 | 366 |
| 613 | 3300009177 | Ga0105248_10665160 | Ga0105248_106651601 | 366 |
| 614 | 3300009545 | Ga0105237_10015760 | Ga0105237_100157603 | 366 |
| 615 | 3300009545 | Ga0105237_10018209 | Ga0105237_100182093 | 366 |
| 616 | 3300009545 | Ga0105237_10068168 | Ga0105237_100681683 | 366 |
| 617 | 3300009553 | Ga0105249_10009844 | Ga0105249_100098442 | 366 |
| 618 | 3300009553 | Ga0105249_10013748 | Ga0105249_100137483 | 366 |
| 619 | 3300009553 | Ga0105249_10218971 | Ga0105249_102189712 | 366 |
| 620 | 3300010375 | Ga0105239_10000101 | Ga0105239_1000010187 | 366 |
| 621 | 3300010375 | Ga0105239_10020208 | Ga0105239_100202083 | 366 |
| 622 | 3300010375 | Ga0105239_10023231 | Ga0105239_100232315 | 366 |
| 623 | 3300013296 | Ga0157374_10000029 | Ga0157374_1000002973 | 366 |
| 624 | 3300013296 | Ga0157374_10002518 | Ga0157374_100025188 | 366 |
| 625 | 3300013296 | Ga0157374_10022675 | Ga0157374_100226754 | 366 |
| 626 | 3300013297 | Ga0157378_10036566 | Ga0157378_100365662 | 366 |
| 627 | 3300013297 | Ga0157378_10045202 | Ga0157378_100452022 | 366 |
| 628 | 3300013306 | Ga0163162_10000355 | Ga0163162_1000035527 | 366 |
| 629 | 3300013306 | Ga0163162_10236468 | Ga0163162_102364681 | 366 |
| 630 | 3300013307 | Ga0157372_10235796 | Ga0157372_102357962 | 366 |
| 631 | 3300013308 | Ga0157375_10066270 | Ga0157375_100662702 | 366 |
| 632 | 3300013308 | Ga0157375_10159336 | Ga0157375_101593361 | 366 |
| 633 | 3300014325 | Ga0163163_10192403 | Ga0163163_101924031 | 366 |
| 634 | 3300014326 | Ga0157380_10002654 | Ga0157380_100026546 | 366 |
| 635 | 3300014326 | Ga0157380_10450270 | Ga0157380_104502701 | 366 |
| 636 | 3300014968 | Ga0157379_10216518 | Ga0157379_102165181 | 366 |
| 637 | 3300014968 | Ga0157379_10323816 | Ga0157379_103238161 | 366 |
| 638 | 3300014968 | Ga0157379_10329740 | Ga0157379_103297401 | 366 |
| 639 | 3300014969 | Ga0157376_10002108 | Ga0157376_100021086 | 366 |
| 640 | 3300014969 | Ga0157376_10088629 | Ga0157376_100886293 | 366 |
| 641 | 3300017792 | Ga0163161_10144685 | Ga0163161_101446851 | 366 |
| 642 | 3300025246 | Ga0209646_1000003 | Ga0209646_1000003277 | 366 |
| 643 | 3300025246 | Ga0209646_1001862 | Ga0209646_10018623 | 366 |
| 644 | 3300025250 | Ga0209026_1000614 | Ga0209026_10006149 | 366 |
| 645 | 3300025273 | Ga0209673_1000962 | Ga0209673_10009621 | 366 |
| 646 | 3300025295 | Ga0209564_1003078 | Ga0209564_10030789 | 366 |
| 647 | 3300025297 | Ga0209758_1002110 | Ga0209758_100211013 | 366 |
| 648 | 3300025297 | Ga0209758_1011568 | Ga0209758_10115683 | 366 |
| 649 | 3300025298 | Ga0209050_1000561 | Ga0209050_10005612 | 366 |
| 650 | 3300025302 | Ga0207426_1000187 | Ga0207426_100018713 | 366 |
| 651 | 3300025302 | Ga0207426_1015489 | Ga0207426_10154892 | 366 |
| 652 | 3300025304 | Ga0209257_1010390 | Ga0209257_10103902 | 366 |
| 653 | 3300025899 | Ga0207642_10016957 | Ga0207642_100169572 | 366 |
| 654 | 3300025913 | Ga0207695_10002144 | Ga0207695_100021447 | 366 |
| 655 | 3300025913 | Ga0207695_10137474 | Ga0207695_101374742 | 366 |
| 656 | 3300025914 | Ga0207671_10019962 | Ga0207671_100199623 | 366 |
| 657 | 3300025914 | Ga0207671_10130845 | Ga0207671_101308452 | 366 |
| 658 | 3300025919 | Ga0207657_10167202 | Ga0207657_101672021 | 366 |
| 659 | 3300025923 | Ga0207681_10258681 | Ga0207681_102586812 | 366 |
| 660 | 3300025932 | Ga0207690_10014232 | Ga0207690_100142323 | 366 |
| 661 | 3300025934 | Ga0207686_10002379 | Ga0207686_100023793 | 366 |
| 662 | 3300025937 | Ga0207669_10019354 | Ga0207669_100193542 | 366 |
| 663 | 3300025940 | Ga0207691_10033523 | Ga0207691_100335235 | 366 |
| 664 | 3300025940 | Ga0207691_10078777 | Ga0207691_100787773 | 366 |
| 665 | 3300025942 | Ga0207689_10016558 | Ga0207689_100165582 | 366 |
| 666 | 3300025942 | Ga0207689_10029959 | Ga0207689_100299593 | 366 |
| 667 | 3300025944 | Ga0207661_10016817 | Ga0207661_100168173 | 366 |
| 668 | 3300025944 | Ga0207661_10017076 | Ga0207661_100170764 | 366 |
| 669 | 3300025945 | Ga0207679_10040417 | Ga0207679_100404173 | 366 |
| 670 | 3300025945 | Ga0207679_10298365 | Ga0207679_102983651 | 366 |
| 671 | 3300025960 | Ga0207651_10099594 | Ga0207651_100995943 | 366 |
| 672 | 3300025961 | Ga0207712_10008345 | Ga0207712_100083452 | 366 |
| 673 | 3300025961 | Ga0207712_10349203 | Ga0207712_103492031 | 366 |
| 674 | 3300026088 | Ga0207641_10001165 | Ga0207641_1000116510 | 366 |
| 675 | 3300026089 | Ga0207648_10077588 | Ga0207648_100775884 | 366 |
| 676 | 3300026116 | Ga0207674_10006014 | Ga0207674_100060146 | 366 |
| 677 | 3300026116 | Ga0207674_10121792 | Ga0207674_101217922 | 366 |
| 678 | 3300026118 | Ga0207675_100153605 | Ga0207675_1001536052 | 366 |
| 679 | 3300028379 | Ga0268266_10000149 | Ga0268266_1000014997 | 366 |
| 680 | 3300028381 | Ga0268264_10000064 | Ga0268264_1000006457 | 366 |
| 681 | 3300028381 | Ga0268264_10135630 | Ga0268264_101356301 | 366 |
| 682 | 3300031456 | Ga0307513_10158870 | Ga0307513_101588701 | 366 |
| 683 | 3300032004 | Ga0307414_10000021 | Ga0307414_10000021157 | 366 |
| 684 | 3300032004 | Ga0307414_10191614 | Ga0307414_101916142 | 366 |
| 685 | 3300041486 | Ga0451807_1542018 | Ga0451807_1542018_40_1140 | 366 |
| 686 | 3300042876 | Ga0451577_0007245 | Ga0451577_0007245_1827_2930 | 366 |
| 687 | 3300044658 | Ga0466972_0000027 | Ga0466972_0000027_167655_168755 | 366 |
| 688 | 3300044658 | Ga0466972_0012027 | Ga0466972_0012027_3238_4338 | 366 |
| 689 | 3300044712 | Ga0453684_0000549 | Ga0453684_0000549_140371_141474 | 366 |
| 690 | 3300046453 | Ga0495627_017509 | Ga0495627_017509_1134_2237 | 366 |
| 691 | 3300046477 | Ga0495664_0062271 | Ga0495664_0062271_743_1879 | 366 |
| 692 | 3300046524 | Ga0495648_0001120 | Ga0495648_0001120_19255_20355 | 366 |
| 693 | 3300046558 | Ga0495633_0018045 | Ga0495633_0018045_1067_2170 | 366 |
| 694 | 3300046616 | Ga0495668_0007170 | Ga0495668_0007170_2731_3831 | 366 |
| 695 | 3300046648 | Ga0495611_0000099 | Ga0495611_0000099_373_1473 | 366 |
| 696 | 3300046660 | Ga0495625_0114616 | Ga0495625_0114616_624_1724 | 366 |
| 697 | 3300047320 | Ga0495672_0010307 | Ga0495672_0010307_2981_4081 | 366 |
| 698 | 3300047443 | Ga0495687_000158 | Ga0495687_000158_60788_61888 | 366 |
| 699 | 3300049581 | Ga0501047_0035937 | Ga0501047_0035937_731_1834 | 366 |
| 700 | 3300049661 | Ga0501217_029450 | Ga0501217_029450_168_1319 | 366 |
| 701 | 3300049663 | Ga0501223_003903 | Ga0501223_003903_1154_2305 | 366 |
| 702 | 3300049669 | Ga0501235_004698 | Ga0501235_004698_1654_2805 | 366 |
| 703 | 3300049674 | Ga0501242_004225 | Ga0501242_004225_288_1439 | 366 |
| 704 | 3300049675 | Ga0501243_000060 | Ga0501243_000060_3393_4544 | 366 |
| 705 | 3300049686 | Ga0501257_032032 | Ga0501257_032032_40_1179 | 366 |
| 706 | 3300049705 | Ga0501225_0001832 | Ga0501225_0001832_1409_2509 | 366 |
| 707 | 3300049707 | Ga0501234_003841 | Ga0501234_003841_791_1942 | 366 |
| 708 | 3300049823 | Ga0501044_0272675 | Ga0501044_0272675_50_1153 | 366 |
| 709 | 3300050507 | nmdc:mga05p37_42353_c1 | nmdc:mga05p37_42353_c1_950_2050 | 366 |
| 710 | 3300050510 | nmdc:mga06r32_57778_c1 | nmdc:mga06r32_57778_c1_2539_3642 | 366 |
| 711 | 3300053086 | Ga0500578_0000009 | Ga0500578_0000009_49854_50954 | 366 |
| 712 | 3300053092 | Ga0500583_0000036 | Ga0500583_0000036_89121_90221 | 366 |
| 713 | 3300053092 | Ga0500583_0000666 | Ga0500583_0000666_3331_4431 | 366 |
| 714 | 3300053093 | Ga0500651_0019024 | Ga0500651_0019024_2831_3934 | 366 |
| 715 | 3300053139 | Ga0500568_0000346 | Ga0500568_0000346_29925_31028 | 366 |
| 716 | 3300053156 | Ga0500622_0001640 | Ga0500622_0001640_3597_4697 | 366 |
| 717 | 3300053156 | Ga0500622_0026835 | Ga0500622_0026835_533_1633 | 366 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5a06-assembly1.cif.gz_C | crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol | 0.9431 | 35 | 365 |
| 1evj-assembly1.cif.gz_C | crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d | 0.9427 | 37 | 364 |
| 1h6d-assembly3.cif.gz_I | oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol | 0.9393 | 33 | 364 |
| 1evj-assembly2.cif.gz_B | crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d | 0.9362 | 37 | 364 |
| 1rye-assembly1.cif.gz_C | crystal structure of the shifted form of the glucose-fructose oxidoreductase from zymomonas mobilis | 0.9345 | 37 | 365 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1h6aA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9646 | 33 | 165 | 3.40.50.720 |
| 3moiA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9263 | 37 | 161 | 3.40.50.720 |
| 3rbvA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9201 | 37 | 162 | 3.40.50.720 |
| af_P42599_1_134_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9138 | 38 | 169 | 3.40.50.720 |
| 4hadB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9108 | 38 | 158 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A059EDH1-F1-model_v4 | Glucose-fructose oxidoreductase | 0.9557 | 33 | 365 |
GO:0000166
GO:0016491 |
| AF-A0A6L9L9A7-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9475 | 33 | 365 |
GO:0000166
GO:0016491 |
| AF-A0A4Q6BVG7-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9404 | 52 | 365 |
GO:0000166
GO:0016491 |
| AF-A0A2V6G7H8-F1-model_v4 | Gfo/Idh/MocA family oxidoreductase | 0.9344 | 35 | 365 |
GO:0000166
GO:0016491 |
| AF-A0A1G7HBR9-F1-model_v4 | Predicted dehydrogenase | 0.9332 | 32 | 365 |
GO:0000166
GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar