F477028

General Info

Members Datasets Scaffolds Average Seq Length
716 335 1432 303

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100080836|Ga0070671_1000808363
Length 352
Sequence MTSSKGKSSGGERQSKAAGRRKPVAEVPAVTVPTRVFDPTKPLPDDLTTAEILAATPPAKPRRSRKRETAKTLGVYDADRDILDQYLYEVSMTPLLTPQQEIAIAKRVRMGDQDAMQELVKRNLRFVISVAKKYQNRGLPLTDLIGEGNVGLLTAARKFDPDQGVKFISYAVWWIRQAILASLARQGRTVRVPLNRTADLSKIVRTAEALRQELRREPTPEEIAQSTGLSLEVVQSLAALNTSDVRLDAPLDPEGDRSLIERFIAEDQGDAEEQAMDSFLSEEIESALRTLPPRDAKVLRLYFGLDGGREHTLEEIGGMLGVTRERVRQLRDRALKRLREGDVGRALASFAA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
172 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
194 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
203 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
204 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
216 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
230 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
308 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
309 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
310 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
311 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
312 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
330 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
331 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
333 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
335 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 2.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 8.94
Rhizosphere 90.5
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100080836 3300005355 Bacteria 2718
2 rootL2_10175328 3300003322 Bacteria 5860
3 Ga0006781J51513_1016989 3300003568 Unclassified 1180
4 Ga0007429J51699_1015491 3300003579 Unclassified 1176
5 Ga0032354_1005271 3300003693 Unclassified 1270
6 Ga0006780_1009652 3300003735 Unclassified 1171
7 Ga0058863_10022371 3300004799 Bacteria 1058
8 Ga0058863_10032824 3300004799 Bacteria 1056
9 Ga0058861_10023093 3300004800 Bacteria 1963
10 Ga0058862_10029900 3300004803 Bacteria 1355
11 Ga0070658_10322226 3300005327 Bacteria 1320
12 Ga0070683_100034790 3300005329 Bacteria 4604
13 Ga0068869_100037651 3300005334 Bacteria 3441
14 Ga0070680_100003299 3300005336 Bacteria 12041
15 Ga0070680_100020856 3300005336 Bacteria 5202
16 Ga0070680_100022221 3300005336 Bacteria 5048
17 Ga0070680_100044538 3300005336 Bacteria 3605
18 Ga0070680_100078040 3300005336 Bacteria 2728
19 Ga0068868_100020234 3300005338 Bacteria 4996
20 Ga0070660_100008563 3300005339 Bacteria 7162
21 Ga0070691_10024995 3300005341 Bacteria 2779
22 Ga0070687_100059293 3300005343 Bacteria 2015
23 Ga0070661_100004479 3300005344 Bacteria 9635
24 Ga0070661_100100049 3300005344 Bacteria 2155
25 Ga0070692_10134519 3300005345 Bacteria 1393
26 Ga0070668_100029512 3300005347 Bacteria 4166
27 Ga0070668_100075243 3300005347 Bacteria 2636
28 Ga0070669_100039339 3300005353 Bacteria 3436
29 Ga0070675_100136738 3300005354 Bacteria 2092
30 Ga0070674_100034213 3300005356 Bacteria 3392
31 Ga0070659_100065929 3300005366 Bacteria 2869
32 Ga0070709_10026619 3300005434 Bacteria 3430
33 Ga0070709_10177401 3300005434 Bacteria 1494
34 Ga0070709_10263210 3300005434 Bacteria 1247
35 Ga0070714_100009907 3300005435 Bacteria 7515
36 Ga0070714_100024257 3300005435 Bacteria 4990
37 Ga0070713_100000613 3300005436 Bacteria 22734
38 Ga0070713_100189495 3300005436 Bacteria 1853
39 Ga0070713_100193991 3300005436 Bacteria 1831
40 Ga0070710_10143874 3300005437 Bacteria 1465
41 Ga0070711_100023214 3300005439 Bacteria 4030
42 Ga0070705_100022882 3300005440 Bacteria 3346
43 Ga0070705_100064500 3300005440 Bacteria 2189
44 Ga0070700_100023254 3300005441 Bacteria 3623
45 Ga0070700_100335170 3300005441 Bacteria 1116
46 Ga0070708_100111180 3300005445 Bacteria 2518
47 Ga0070708_100133701 3300005445 Bacteria 2297
48 Ga0070663_100169887 3300005455 Bacteria 1685
49 Ga0070662_100001133 3300005457 Bacteria 16293
50 Ga0070681_10003599 3300005458 Bacteria 14529
51 Ga0070681_10009235 3300005458 Bacteria 9691
52 Ga0070681_10074960 3300005458 Bacteria 3344
53 Ga0070681_10111442 3300005458 Bacteria 2675
54 Ga0070681_10204204 3300005458 Bacteria 1894
55 Ga0070685_10028556 3300005466 Bacteria 3091
56 Ga0070706_100151760 3300005467 Bacteria 2162
57 Ga0070707_100015201 3300005468 Bacteria 7222
58 Ga0070707_100048292 3300005468 Bacteria 4077
59 Ga0070707_100170417 3300005468 Bacteria 2121
60 Ga0070707_100220492 3300005468 Bacteria 1847
61 Ga0070698_100006957 3300005471 Bacteria 12249
62 Ga0070698_100021368 3300005471 Bacteria 6780
63 Ga0070698_100055578 3300005471 Bacteria 4012
64 Ga0070698_100180162 3300005471 Bacteria 2052
65 Ga0070698_100408001 3300005471 Bacteria 1292
66 Ga0070699_100002420 3300005518 Bacteria 16748
67 Ga0070699_100005787 3300005518 Bacteria 10811
68 Ga0070699_100018809 3300005518 Bacteria 5933
69 Ga0070699_100046366 3300005518 Bacteria 3760
70 Ga0070699_100068582 3300005518 Bacteria 3080
71 Ga0070679_100009001 3300005530 Bacteria 9418
72 Ga0070679_100016143 3300005530 Bacteria 7196
73 Ga0070679_100025375 3300005530 Bacteria 5816
74 Ga0070679_100030573 3300005530 Bacteria 5316
75 Ga0070679_100042693 3300005530 Bacteria 4516
76 Ga0070679_100053122 3300005530 Bacteria 4034
77 Ga0070679_100107811 3300005530 Bacteria 2771
78 Ga0070679_100119845 3300005530 Bacteria 2616
79 Ga0070679_100233696 3300005530 Bacteria 1798
80 Ga0070684_100073520 3300005535 Bacteria 3012
81 Ga0070697_100002997 3300005536 Bacteria 12963
82 Ga0070697_100207150 3300005536 Bacteria 1668
83 Ga0068853_100002137 3300005539 Bacteria 14714
84 Ga0068853_100125723 3300005539 Bacteria 2290
85 Ga0070672_100091882 3300005543 Bacteria 2449
86 Ga0070686_100000019 3300005544 Bacteria 139615
87 Ga0070695_100190968 3300005545 Bacteria 1458
88 Ga0070696_100006350 3300005546 Bacteria 7910
89 Ga0070696_100011766 3300005546 Bacteria 5864
90 Ga0070696_100041317 3300005546 Bacteria 3186
91 Ga0070696_100044477 3300005546 Bacteria 3075
92 Ga0070693_100003492 3300005547 Bacteria 7333
93 Ga0070693_100186870 3300005547 Bacteria 1338
94 Ga0070693_100225670 3300005547 Bacteria 1230
95 Ga0070693_100299348 3300005547 Bacteria 1084
96 Ga0070704_100080644 3300005549 Bacteria 2394
97 Ga0068855_100034245 3300005563 Bacteria 6059
98 Ga0068855_100042472 3300005563 Bacteria 5386
99 Ga0068855_100115730 3300005563 Bacteria 3073
100 Ga0068855_100123337 3300005563 Bacteria 2964
101 Ga0070664_100105206 3300005564 Bacteria 2458
102 Ga0068857_100021177 3300005577 Bacteria 5721
103 Ga0068857_100132001 3300005577 Bacteria 2253
104 Ga0068854_100003430 3300005578 Bacteria 9881
105 Ga0068854_100018423 3300005578 Bacteria 4686
106 Ga0068856_100054706 3300005614 Bacteria 3938
107 Ga0068856_100111745 3300005614 Bacteria 2730
108 Ga0068856_100246352 3300005614 Bacteria 1802
109 Ga0068856_100297732 3300005614 Bacteria 1630
110 Ga0068852_100040836 3300005616 Bacteria 3917
111 Ga0068852_100087338 3300005616 Bacteria 2782
112 Ga0068859_100113319 3300005617 Bacteria 2775
113 Ga0068859_100164192 3300005617 Bacteria 2300
114 Ga0068864_100010117 3300005618 Bacteria 7788
115 Ga0068866_10089826 3300005718 Bacteria 1670
116 Ga0068862_100032596 3300005844 Bacteria 4402
117 Ga0068862_100264960 3300005844 Bacteria 1570
118 Ga0081455_10034468 3300005937 Bacteria 4534
119 Ga0070717_10029999 3300006028 Bacteria 4369
120 Ga0070717_10189265 3300006028 Bacteria 1798
121 Ga0070712_100049292 3300006175 Bacteria 2924
122 Ga0070712_100146362 3300006175 Bacteria 1809
123 Ga0075428_100017622 3300006844 Bacteria 7889
124 Ga0075431_100001611 3300006847 Bacteria 21067
125 Ga0075431_100009633 3300006847 Bacteria 9703
126 Ga0075431_100078878 3300006847 Bacteria 3399
127 Ga0075431_100474662 3300006847 Bacteria 1244
128 Ga0075433_10051174 3300006852 Bacteria 3596
129 Ga0075433_10131388 3300006852 Bacteria 2224
130 Ga0075434_100552840 3300006871 Bacteria 1171
131 Ga0075429_100245467 3300006880 Bacteria 1568
132 Ga0068865_100007947 3300006881 Bacteria 6550
133 Ga0068865_100045084 3300006881 Bacteria 3021
134 Ga0075436_100009117 3300006914 Bacteria 6789
135 Ga0075436_100041779 3300006914 Bacteria 3164
136 Ga0075436_100070748 3300006914 Bacteria 2412
137 Ga0097620_100113316 3300006931 Bacteria 2775
138 Ga0097620_100164194 3300006931 Bacteria 2300
139 Ga0105240_10012239 3300009093 Bacteria 11855
140 Ga0105240_10108857 3300009093 Bacteria 3356
141 Ga0105240_10210411 3300009093 Bacteria 2273
142 Ga0105240_10224427 3300009093 Bacteria 2187
143 Ga0105240_10360040 3300009093 Bacteria 1648
144 Ga0111539_10047475 3300009094 Bacteria 5131
145 Ga0111539_10222541 3300009094 Bacteria 2198
146 Ga0111539_10411406 3300009094 Bacteria 1575
147 Ga0105245_10202500 3300009098 Bacteria 1906
148 Ga0114129_10000967 3300009147 Bacteria 37553
149 Ga0114129_10023362 3300009147 Bacteria 8769
150 Ga0114129_10096484 3300009147 Bacteria 4093
151 Ga0114129_10186444 3300009147 Bacteria 2819
152 Ga0114129_10193434 3300009147 Bacteria 2760
153 Ga0114129_10243018 3300009147 Bacteria 2420
154 Ga0114129_10462578 3300009147 Bacteria 1662
155 Ga0114129_10714475 3300009147 Bacteria 1286
156 Ga0105241_10081071 3300009174 Bacteria 2541
157 Ga0105241_10556721 3300009174 Bacteria 1030
158 Ga0105242_10284581 3300009176 Bacteria 1503
159 Ga0105248_10230889 3300009177 Bacteria 2083
160 Ga0105248_10457032 3300009177 Bacteria 1439
161 Ga0105237_10064590 3300009545 Bacteria 3656
162 Ga0105238_10000164 3300009551 Bacteria 71747
163 Ga0105238_10019775 3300009551 Bacteria 6856
164 Ga0105238_10038888 3300009551 Bacteria 4830
165 Ga0105238_10094898 3300009551 Bacteria 2970
166 Ga0105249_10000078 3300009553 Bacteria 140030
167 Ga0105239_10060015 3300010375 Bacteria 4174
168 Ga0105246_10028562 3300011119 Bacteria 3665
169 Ga0157373_10032278 3300013100 Bacteria 3770
170 Ga0157373_10092671 3300013100 Bacteria 2128
171 Ga0157373_10129869 3300013100 Bacteria 1772
172 Ga0157370_10070657 3300013104 Bacteria 3295
173 Ga0157370_10074430 3300013104 Bacteria 3203
174 Ga0157370_10074628 3300013104 Bacteria 3199
175 Ga0157369_10071321 3300013105 Bacteria 3730
176 Ga0157369_10142577 3300013105 Bacteria 2534
177 Ga0157369_10153503 3300013105 Bacteria 2433
178 Ga0157369_10256337 3300013105 Bacteria 1825
179 Ga0157378_10021281 3300013297 Bacteria 5702
180 Ga0157372_10016786 3300013307 Bacteria 7859
181 Ga0157372_10030513 3300013307 Bacteria 5897
182 Ga0157372_10067617 3300013307 Bacteria 4015
183 Ga0157372_10145451 3300013307 Bacteria 2733
184 Ga0157372_10174590 3300013307 Bacteria 2487
185 Ga0157372_10195190 3300013307 Bacteria 2345
186 Ga0157372_10447805 3300013307 Bacteria 1505
187 Ga0157375_10517902 3300013308 Bacteria 1356
188 Ga0163163_10120964 3300014325 Bacteria 2652
189 Ga0157380_10098028 3300014326 Bacteria 2434
190 Ga0182008_10005341 3300014497 Bacteria 7335
191 Ga0157379_10098657 3300014968 Bacteria 2622
192 Ga0157376_10197635 3300014969 Bacteria 1848
193 Ga0182007_10055586 3300015262 Bacteria 1301
194 Ga0197907_10079591 3300020069 Bacteria 1671
195 Ga0206356_10918997 3300020070 Bacteria 1159
196 Ga0206356_11226634 3300020070 Bacteria 1984
197 Ga0206351_10291053 3300020077 Bacteria 1140
198 Ga0206352_10650051 3300020078 Bacteria 1315
199 Ga0206352_11112771 3300020078 Bacteria 1124
200 Ga0206354_10583953 3300020081 Bacteria 1442
201 Ga0213875_10012597 3300021388 Bacteria 4169
202 Ga0224712_10066279 3300022467 Bacteria 1454
203 Ga0224712_10122937 3300022467 Bacteria 1126
204 Ga0207653_10024341 3300025885 Bacteria 1932
205 Ga0207682_10024049 3300025893 Bacteria 2410
206 Ga0207692_10133082 3300025898 Bacteria 1406
207 Ga0207642_10150584 3300025899 Bacteria 1238
208 Ga0207699_10052703 3300025906 Bacteria 2409
209 Ga0207699_10063370 3300025906 Bacteria 2233
210 Ga0207699_10233425 3300025906 Bacteria 1261
211 Ga0207699_10234813 3300025906 Bacteria 1257
212 Ga0207645_10005788 3300025907 Bacteria 8917
213 Ga0207645_10090623 3300025907 Bacteria 1966
214 Ga0207643_10069275 3300025908 Bacteria 2027
215 Ga0207684_10320315 3300025910 Bacteria 1336
216 Ga0207654_10350596 3300025911 Bacteria 1016
217 Ga0207707_10001068 3300025912 Bacteria 26271
218 Ga0207707_10004116 3300025912 Bacteria 12890
219 Ga0207707_10010041 3300025912 Bacteria 8211
220 Ga0207707_10019109 3300025912 Bacteria 5980
221 Ga0207707_10026624 3300025912 Bacteria 5054
222 Ga0207707_10035867 3300025912 Bacteria 4336
223 Ga0207707_10047570 3300025912 Bacteria 3735
224 Ga0207707_10055509 3300025912 Bacteria 3446
225 Ga0207707_10065785 3300025912 Bacteria 3156
226 Ga0207707_10075682 3300025912 Bacteria 2937
227 Ga0207707_10227980 3300025912 Bacteria 1621
228 Ga0207695_10038557 3300025913 Bacteria 5142
229 Ga0207695_10050641 3300025913 Bacteria 4367
230 Ga0207695_10052732 3300025913 Bacteria 4259
231 Ga0207695_10057259 3300025913 Bacteria 4050
232 Ga0207695_10115626 3300025913 Bacteria 2657
233 Ga0207671_10089645 3300025914 Bacteria 2315
234 Ga0207693_10028182 3300025915 Bacteria 4438
235 Ga0207693_10054026 3300025915 Bacteria 3151
236 Ga0207663_10036989 3300025916 Bacteria 2940
237 Ga0207660_10005160 3300025917 Bacteria 8492
238 Ga0207660_10019495 3300025917 Bacteria 4535
239 Ga0207660_10038716 3300025917 Bacteria 3329
240 Ga0207660_10040206 3300025917 Bacteria 3273
241 Ga0207660_10059744 3300025917 Bacteria 2738
242 Ga0207660_10081958 3300025917 Bacteria 2372
243 Ga0207660_10166263 3300025917 Bacteria 1705
244 Ga0207660_10252562 3300025917 Bacteria 1392
245 Ga0207660_10309237 3300025917 Unclassified 1260
246 Ga0207662_10010521 3300025918 Bacteria 5111
247 Ga0207662_10078069 3300025918 Bacteria 2015
248 Ga0207657_10009377 3300025919 Bacteria 9846
249 Ga0207657_10068311 3300025919 Bacteria 3019
250 Ga0207649_10033125 3300025920 Bacteria 3085
251 Ga0207649_10073369 3300025920 Bacteria 2192
252 Ga0207652_10007505 3300025921 Bacteria 8778
253 Ga0207652_10017555 3300025921 Bacteria 5857
254 Ga0207652_10065442 3300025921 Bacteria 3148
255 Ga0207652_10066578 3300025921 Bacteria 3122
256 Ga0207652_10082843 3300025921 Bacteria 2808
257 Ga0207652_10088984 3300025921 Bacteria 2710
258 Ga0207652_10268360 3300025921 Bacteria 1539
259 Ga0207652_10350942 3300025921 Bacteria 1331
260 Ga0207646_10087135 3300025922 Bacteria 2794
261 Ga0207646_10093910 3300025922 Bacteria 2686
262 Ga0207681_10158040 3300025923 Bacteria 1705
263 Ga0207694_10000071 3300025924 Bacteria 120633
264 Ga0207694_10042329 3300025924 Bacteria 3513
265 Ga0207687_10172676 3300025927 Bacteria 1669
266 Ga0207700_10000550 3300025928 Bacteria 22006
267 Ga0207700_10163651 3300025928 Bacteria 1850
268 Ga0207700_10263092 3300025928 Bacteria 1478
269 Ga0207664_10020097 3300025929 Bacteria 4945
270 Ga0207664_10073090 3300025929 Bacteria 2766
271 Ga0207664_10134238 3300025929 Bacteria 2086
272 Ga0207664_10177287 3300025929 Bacteria 1828
273 Ga0207644_10028695 3300025931 Bacteria 3855
274 Ga0207690_10083792 3300025932 Bacteria 2233
275 Ga0207706_10001190 3300025933 Bacteria 26240
276 Ga0207706_10006009 3300025933 Bacteria 11290
277 Ga0207706_10060034 3300025933 Bacteria 3349
278 Ga0207669_10069134 3300025937 Bacteria 2208
279 Ga0207704_10125274 3300025938 Bacteria 1767
280 Ga0207665_10338851 3300025939 Bacteria 1132
281 Ga0207691_10223203 3300025940 Bacteria 1633
282 Ga0207691_10262618 3300025940 Bacteria 1488
283 Ga0207689_10153684 3300025942 Bacteria 1897
284 Ga0207661_10105296 3300025944 Bacteria 2376
285 Ga0207661_10485758 3300025944 Bacteria 1128
286 Ga0207679_10303499 3300025945 Bacteria 1377
287 Ga0207667_10079507 3300025949 Bacteria 3398
288 Ga0207667_10134740 3300025949 Bacteria 2543
289 Ga0207667_10417086 3300025949 Bacteria 1366
290 Ga0207667_10697746 3300025949 Bacteria 1018
291 Ga0207651_10330121 3300025960 Bacteria 1278
292 Ga0207712_10000568 3300025961 Bacteria 29835
293 Ga0207712_10001653 3300025961 Bacteria 14998
294 Ga0207712_10015750 3300025961 Bacteria 4883
295 Ga0207712_10131732 3300025961 Bacteria 1906
296 Ga0207668_10002220 3300025972 Bacteria 11320
297 Ga0207668_10053358 3300025972 Bacteria 2801
298 Ga0207668_10339859 3300025972 Bacteria 1252
299 Ga0207640_10223179 3300025981 Bacteria 1444
300 Ga0207639_10005231 3300026041 Bacteria 8752
301 Ga0207639_10176422 3300026041 Bacteria 1814
302 Ga0207639_10427258 3300026041 Bacteria 1199
303 Ga0207639_10582342 3300026041 Bacteria 1030
304 Ga0207678_10105611 3300026067 Bacteria 2403
305 Ga0207678_10357467 3300026067 Bacteria 1260
306 Ga0207708_10011594 3300026075 Bacteria 6568
307 Ga0207708_10104325 3300026075 Bacteria 2196
308 Ga0207702_10107317 3300026078 Bacteria 2476
309 Ga0207641_10062106 3300026088 Bacteria 3187
310 Ga0207676_10011297 3300026095 Bacteria 6382
311 Ga0207676_10662311 3300026095 Bacteria 1008
312 Ga0207674_10031277 3300026116 Bacteria 5592
313 Ga0207674_10153962 3300026116 Bacteria 2255
314 Ga0207675_100060689 3300026118 Bacteria 3530
315 Ga0207698_10019017 3300026142 Bacteria 4692
316 Ga0207698_10248064 3300026142 Bacteria 1627
317 Ga0209970_1006447 3300027614 Bacteria 1925
318 Ga0268266_10120065 3300028379 Bacteria 2339
319 Ga0268265_10107946 3300028380 Bacteria 2265
320 Ga0268265_10342081 3300028380 Bacteria 1363
321 Ga0268265_10358620 3300028380 Bacteria 1334
322 Ga0268265_10455750 3300028380 Bacteria 1195
323 Ga0307408_100020409 3300031548 Bacteria 4472
324 Ga0307408_100042937 3300031548 Bacteria 3215
325 Ga0307408_100057995 3300031548 Bacteria 2813
326 Ga0307408_100147447 3300031548 Bacteria 1854
327 Ga0307408_100196828 3300031548 Bacteria 1628
328 Ga0307408_100286951 3300031548 Bacteria 1373
329 Ga0307408_100316817 3300031548 Bacteria 1312
330 Ga0307408_100338018 3300031548 Bacteria 1274
331 Ga0316579_10001200 3300031691 Bacteria 9287
332 Ga0316579_10005340 3300031691 Bacteria 5177
333 Ga0316576_10001914 3300031727 Bacteria 11600
334 Ga0316578_10000302 3300031728 Bacteria 15099
335 Ga0316578_10001720 3300031728 Bacteria 9139
336 Ga0307405_10088128 3300031731 Bacteria 2047
337 Ga0307405_10136560 3300031731 Bacteria 1703
338 Ga0307405_10138705 3300031731 Bacteria 1692
339 Ga0307405_10144319 3300031731 Bacteria 1665
340 Ga0307405_10266073 3300031731 Bacteria 1283
341 Ga0316577_10000090 3300031733 Bacteria 24344
342 Ga0316577_10000428 3300031733 Bacteria 16319
343 Ga0316577_10000433 3300031733 Bacteria 16242
344 Ga0316577_10047326 3300031733 Bacteria 2401
345 Ga0307413_10004893 3300031824 Bacteria 5896
346 Ga0307413_10006194 3300031824 Bacteria 5435
347 Ga0307413_10041512 3300031824 Bacteria 2694
348 Ga0307413_10046211 3300031824 Bacteria 2587
349 Ga0307413_10076802 3300031824 Bacteria 2124
350 Ga0307413_10158454 3300031824 Bacteria 1587
351 Ga0307413_10219860 3300031824 Bacteria 1387
352 Ga0307413_10504153 3300031824 Bacteria 972
353 Ga0307410_10002094 3300031852 Bacteria 9461
354 Ga0307410_10004773 3300031852 Bacteria 7072
355 Ga0307410_10009908 3300031852 Bacteria 5373
356 Ga0307410_10015068 3300031852 Bacteria 4574
357 Ga0307410_10124567 3300031852 Bacteria 1884
358 Ga0307410_10134156 3300031852 Bacteria 1823
359 Ga0307410_10153427 3300031852 Bacteria 1717
360 Ga0307406_10016863 3300031901 Bacteria 4250
361 Ga0307406_10016886 3300031901 Bacteria 4247
362 Ga0307406_10022399 3300031901 Bacteria 3748
363 Ga0307406_10024498 3300031901 Bacteria 3606
364 Ga0307406_10051812 3300031901 Bacteria 2608
365 Ga0307406_10100945 3300031901 Bacteria 1965
366 Ga0307406_10123123 3300031901 Bacteria 1807
367 Ga0307406_10145957 3300031901 Bacteria 1681
368 Ga0307406_10149495 3300031901 Bacteria 1664
369 Ga0307406_10167551 3300031901 Bacteria 1586
370 Ga0307406_10317280 3300031901 Bacteria 1204
371 Ga0307407_10001982 3300031903 Bacteria 7788
372 Ga0307407_10016357 3300031903 Bacteria 3693
373 Ga0307407_10073607 3300031903 Bacteria 2042
374 Ga0307407_10092034 3300031903 Bacteria 1861
375 Ga0307412_10028500 3300031911 Bacteria 3494
376 Ga0307409_100011240 3300031995 Bacteria 5629
377 Ga0307409_100018209 3300031995 Bacteria 4712
378 Ga0307409_100050329 3300031995 Bacteria 3181
379 Ga0307409_100051075 3300031995 Bacteria 3162
380 Ga0307409_100060748 3300031995 Bacteria 2949
381 Ga0307409_100109947 3300031995 Bacteria 2309
382 Ga0307409_100128521 3300031995 Bacteria 2160
383 Ga0307409_100142773 3300031995 Bacteria 2065
384 Ga0307409_100243494 3300031995 Bacteria 1639
385 Ga0307409_100360270 3300031995 Bacteria 1375
386 Ga0307409_100398947 3300031995 Bacteria 1313
387 Ga0307409_100427621 3300031995 Bacteria 1272
388 Ga0307416_100006042 3300032002 Bacteria 7535
389 Ga0307416_100031463 3300032002 Bacteria 3995
390 Ga0307416_100039532 3300032002 Bacteria 3653
391 Ga0307416_100047727 3300032002 Bacteria 3392
392 Ga0307416_100050439 3300032002 Bacteria 3317
393 Ga0307416_100057734 3300032002 Bacteria 3142
394 Ga0307416_100081465 3300032002 Bacteria 2737
395 Ga0307416_100104301 3300032002 Bacteria 2478
396 Ga0307416_100109755 3300032002 Bacteria 2427
397 Ga0307416_100128810 3300032002 Bacteria 2273
398 Ga0307416_100140672 3300032002 Unclassified 2193
399 Ga0307416_100189634 3300032002 Bacteria 1937
400 Ga0307416_100206881 3300032002 Bacteria 1867
401 Ga0307414_10048098 3300032004 Bacteria 2940
402 Ga0307414_10144470 3300032004 Bacteria 1867
403 Ga0307414_10222243 3300032004 Bacteria 1551
404 Ga0307414_10248496 3300032004 Bacteria 1477
405 Ga0307414_10287734 3300032004 Bacteria 1384
406 Ga0307414_10342045 3300032004 Bacteria 1281
407 Ga0307411_10018555 3300032005 Bacteria 3994
408 Ga0307411_10023188 3300032005 Bacteria 3671
409 Ga0307411_10023882 3300032005 Bacteria 3633
410 Ga0307411_10040900 3300032005 Bacteria 2944
411 Ga0307411_10042560 3300032005 Bacteria 2899
412 Ga0307411_10049308 3300032005 Bacteria 2735
413 Ga0307411_10131825 3300032005 Bacteria 1828
414 Ga0307411_10556348 3300032005 Bacteria 979
415 Ga0307415_100008314 3300032126 Bacteria 5743
416 Ga0307415_100076532 3300032126 Bacteria 2372
417 Ga0307415_100077642 3300032126 Bacteria 2359
418 Ga0307415_100116787 3300032126 Bacteria 1991
419 Ga0316580_10010301 3300032139 Bacteria 2822
420 Ga0316593_10023466 3300032168 Bacteria 1947
421 Ga0316593_10098836 3300032168 Bacteria 1033
422 Ga0316596_1041130 3300033541 Bacteria 1215
423 Ga0373959_0000280 3300034820 Bacteria 10891
424 Ga0373959_0033679 3300034820 Bacteria 1046
425 Ga0373926_0005757 3300035083 Bacteria 4094
426 Ga0373940_0045215 3300035088 Bacteria 1221
427 Ga0373949_0023386 3300035090 Bacteria 1430
428 Ga0373923_0002279 3300035111 Bacteria 5854
429 Ga0373936_0019630 3300035113 Bacteria 2620
430 Ga0373939_0046446 3300035114 Bacteria 1330
431 Ga0373941_0028664 3300035115 Bacteria 1636
432 Ga0373953_0098519 3300035117 Bacteria 1228
433 Ga0373960_0069517 3300035121 Bacteria 1086
434 Ga0373946_0014579 3300035171 Bacteria 2965
435 Ga0373955_0006299 3300035172 Bacteria 5404
436 Ga0316574_0013497 3300035398 Bacteria 4698
437 Ga0316574_0047496 3300035398 Bacteria 2665
438 Ga0373924_0005697 3300035410 Bacteria 4422
439 Ga0373935_0011597 3300035692 Bacteria 5292
440 Ga0373927_0005620 3300035695 Bacteria 8615
441 Ga0373933_0000768 3300035724 Bacteria 19608
442 Ga0373947_0001405 3300035725 Bacteria 14815
443 Ga0373937_0000855 3300036401 Bacteria 26105
444 Ga0316582_0009340 3300036647 Bacteria 5318
445 Ga0316582_0078079 3300036647 Bacteria 2156
446 Ga0316584_0002489 3300036712 Bacteria 11666
447 Ga0316584_0022618 3300036712 Bacteria 4587
448 Ga0316584_0078657 3300036712 Bacteria 2470
449 Ga0373925_0003422 3300037068 Bacteria 12286
450 Ga0373925_0471797 3300037068 Bacteria 1029
451 Ga0395899_0010287 3300037312 Bacteria 7172
452 Ga0395900_0340034 3300037418 Bacteria 1477
453 Ga0395905_0047462 3300037471 Bacteria 4025
454 Ga0395905_0063051 3300037471 Bacteria 3467
455 Ga0316581_0007861 3300037588 Bacteria 2882
456 Ga0436364_0933811 3300037853 Bacteria 4174
457 Ga0395901_0010063 3300038443 Bacteria 9584
458 Ga0439439_0032883 3300041406 Bacteria 1326
459 Ga0450910_003147 3300042147 Bacteria 2182
460 Ga0439446_0018507 3300042156 Bacteria 1952
461 Ga0439446_0042451 3300042156 Bacteria 1342
462 Ga0439434_0064866 3300042435 Bacteria 1145
463 Ga0451577_0006854 3300042876 Bacteria 11279
464 Ga0451577_0072129 3300042876 Bacteria 3080
465 Ga0466969_0036155 3300044656 Bacteria 2496
466 Ga0453683_0051172 3300044673 Bacteria 2588
467 Ga0466965_0099299 3300044683 Bacteria 1488
468 Ga0466961_0001673 3300044693 Bacteria 13789
469 Ga0466964_0046344 3300044706 Bacteria 1772
470 Ga0453684_0372976 3300044712 Bacteria 1604
471 Ga0466957_0236018 3300044842 Bacteria 1212
472 Ga0466959_0056988 3300045049 Bacteria 2850
473 Ga0451576_0090888 3300045051 Bacteria 3175
474 Ga0466958_0067824 3300045836 Bacteria 2180
475 Ga0466967_0148924 3300045976 Bacteria 2186
476 Ga0495592_0000760 3300046454 Bacteria 22427
477 Ga0495603_0054779 3300046455 Bacteria 2363
478 Ga0495629_0007081 3300046459 Bacteria 8264
479 Ga0495651_0000942 3300046462 Bacteria 22542
480 Ga0495653_0000868 3300046463 Bacteria 23331
481 Ga0495580_0003627 3300046472 Bacteria 13071
482 Ga0495582_0002848 3300046473 Bacteria 9674
483 Ga0495639_0000089 3300046475 Bacteria 44172
484 Ga0495594_0060042 3300046499 Bacteria 2103
485 Ga0495594_0135623 3300046499 Bacteria 1395
486 Ga0495608_0003620 3300046511 Bacteria 11088
487 Ga0495618_0074879 3300046514 Bacteria 2156
488 Ga0495628_0011454 3300046516 Bacteria 7499
489 Ga0495630_0007153 3300046517 Bacteria 7955
490 Ga0495630_0101208 3300046517 Bacteria 2180
491 Ga0495643_0000043 3300046522 Bacteria 226821
492 Ga0495652_0041851 3300046529 Bacteria 3952
493 Ga0495665_0000272 3300046531 Bacteria 26290
494 Ga0495665_0169513 3300046531 Bacteria 1137
495 Ga0495586_0006720 3300046535 Bacteria 6144
496 Ga0495586_0102538 3300046535 Bacteria 1588
497 Ga0495587_0000827 3300046536 Bacteria 20527
498 Ga0495645_0000703 3300046543 Bacteria 22940
499 Ga0495622_0057344 3300046557 Bacteria 1805
500 Ga0495667_0049016 3300046559 Bacteria 2788
501 Ga0495634_0105882 3300046642 Bacteria 1813
502 Ga0495635_0000566 3300046663 Bacteria 23641
503 Ga0495635_0225692 3300046663 Bacteria 1266
504 Ga0495588_0000396 3300046674 Bacteria 24703
505 Ga0495657_0000787 3300046675 Bacteria 28215
506 Ga0495599_0007261 3300046678 Bacteria 6713
507 Ga0495623_0000572 3300046679 Bacteria 24483
508 Ga0495646_0055510 3300046680 Bacteria 2378
509 Ga0495658_0002152 3300046683 Bacteria 9971
510 Ga0495669_0050225 3300046684 Bacteria 1870
511 Ga0495613_0024107 3300046689 Bacteria 4534
512 Ga0495600_0000461 3300046809 Bacteria 21123
513 Ga0495581_0001927 3300047315 Bacteria 11634
514 Ga0495604_0000184 3300047317 Bacteria 55687
515 Ga0495674_0043261 3300047319 Bacteria 4009
516 Ga0495680_0010446 3300047322 Bacteria 8284
517 Ga0495675_0003056 3300047444 Bacteria 10056
518 Ga0495684_0025437 3300047471 Bacteria 4548
519 Ga0495593_0000172 3300047673 Bacteria 33560
520 Ga0495602_0005823 3300048088 Bacteria 12932
521 Ga0495614_0000310 3300048089 Bacteria 19278
522 Ga0496100_0034983 3300048903 Bacteria 3157
523 Ga0496101_0081683 3300048904 Bacteria 2391
524 Ga0496101_0090154 3300048904 Bacteria 2280
525 Ga0496101_0183648 3300048904 Bacteria 1611
526 Ga0496101_0193555 3300048904 Bacteria 1570
527 Ga0496102_0007597 3300048905 Bacteria 9264
528 Ga0496102_0014620 3300048905 Bacteria 6823
529 Ga0496102_0127451 3300048905 Bacteria 2380
530 Ga0496102_0179173 3300048905 Bacteria 1996
531 Ga0496103_0056535 3300048906 Bacteria 2436
532 Ga0496104_0008281 3300048907 Bacteria 9233
533 Ga0496104_0045211 3300048907 Bacteria 4140
534 Ga0496104_0060504 3300048907 Bacteria 3588
535 Ga0496104_0084934 3300048907 Bacteria 3021
536 Ga0496104_0497292 3300048907 Bacteria 1130
537 Ga0496105_0063218 3300048908 Bacteria 3054
538 Ga0496106_0017251 3300048909 Bacteria 5344
539 Ga0496106_0135774 3300048909 Bacteria 1932
540 Ga0496106_0137326 3300048909 Bacteria 1921
541 Ga0496106_0141049 3300048909 Bacteria 1896
542 Ga0496106_0315097 3300048909 Bacteria 1255
543 Ga0496106_0419049 3300048909 Bacteria 1076
544 Ga0496107_0060353 3300048910 Bacteria 2745
545 Ga0496107_0307356 3300048910 Bacteria 1180
546 Ga0496107_0400662 3300048910 Bacteria 1020
547 Ga0496108_0000554 3300048911 Bacteria 29289
548 Ga0496108_0000761 3300048911 Bacteria 25068
549 Ga0496108_0040854 3300048911 Bacteria 3869
550 Ga0496108_0094666 3300048911 Bacteria 2542
551 Ga0496108_0096945 3300048911 Bacteria 2512
552 Ga0496108_0100678 3300048911 Bacteria 2465
553 Ga0496109_0000982 3300048912 Bacteria 23606
554 Ga0496109_0002092 3300048912 Bacteria 16589
555 Ga0496109_0002112 3300048912 Bacteria 16523
556 Ga0496109_0003362 3300048912 Bacteria 13378
557 Ga0496109_0006910 3300048912 Bacteria 9574
558 Ga0496110_0000680 3300048913 Bacteria 23369
559 Ga0496110_0006120 3300048913 Bacteria 9487
560 Ga0496110_0007290 3300048913 Bacteria 8820
561 Ga0496110_0007689 3300048913 Bacteria 8624
562 Ga0496110_0031509 3300048913 Bacteria 4575
563 Ga0496110_0220782 3300048913 Bacteria 1723
564 Ga0496110_0430673 3300048913 Bacteria 1202
565 Ga0496111_0003892 3300048914 Bacteria 9346
566 Ga0496111_0139760 3300048914 Bacteria 1794
567 Ga0496111_0154559 3300048914 Bacteria 1702
568 Ga0496112_0000493 3300048915 Bacteria 26541
569 Ga0496112_0001820 3300048915 Bacteria 16767
570 Ga0496112_0002036 3300048915 Bacteria 16023
571 Ga0496112_0002501 3300048915 Bacteria 14826
572 Ga0496112_0108318 3300048915 Bacteria 2748
573 Ga0496112_0304351 3300048915 Bacteria 1539
574 Ga0496112_0460169 3300048915 Bacteria 1210
575 Ga0496112_0474126 3300048915 Bacteria 1188
576 Ga0496113_0000545 3300048916 Bacteria 18636
577 Ga0496113_0001267 3300048916 Bacteria 13921
578 Ga0496113_0001721 3300048916 Bacteria 12379
579 Ga0496113_0002505 3300048916 Bacteria 10700
580 Ga0496113_0010708 3300048916 Bacteria 6075
581 Ga0496113_0046635 3300048916 Bacteria 3217
582 Ga0496113_0324330 3300048916 Bacteria 1234
583 Ga0496114_0157944 3300048917 Bacteria 1970
584 Ga0496114_0202462 3300048917 Bacteria 1739
585 Ga0496115_0034545 3300048918 Bacteria 3996
586 Ga0501299_006559 3300049522 Bacteria 1829
587 Ga0501031_0060653 3300049568 Bacteria 2465
588 Ga0501031_0236546 3300049568 Bacteria 1188
589 Ga0501032_0241871 3300049569 Bacteria 1172
590 Ga0501033_0008151 3300049570 Bacteria 8114
591 Ga0501033_0239840 3300049570 Bacteria 1286
592 Ga0501034_0003992 3300049571 Bacteria 16573
593 Ga0501034_0177400 3300049571 Bacteria 2096
594 Ga0501034_0415302 3300049571 Bacteria 1267
595 Ga0501036_0139316 3300049572 Bacteria 2048
596 Ga0501036_0268978 3300049572 Bacteria 1427
597 Ga0501037_0104782 3300049573 Bacteria 2039
598 Ga0501037_0322550 3300049573 Bacteria 1069
599 Ga0501038_0030181 3300049574 Bacteria 4800
600 Ga0501038_0105546 3300049574 Bacteria 2340
601 Ga0501039_0007838 3300049575 Bacteria 8141
602 Ga0501040_0027999 3300049576 Bacteria 3797
603 Ga0501040_0156417 3300049576 Bacteria 1610
604 Ga0501040_0325354 3300049576 Bacteria 1100
605 Ga0501041_0057301 3300049577 Bacteria 2383
606 Ga0501041_0165831 3300049577 Bacteria 1382
607 Ga0501042_0062716 3300049578 Bacteria 2656
608 Ga0501042_0092831 3300049578 Bacteria 2167
609 Ga0501043_0155283 3300049579 Bacteria 1790
610 Ga0501046_0043225 3300049580 Bacteria 3588
611 Ga0501046_0092382 3300049580 Bacteria 2327
612 Ga0501046_0124294 3300049580 Bacteria 1961
613 Ga0501047_0190366 3300049581 Bacteria 1915
614 Ga0501048_0022319 3300049582 Bacteria 4631
615 Ga0501048_0041892 3300049582 Bacteria 3280
616 Ga0501048_0095099 3300049582 Bacteria 2101
617 Ga0501048_0256380 3300049582 Bacteria 1242
618 Ga0501067_0009075 3300049583 Bacteria 5506
619 Ga0501067_0018645 3300049583 Bacteria 3842
620 Ga0501068_0000875 3300049584 Bacteria 15701
621 Ga0501068_0140152 3300049584 Bacteria 1516
622 Ga0501069_0008829 3300049585 Bacteria 5310
623 Ga0501069_0052057 3300049585 Bacteria 2279
624 Ga0501070_0038564 3300049586 Bacteria 3986
625 Ga0501070_0044035 3300049586 Bacteria 3714
626 Ga0501071_0003829 3300049587 Bacteria 9465
627 Ga0501071_0024128 3300049587 Bacteria 4251
628 Ga0501071_0067085 3300049587 Bacteria 2609
629 Ga0501071_0152340 3300049587 Bacteria 1725
630 Ga0501071_0163378 3300049587 Bacteria 1665
631 Ga0501072_0000677 3300049588 Bacteria 24659
632 Ga0501072_0051789 3300049588 Bacteria 3232
633 Ga0501072_0094084 3300049588 Bacteria 2381
634 Ga0501072_0275295 3300049588 Bacteria 1339
635 Ga0501073_0004027 3300049589 Bacteria 11042
636 Ga0501073_0068891 3300049589 Bacteria 2466
637 Ga0501074_0001727 3300049590 Bacteria 14922
638 Ga0501074_0056835 3300049590 Bacteria 2819
639 Ga0501074_0064389 3300049590 Bacteria 2639
640 Ga0501074_0113127 3300049590 Bacteria 1942
641 Ga0501074_0338111 3300049590 Bacteria 1069
642 Ga0501075_0101821 3300049591 Bacteria 2181
643 Ga0501075_0107578 3300049591 Bacteria 2120
644 Ga0501075_0294473 3300049591 Bacteria 1236
645 Ga0501076_0005793 3300049592 Bacteria 8914
646 Ga0501076_0020626 3300049592 Bacteria 5045
647 Ga0501076_0061509 3300049592 Bacteria 2988
648 Ga0501076_0286696 3300049592 Bacteria 1349
649 Ga0501077_0000507 3300049593 Bacteria 23749
650 Ga0501077_0004550 3300049593 Bacteria 8431
651 Ga0501077_0071902 3300049593 Bacteria 2192
652 Ga0501209_041954 3300049656 Bacteria 1214
653 Ga0501079_0011338 3300049741 Bacteria 6801
654 Ga0501079_0040860 3300049741 Bacteria 3579
655 Ga0501079_0115010 3300049741 Bacteria 2091
656 Ga0501079_0187503 3300049741 Bacteria 1614
657 Ga0501080_0035276 3300049742 Bacteria 4669
658 Ga0501080_0057954 3300049742 Bacteria 3606
659 Ga0501080_0086950 3300049742 Bacteria 2904
660 Ga0501080_0177879 3300049742 Bacteria 1959
661 Ga0501081_0012763 3300049743 Bacteria 5527
662 Ga0501081_0090215 3300049743 Bacteria 2154
663 Ga0501081_0101806 3300049743 Bacteria 2031
664 Ga0501083_0010352 3300049744 Bacteria 6565
665 Ga0501083_0016588 3300049744 Bacteria 5151
666 Ga0501263_017765 3300049760 Bacteria 937
667 Ga0501267_003987 3300049764 Bacteria 1360
668 Ga0501270_011890 3300049767 Unclassified 1177
669 Ga0501273_005280 3300049770 Bacteria 1453
670 Ga0501275_006310 3300049772 Bacteria 1162
671 Ga0501283_015843 3300049779 Bacteria 1163
672 Ga0501035_0002480 3300049822 Bacteria 18029
673 Ga0501035_0272588 3300049822 Bacteria 1432
674 Ga0501035_0374128 3300049822 Bacteria 1189
675 Ga0501044_0009259 3300049823 Bacteria 10758
676 Ga0501045_0084618 3300049824 Bacteria 2340
677 nmdc:mga05p37_22076_c1 3300050507 Bacteria 7714
678 nmdc:mga05p37_220937_c1 3300050507 Bacteria 2286
679 nmdc:mga05p37_36609_c1 3300050507 Bacteria 6018
680 nmdc:mga05p37_531200_c1 3300050507 Bacteria 1343
681 nmdc:mga05p37_682628_c1 3300050507 Bacteria 1144
682 nmdc:mga05p37_703221_c1 3300050507 Bacteria 1122
683 nmdc:mga09592_152924_c1 3300050508 Bacteria 1991
684 nmdc:mga09592_240951_c1 3300050508 Bacteria 1567
685 nmdc:mga0qj67_330702_c1 3300050509 Bacteria 1233
686 nmdc:mga06r32_342507_c1 3300050510 Bacteria 1479
687 nmdc:mga06r32_4763_c1 3300050510 Bacteria 12199
688 nmdc:mga08y16_134346_c1 3300050511 Bacteria 2571
689 nmdc:mga08y16_36898_c1 3300050511 Bacteria 5132
690 nmdc:mga0n895_592839_c1 3300050512 Bacteria 1111
691 nmdc:mga0rr50_242565_c1 3300050513 Bacteria 1494
692 nmdc:mga0rr50_268386_c1 3300050513 Bacteria 1421
693 nmdc:mga08x19_3686_c1 3300050514 Bacteria 9123
694 nmdc:mga0a205_167279_c2 3300050515 Bacteria 1373
695 Ga0495612_0005520 3300053078 Bacteria 5227
696 Ga0495619_0080273 3300053085 Bacteria 2195
697 Ga0500628_000310 3300053129 Bacteria 9314
698 Ga0501084_0014011 3300054114 Bacteria 6637
699 Ga0501084_0021801 3300054114 Bacteria 5343
700 Ga0501084_0023412 3300054114 Bacteria 5154
701 Ga0501084_0104603 3300054114 Bacteria 2377
702 Ga0501084_0118068 3300054114 Bacteria 2230
703 Ga0501084_0144395 3300054114 Bacteria 2004
704 Ga0501084_0634264 3300054114 Bacteria 902
705 Ga0590071_001510 3300059421 Bacteria 6117
706 Ga0590071_031847 3300059421 Bacteria 1257
707 Ga0590074_014264 3300059423 Bacteria 1344
708 Ga0590075_010563 3300059424 Bacteria 2224
709 Ga0590075_036522 3300059424 Bacteria 1252
710 Ga0590077_002275 3300059426 Bacteria 4147
711 Ga0587114_016248 3300059655 Bacteria 995
712 Ga0501082_0044018 3300060353 Bacteria 3851
713 Ga0501082_0069643 3300060353 Bacteria 3029
714 Ga0501082_0163436 3300060353 Bacteria 1934
715 Ga0501082_0214280 3300060353 Bacteria 1675
716 Ga0530510_0105036 3300061734 Bacteria 2067
717 Ga0070671_100080836
718 rootL2_10175328
719 Ga0006781J51513_1016989
720 Ga0007429J51699_1015491
721 Ga0032354_1005271
722 Ga0006780_1009652
723 Ga0058863_10022371
724 Ga0058863_10032824
725 Ga0058861_10023093
726 Ga0058862_10029900
727 Ga0070658_10322226
728 Ga0070683_100034790
729 Ga0068869_100037651
730 Ga0070680_100003299
731 Ga0070680_100020856
732 Ga0070680_100022221
733 Ga0070680_100044538
734 Ga0070680_100078040
735 Ga0068868_100020234
736 Ga0070660_100008563
737 Ga0070691_10024995
738 Ga0070687_100059293
739 Ga0070661_100004479
740 Ga0070661_100100049
741 Ga0070692_10134519
742 Ga0070668_100029512
743 Ga0070668_100075243
744 Ga0070669_100039339
745 Ga0070675_100136738
746 Ga0070674_100034213
747 Ga0070659_100065929
748 Ga0070709_10026619
749 Ga0070709_10177401
750 Ga0070709_10263210
751 Ga0070714_100009907
752 Ga0070714_100024257
753 Ga0070713_100000613
754 Ga0070713_100189495
755 Ga0070713_100193991
756 Ga0070710_10143874
757 Ga0070711_100023214
758 Ga0070705_100022882
759 Ga0070705_100064500
760 Ga0070700_100023254
761 Ga0070700_100335170
762 Ga0070708_100111180
763 Ga0070708_100133701
764 Ga0070663_100169887
765 Ga0070662_100001133
766 Ga0070681_10003599
767 Ga0070681_10009235
768 Ga0070681_10074960
769 Ga0070681_10111442
770 Ga0070681_10204204
771 Ga0070685_10028556
772 Ga0070706_100151760
773 Ga0070707_100015201
774 Ga0070707_100048292
775 Ga0070707_100170417
776 Ga0070707_100220492
777 Ga0070698_100006957
778 Ga0070698_100021368
779 Ga0070698_100055578
780 Ga0070698_100180162
781 Ga0070698_100408001
782 Ga0070699_100002420
783 Ga0070699_100005787
784 Ga0070699_100018809
785 Ga0070699_100046366
786 Ga0070699_100068582
787 Ga0070679_100009001
788 Ga0070679_100016143
789 Ga0070679_100025375
790 Ga0070679_100030573
791 Ga0070679_100042693
792 Ga0070679_100053122
793 Ga0070679_100107811
794 Ga0070679_100119845
795 Ga0070679_100233696
796 Ga0070684_100073520
797 Ga0070697_100002997
798 Ga0070697_100207150
799 Ga0068853_100002137
800 Ga0068853_100125723
801 Ga0070672_100091882
802 Ga0070686_100000019
803 Ga0070695_100190968
804 Ga0070696_100006350
805 Ga0070696_100011766
806 Ga0070696_100041317
807 Ga0070696_100044477
808 Ga0070693_100003492
809 Ga0070693_100186870
810 Ga0070693_100225670
811 Ga0070693_100299348
812 Ga0070704_100080644
813 Ga0068855_100034245
814 Ga0068855_100042472
815 Ga0068855_100115730
816 Ga0068855_100123337
817 Ga0070664_100105206
818 Ga0068857_100021177
819 Ga0068857_100132001
820 Ga0068854_100003430
821 Ga0068854_100018423
822 Ga0068856_100054706
823 Ga0068856_100111745
824 Ga0068856_100246352
825 Ga0068856_100297732
826 Ga0068852_100040836
827 Ga0068852_100087338
828 Ga0068859_100113319
829 Ga0068859_100164192
830 Ga0068864_100010117
831 Ga0068866_10089826
832 Ga0068862_100032596
833 Ga0068862_100264960
834 Ga0081455_10034468
835 Ga0070717_10029999
836 Ga0070717_10189265
837 Ga0070712_100049292
838 Ga0070712_100146362
839 Ga0075428_100017622
840 Ga0075431_100001611
841 Ga0075431_100009633
842 Ga0075431_100078878
843 Ga0075431_100474662
844 Ga0075433_10051174
845 Ga0075433_10131388
846 Ga0075434_100552840
847 Ga0075429_100245467
848 Ga0068865_100007947
849 Ga0068865_100045084
850 Ga0075436_100009117
851 Ga0075436_100041779
852 Ga0075436_100070748
853 Ga0097620_100113316
854 Ga0097620_100164194
855 Ga0105240_10012239
856 Ga0105240_10108857
857 Ga0105240_10210411
858 Ga0105240_10224427
859 Ga0105240_10360040
860 Ga0111539_10047475
861 Ga0111539_10222541
862 Ga0111539_10411406
863 Ga0105245_10202500
864 Ga0114129_10000967
865 Ga0114129_10023362
866 Ga0114129_10096484
867 Ga0114129_10186444
868 Ga0114129_10193434
869 Ga0114129_10243018
870 Ga0114129_10462578
871 Ga0114129_10714475
872 Ga0105241_10081071
873 Ga0105241_10556721
874 Ga0105242_10284581
875 Ga0105248_10230889
876 Ga0105248_10457032
877 Ga0105237_10064590
878 Ga0105238_10000164
879 Ga0105238_10019775
880 Ga0105238_10038888
881 Ga0105238_10094898
882 Ga0105249_10000078
883 Ga0105239_10060015
884 Ga0105246_10028562
885 Ga0157373_10032278
886 Ga0157373_10092671
887 Ga0157373_10129869
888 Ga0157370_10070657
889 Ga0157370_10074430
890 Ga0157370_10074628
891 Ga0157369_10071321
892 Ga0157369_10142577
893 Ga0157369_10153503
894 Ga0157369_10256337
895 Ga0157378_10021281
896 Ga0157372_10016786
897 Ga0157372_10030513
898 Ga0157372_10067617
899 Ga0157372_10145451
900 Ga0157372_10174590
901 Ga0157372_10195190
902 Ga0157372_10447805
903 Ga0157375_10517902
904 Ga0163163_10120964
905 Ga0157380_10098028
906 Ga0182008_10005341
907 Ga0157379_10098657
908 Ga0157376_10197635
909 Ga0182007_10055586
910 Ga0197907_10079591
911 Ga0206356_10918997
912 Ga0206356_11226634
913 Ga0206351_10291053
914 Ga0206352_10650051
915 Ga0206352_11112771
916 Ga0206354_10583953
917 Ga0213875_10012597
918 Ga0224712_10066279
919 Ga0224712_10122937
920 Ga0207653_10024341
921 Ga0207682_10024049
922 Ga0207692_10133082
923 Ga0207642_10150584
924 Ga0207699_10052703
925 Ga0207699_10063370
926 Ga0207699_10233425
927 Ga0207699_10234813
928 Ga0207645_10005788
929 Ga0207645_10090623
930 Ga0207643_10069275
931 Ga0207684_10320315
932 Ga0207654_10350596
933 Ga0207707_10001068
934 Ga0207707_10004116
935 Ga0207707_10010041
936 Ga0207707_10019109
937 Ga0207707_10026624
938 Ga0207707_10035867
939 Ga0207707_10047570
940 Ga0207707_10055509
941 Ga0207707_10065785
942 Ga0207707_10075682
943 Ga0207707_10227980
944 Ga0207695_10038557
945 Ga0207695_10050641
946 Ga0207695_10052732
947 Ga0207695_10057259
948 Ga0207695_10115626
949 Ga0207671_10089645
950 Ga0207693_10028182
951 Ga0207693_10054026
952 Ga0207663_10036989
953 Ga0207660_10005160
954 Ga0207660_10019495
955 Ga0207660_10038716
956 Ga0207660_10040206
957 Ga0207660_10059744
958 Ga0207660_10081958
959 Ga0207660_10166263
960 Ga0207660_10252562
961 Ga0207660_10309237
962 Ga0207662_10010521
963 Ga0207662_10078069
964 Ga0207657_10009377
965 Ga0207657_10068311
966 Ga0207649_10033125
967 Ga0207649_10073369
968 Ga0207652_10007505
969 Ga0207652_10017555
970 Ga0207652_10065442
971 Ga0207652_10066578
972 Ga0207652_10082843
973 Ga0207652_10088984
974 Ga0207652_10268360
975 Ga0207652_10350942
976 Ga0207646_10087135
977 Ga0207646_10093910
978 Ga0207681_10158040
979 Ga0207694_10000071
980 Ga0207694_10042329
981 Ga0207687_10172676
982 Ga0207700_10000550
983 Ga0207700_10163651
984 Ga0207700_10263092
985 Ga0207664_10020097
986 Ga0207664_10073090
987 Ga0207664_10134238
988 Ga0207664_10177287
989 Ga0207644_10028695
990 Ga0207690_10083792
991 Ga0207706_10001190
992 Ga0207706_10006009
993 Ga0207706_10060034
994 Ga0207669_10069134
995 Ga0207704_10125274
996 Ga0207665_10338851
997 Ga0207691_10223203
998 Ga0207691_10262618
999 Ga0207689_10153684
1000 Ga0207661_10105296
1001 Ga0207661_10485758
1002 Ga0207679_10303499
1003 Ga0207667_10079507
1004 Ga0207667_10134740
1005 Ga0207667_10417086
1006 Ga0207667_10697746
1007 Ga0207651_10330121
1008 Ga0207712_10000568
1009 Ga0207712_10001653
1010 Ga0207712_10015750
1011 Ga0207712_10131732
1012 Ga0207668_10002220
1013 Ga0207668_10053358
1014 Ga0207668_10339859
1015 Ga0207640_10223179
1016 Ga0207639_10005231
1017 Ga0207639_10176422
1018 Ga0207639_10427258
1019 Ga0207639_10582342
1020 Ga0207678_10105611
1021 Ga0207678_10357467
1022 Ga0207708_10011594
1023 Ga0207708_10104325
1024 Ga0207702_10107317
1025 Ga0207641_10062106
1026 Ga0207676_10011297
1027 Ga0207676_10662311
1028 Ga0207674_10031277
1029 Ga0207674_10153962
1030 Ga0207675_100060689
1031 Ga0207698_10019017
1032 Ga0207698_10248064
1033 Ga0209970_1006447
1034 Ga0268266_10120065
1035 Ga0268265_10107946
1036 Ga0268265_10342081
1037 Ga0268265_10358620
1038 Ga0268265_10455750
1039 Ga0307408_100020409
1040 Ga0307408_100042937
1041 Ga0307408_100057995
1042 Ga0307408_100147447
1043 Ga0307408_100196828
1044 Ga0307408_100286951
1045 Ga0307408_100316817
1046 Ga0307408_100338018
1047 Ga0316579_10001200
1048 Ga0316579_10005340
1049 Ga0316576_10001914
1050 Ga0316578_10000302
1051 Ga0316578_10001720
1052 Ga0307405_10088128
1053 Ga0307405_10136560
1054 Ga0307405_10138705
1055 Ga0307405_10144319
1056 Ga0307405_10266073
1057 Ga0316577_10000090
1058 Ga0316577_10000428
1059 Ga0316577_10000433
1060 Ga0316577_10047326
1061 Ga0307413_10004893
1062 Ga0307413_10006194
1063 Ga0307413_10041512
1064 Ga0307413_10046211
1065 Ga0307413_10076802
1066 Ga0307413_10158454
1067 Ga0307413_10219860
1068 Ga0307413_10504153
1069 Ga0307410_10002094
1070 Ga0307410_10004773
1071 Ga0307410_10009908
1072 Ga0307410_10015068
1073 Ga0307410_10124567
1074 Ga0307410_10134156
1075 Ga0307410_10153427
1076 Ga0307406_10016863
1077 Ga0307406_10016886
1078 Ga0307406_10022399
1079 Ga0307406_10024498
1080 Ga0307406_10051812
1081 Ga0307406_10100945
1082 Ga0307406_10123123
1083 Ga0307406_10145957
1084 Ga0307406_10149495
1085 Ga0307406_10167551
1086 Ga0307406_10317280
1087 Ga0307407_10001982
1088 Ga0307407_10016357
1089 Ga0307407_10073607
1090 Ga0307407_10092034
1091 Ga0307412_10028500
1092 Ga0307409_100011240
1093 Ga0307409_100018209
1094 Ga0307409_100050329
1095 Ga0307409_100051075
1096 Ga0307409_100060748
1097 Ga0307409_100109947
1098 Ga0307409_100128521
1099 Ga0307409_100142773
1100 Ga0307409_100243494
1101 Ga0307409_100360270
1102 Ga0307409_100398947
1103 Ga0307409_100427621
1104 Ga0307416_100006042
1105 Ga0307416_100031463
1106 Ga0307416_100039532
1107 Ga0307416_100047727
1108 Ga0307416_100050439
1109 Ga0307416_100057734
1110 Ga0307416_100081465
1111 Ga0307416_100104301
1112 Ga0307416_100109755
1113 Ga0307416_100128810
1114 Ga0307416_100140672
1115 Ga0307416_100189634
1116 Ga0307416_100206881
1117 Ga0307414_10048098
1118 Ga0307414_10144470
1119 Ga0307414_10222243
1120 Ga0307414_10248496
1121 Ga0307414_10287734
1122 Ga0307414_10342045
1123 Ga0307411_10018555
1124 Ga0307411_10023188
1125 Ga0307411_10023882
1126 Ga0307411_10040900
1127 Ga0307411_10042560
1128 Ga0307411_10049308
1129 Ga0307411_10131825
1130 Ga0307411_10556348
1131 Ga0307415_100008314
1132 Ga0307415_100076532
1133 Ga0307415_100077642
1134 Ga0307415_100116787
1135 Ga0316580_10010301
1136 Ga0316593_10023466
1137 Ga0316593_10098836
1138 Ga0316596_1041130
1139 Ga0373959_0000280
1140 Ga0373959_0033679
1141 Ga0373926_0005757
1142 Ga0373940_0045215
1143 Ga0373949_0023386
1144 Ga0373923_0002279
1145 Ga0373936_0019630
1146 Ga0373939_0046446
1147 Ga0373941_0028664
1148 Ga0373953_0098519
1149 Ga0373960_0069517
1150 Ga0373946_0014579
1151 Ga0373955_0006299
1152 Ga0316574_0013497
1153 Ga0316574_0047496
1154 Ga0373924_0005697
1155 Ga0373935_0011597
1156 Ga0373927_0005620
1157 Ga0373933_0000768
1158 Ga0373947_0001405
1159 Ga0373937_0000855
1160 Ga0316582_0009340
1161 Ga0316582_0078079
1162 Ga0316584_0002489
1163 Ga0316584_0022618
1164 Ga0316584_0078657
1165 Ga0373925_0003422
1166 Ga0373925_0471797
1167 Ga0395899_0010287
1168 Ga0395900_0340034
1169 Ga0395905_0047462
1170 Ga0395905_0063051
1171 Ga0316581_0007861
1172 Ga0436364_0933811
1173 Ga0395901_0010063
1174 Ga0439439_0032883
1175 Ga0450910_003147
1176 Ga0439446_0018507
1177 Ga0439446_0042451
1178 Ga0439434_0064866
1179 Ga0451577_0006854
1180 Ga0451577_0072129
1181 Ga0466969_0036155
1182 Ga0453683_0051172
1183 Ga0466965_0099299
1184 Ga0466961_0001673
1185 Ga0466964_0046344
1186 Ga0453684_0372976
1187 Ga0466957_0236018
1188 Ga0466959_0056988
1189 Ga0451576_0090888
1190 Ga0466958_0067824
1191 Ga0466967_0148924
1192 Ga0495592_0000760
1193 Ga0495603_0054779
1194 Ga0495629_0007081
1195 Ga0495651_0000942
1196 Ga0495653_0000868
1197 Ga0495580_0003627
1198 Ga0495582_0002848
1199 Ga0495639_0000089
1200 Ga0495594_0060042
1201 Ga0495594_0135623
1202 Ga0495608_0003620
1203 Ga0495618_0074879
1204 Ga0495628_0011454
1205 Ga0495630_0007153
1206 Ga0495630_0101208
1207 Ga0495643_0000043
1208 Ga0495652_0041851
1209 Ga0495665_0000272
1210 Ga0495665_0169513
1211 Ga0495586_0006720
1212 Ga0495586_0102538
1213 Ga0495587_0000827
1214 Ga0495645_0000703
1215 Ga0495622_0057344
1216 Ga0495667_0049016
1217 Ga0495634_0105882
1218 Ga0495635_0000566
1219 Ga0495635_0225692
1220 Ga0495588_0000396
1221 Ga0495657_0000787
1222 Ga0495599_0007261
1223 Ga0495623_0000572
1224 Ga0495646_0055510
1225 Ga0495658_0002152
1226 Ga0495669_0050225
1227 Ga0495613_0024107
1228 Ga0495600_0000461
1229 Ga0495581_0001927
1230 Ga0495604_0000184
1231 Ga0495674_0043261
1232 Ga0495680_0010446
1233 Ga0495675_0003056
1234 Ga0495684_0025437
1235 Ga0495593_0000172
1236 Ga0495602_0005823
1237 Ga0495614_0000310
1238 Ga0496100_0034983
1239 Ga0496101_0081683
1240 Ga0496101_0090154
1241 Ga0496101_0183648
1242 Ga0496101_0193555
1243 Ga0496102_0007597
1244 Ga0496102_0014620
1245 Ga0496102_0127451
1246 Ga0496102_0179173
1247 Ga0496103_0056535
1248 Ga0496104_0008281
1249 Ga0496104_0045211
1250 Ga0496104_0060504
1251 Ga0496104_0084934
1252 Ga0496104_0497292
1253 Ga0496105_0063218
1254 Ga0496106_0017251
1255 Ga0496106_0135774
1256 Ga0496106_0137326
1257 Ga0496106_0141049
1258 Ga0496106_0315097
1259 Ga0496106_0419049
1260 Ga0496107_0060353
1261 Ga0496107_0307356
1262 Ga0496107_0400662
1263 Ga0496108_0000554
1264 Ga0496108_0000761
1265 Ga0496108_0040854
1266 Ga0496108_0094666
1267 Ga0496108_0096945
1268 Ga0496108_0100678
1269 Ga0496109_0000982
1270 Ga0496109_0002092
1271 Ga0496109_0002112
1272 Ga0496109_0003362
1273 Ga0496109_0006910
1274 Ga0496110_0000680
1275 Ga0496110_0006120
1276 Ga0496110_0007290
1277 Ga0496110_0007689
1278 Ga0496110_0031509
1279 Ga0496110_0220782
1280 Ga0496110_0430673
1281 Ga0496111_0003892
1282 Ga0496111_0139760
1283 Ga0496111_0154559
1284 Ga0496112_0000493
1285 Ga0496112_0001820
1286 Ga0496112_0002036
1287 Ga0496112_0002501
1288 Ga0496112_0108318
1289 Ga0496112_0304351
1290 Ga0496112_0460169
1291 Ga0496112_0474126
1292 Ga0496113_0000545
1293 Ga0496113_0001267
1294 Ga0496113_0001721
1295 Ga0496113_0002505
1296 Ga0496113_0010708
1297 Ga0496113_0046635
1298 Ga0496113_0324330
1299 Ga0496114_0157944
1300 Ga0496114_0202462
1301 Ga0496115_0034545
1302 Ga0501299_006559
1303 Ga0501031_0060653
1304 Ga0501031_0236546
1305 Ga0501032_0241871
1306 Ga0501033_0008151
1307 Ga0501033_0239840
1308 Ga0501034_0003992
1309 Ga0501034_0177400
1310 Ga0501034_0415302
1311 Ga0501036_0139316
1312 Ga0501036_0268978
1313 Ga0501037_0104782
1314 Ga0501037_0322550
1315 Ga0501038_0030181
1316 Ga0501038_0105546
1317 Ga0501039_0007838
1318 Ga0501040_0027999
1319 Ga0501040_0156417
1320 Ga0501040_0325354
1321 Ga0501041_0057301
1322 Ga0501041_0165831
1323 Ga0501042_0062716
1324 Ga0501042_0092831
1325 Ga0501043_0155283
1326 Ga0501046_0043225
1327 Ga0501046_0092382
1328 Ga0501046_0124294
1329 Ga0501047_0190366
1330 Ga0501048_0022319
1331 Ga0501048_0041892
1332 Ga0501048_0095099
1333 Ga0501048_0256380
1334 Ga0501067_0009075
1335 Ga0501067_0018645
1336 Ga0501068_0000875
1337 Ga0501068_0140152
1338 Ga0501069_0008829
1339 Ga0501069_0052057
1340 Ga0501070_0038564
1341 Ga0501070_0044035
1342 Ga0501071_0003829
1343 Ga0501071_0024128
1344 Ga0501071_0067085
1345 Ga0501071_0152340
1346 Ga0501071_0163378
1347 Ga0501072_0000677
1348 Ga0501072_0051789
1349 Ga0501072_0094084
1350 Ga0501072_0275295
1351 Ga0501073_0004027
1352 Ga0501073_0068891
1353 Ga0501074_0001727
1354 Ga0501074_0056835
1355 Ga0501074_0064389
1356 Ga0501074_0113127
1357 Ga0501074_0338111
1358 Ga0501075_0101821
1359 Ga0501075_0107578
1360 Ga0501075_0294473
1361 Ga0501076_0005793
1362 Ga0501076_0020626
1363 Ga0501076_0061509
1364 Ga0501076_0286696
1365 Ga0501077_0000507
1366 Ga0501077_0004550
1367 Ga0501077_0071902
1368 Ga0501209_041954
1369 Ga0501079_0011338
1370 Ga0501079_0040860
1371 Ga0501079_0115010
1372 Ga0501079_0187503
1373 Ga0501080_0035276
1374 Ga0501080_0057954
1375 Ga0501080_0086950
1376 Ga0501080_0177879
1377 Ga0501081_0012763
1378 Ga0501081_0090215
1379 Ga0501081_0101806
1380 Ga0501083_0010352
1381 Ga0501083_0016588
1382 Ga0501263_017765
1383 Ga0501267_003987
1384 Ga0501270_011890
1385 Ga0501273_005280
1386 Ga0501275_006310
1387 Ga0501283_015843
1388 Ga0501035_0002480
1389 Ga0501035_0272588
1390 Ga0501035_0374128
1391 Ga0501044_0009259
1392 Ga0501045_0084618
1393 nmdc:mga05p37_22076_c1
1394 nmdc:mga05p37_220937_c1
1395 nmdc:mga05p37_36609_c1
1396 nmdc:mga05p37_531200_c1
1397 nmdc:mga05p37_682628_c1
1398 nmdc:mga05p37_703221_c1
1399 nmdc:mga09592_152924_c1
1400 nmdc:mga09592_240951_c1
1401 nmdc:mga0qj67_330702_c1
1402 nmdc:mga06r32_342507_c1
1403 nmdc:mga06r32_4763_c1
1404 nmdc:mga08y16_134346_c1
1405 nmdc:mga08y16_36898_c1
1406 nmdc:mga0n895_592839_c1
1407 nmdc:mga0rr50_242565_c1
1408 nmdc:mga0rr50_268386_c1
1409 nmdc:mga08x19_3686_c1
1410 nmdc:mga0a205_167279_c2
1411 Ga0495612_0005520
1412 Ga0495619_0080273
1413 Ga0500628_000310
1414 Ga0501084_0014011
1415 Ga0501084_0021801
1416 Ga0501084_0023412
1417 Ga0501084_0104603
1418 Ga0501084_0118068
1419 Ga0501084_0144395
1420 Ga0501084_0634264
1421 Ga0590071_001510
1422 Ga0590071_031847
1423 Ga0590074_014264
1424 Ga0590075_010563
1425 Ga0590075_036522
1426 Ga0590077_002275
1427 Ga0587114_016248
1428 Ga0501082_0044018
1429 Ga0501082_0069643
1430 Ga0501082_0163436
1431 Ga0501082_0214280
1432 Ga0530510_0105036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

287

340

0.99

PF04542

Sigma70_r2

Sigma-70 region 2

119

189

0.98

PF00140

Sigma70_r1_2

Sigma-70 factor, region 1.2

81

114

0.97

PF04539

Sigma70_r3

Sigma-70 region 3

199

276

0.88

Map