F476998

General Info

Members Datasets Scaffolds Average Seq Length
715 326 704 237

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0377892|Ga0373927_0377892_46_879
Length 277
Sequence MLTIALSLNRPTTDMLVAHAVVQASPPAAIIIATVFFLRDIMRPVLVFRHSPTEGPGYFTTFLDRHGIPWKLVRIDAGDSVPENLNGASGVCLMGGPMSVNDDLPWIPPLLALIRQAVASDIPVIGHCLGGQLMSKALGGTVGANPVKEIGWGDVRITDADAARSWLGNTTQPMLAFHWHGETFSLPPGATRLLDSAFCANQAYVLNDRHIGMQCHVEMTPELIASWCDNGAAEIAVSDSPGVQSPDAIQADLPTRTARLHELADKIYSRWIQGLRK

Samples

Sample ID Description Type Environment
1 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
2 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
3 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
4 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
5 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
6 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
7 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
8 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
9 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
10 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
186 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
196 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
197 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
198 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
217 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
218 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
226 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
227 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
228 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
236 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
237 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
238 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
252 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
270 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
271 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
306 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
307 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
308 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
309 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
314 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
315 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
316 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
317 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
318 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
319 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
320 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
321 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
322 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
323 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
326 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 0
Isolates 1.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 0
Rhizoplane 1.82
Rhizosphere 91.89
Stem 0
Stem Tuber 0
Unclassified 2.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10193919 3300003322 Bacteria 1154
2 Ga0070658_10095822 3300005327 Bacteria 2450
3 Ga0070658_10203122 3300005327 Bacteria 1672
4 Ga0070658_10480851 3300005327 Bacteria 1072
5 Ga0070676_10000988 3300005328 Bacteria 14116
6 Ga0070676_10032638 3300005328 Bacteria 2984
7 Ga0070676_10059241 3300005328 Bacteria 2271
8 Ga0070676_10197125 3300005328 Bacteria 1318
9 Ga0070690_100223598 3300005330 Bacteria 1320
10 Ga0070670_100011047 3300005331 Bacteria 7714
11 Ga0070670_100027074 3300005331 Bacteria 4931
12 Ga0070670_100029619 3300005331 Bacteria 4713
13 Ga0070670_100128779 3300005331 Bacteria 2185
14 Ga0070670_100234413 3300005331 Bacteria 1597
15 Ga0070670_100808522 3300005331 Bacteria 847
16 Ga0070677_10041781 3300005333 Bacteria 1812
17 Ga0070677_10102207 3300005333 Bacteria 1266
18 Ga0068869_100005217 3300005334 Bacteria 8157
19 Ga0068869_100007185 3300005334 Bacteria 7099
20 Ga0070666_10001990 3300005335 Bacteria 12436
21 Ga0070666_10081007 3300005335 Bacteria 2219
22 Ga0070666_10546603 3300005335 Bacteria 842
23 Ga0070680_100459243 3300005336 Bacteria 1088
24 Ga0070680_100651511 3300005336 Bacteria 905
25 Ga0068868_100007819 3300005338 Bacteria 7633
26 Ga0068868_100052336 3300005338 Bacteria 3214
27 Ga0068868_100351500 3300005338 Bacteria 1262
28 Ga0070660_100001840 3300005339 Bacteria 14582
29 Ga0070689_100006107 3300005340 Bacteria 8301
30 Ga0070689_100030639 3300005340 Bacteria 4084
31 Ga0070689_100031394 3300005340 Bacteria 4036
32 Ga0070689_100057351 3300005340 Bacteria 3022
33 Ga0070689_100107539 3300005340 Bacteria 2214
34 Ga0070687_100075003 3300005343 Bacteria 1828
35 Ga0070661_100007211 3300005344 Bacteria 7662
36 Ga0070661_100269692 3300005344 Bacteria 1318
37 Ga0070692_10090688 3300005345 Bacteria 1661
38 Ga0070668_100007290 3300005347 Bacteria 8205
39 Ga0070668_100163744 3300005347 Bacteria 1806
40 Ga0070668_100393515 3300005347 Bacteria 1182
41 Ga0070669_100001481 3300005353 Bacteria 16988
42 Ga0070669_100151055 3300005353 Bacteria 1798
43 Ga0070669_100177476 3300005353 Bacteria 1664
44 Ga0070675_100003903 3300005354 Bacteria 11300
45 Ga0070675_100003952 3300005354 Bacteria 11238
46 Ga0070675_100016457 3300005354 Bacteria 5870
47 Ga0070675_100163285 3300005354 Bacteria 1917
48 Ga0070671_100001117 3300005355 Bacteria 19906
49 Ga0070671_100017774 3300005355 Bacteria 5766
50 Ga0070671_100095852 3300005355 Bacteria 2487
51 Ga0070671_100151526 3300005355 Bacteria 1958
52 Ga0070674_100028183 3300005356 Bacteria 3687
53 Ga0070674_100275437 3300005356 Bacteria 1332
54 Ga0070673_100026652 3300005364 Bacteria 4272
55 Ga0070673_100034104 3300005364 Bacteria 3848
56 Ga0070673_100036746 3300005364 Bacteria 3726
57 Ga0070673_100102030 3300005364 Bacteria 2365
58 Ga0070673_100360607 3300005364 Bacteria 1292
59 Ga0070673_100385599 3300005364 Bacteria 1250
60 Ga0070688_100105802 3300005365 Bacteria 1863
61 Ga0070688_100147238 3300005365 Bacteria 1606
62 Ga0070659_100003840 3300005366 Bacteria 10713
63 Ga0070659_100206080 3300005366 Bacteria 1620
64 Ga0070659_100488884 3300005366 Bacteria 1048
65 Ga0070667_100005528 3300005367 Bacteria 10550
66 Ga0070667_100006553 3300005367 Bacteria 9678
67 Ga0070667_100087072 3300005367 Bacteria 2681
68 Ga0070667_100138879 3300005367 Bacteria 2126
69 Ga0070667_100165886 3300005367 Bacteria 1948
70 Ga0070667_100242661 3300005367 Bacteria 1609
71 Ga0070667_100501969 3300005367 Bacteria 1112
72 Ga0070667_100510692 3300005367 Bacteria 1102
73 Ga0070709_10064574 3300005434 Bacteria 2341
74 Ga0070709_10094017 3300005434 Bacteria 1983
75 Ga0070709_10356203 3300005434 Unclassified 1082
76 Ga0070705_100014585 3300005440 Bacteria 4046
77 Ga0070700_100028894 3300005441 Bacteria 3303
78 Ga0070700_100105481 3300005441 Bacteria 1864
79 Ga0070694_100137251 3300005444 Bacteria 1773
80 Ga0070708_100122759 3300005445 Bacteria 2398
81 Ga0070663_100100178 3300005455 Bacteria 2161
82 Ga0070678_100001068 3300005456 Bacteria 14327
83 Ga0070678_100074216 3300005456 Bacteria 2555
84 Ga0070678_100249834 3300005456 Bacteria 1487
85 Ga0070662_100000568 3300005457 Bacteria 22525
86 Ga0070662_100026453 3300005457 Bacteria 4019
87 Ga0070681_10022463 3300005458 Bacteria 6334
88 Ga0070681_10308802 3300005458 Bacteria 1491
89 Ga0068867_100008617 3300005459 Bacteria 7201
90 Ga0070685_10090259 3300005466 Bacteria 1853
91 Ga0070706_100002403 3300005467 Bacteria 18889
92 Ga0070679_100036286 3300005530 Bacteria 4892
93 Ga0070679_100136476 3300005530 Bacteria 2434
94 Ga0070679_100630482 3300005530 Bacteria 1015
95 Ga0068853_100007620 3300005539 Bacteria 8673
96 Ga0068853_100037771 3300005539 Bacteria 4111
97 Ga0068853_100121579 3300005539 Bacteria 2330
98 Ga0068853_100141253 3300005539 Bacteria 2162
99 Ga0068853_100577885 3300005539 Bacteria 1066
100 Ga0070672_100002490 3300005543 Bacteria 11720
101 Ga0070672_100018765 3300005543 Bacteria 5009
102 Ga0070672_100020253 3300005543 Bacteria 4848
103 Ga0070672_100030145 3300005543 Bacteria 4072
104 Ga0070672_100040170 3300005543 Bacteria 3587
105 Ga0070672_100057707 3300005543 Bacteria 3048
106 Ga0070686_100491366 3300005544 Bacteria 951
107 Ga0070696_100483194 3300005546 Bacteria 983
108 Ga0070693_100002437 3300005547 Bacteria 8566
109 Ga0070693_100031171 3300005547 Bacteria 2920
110 Ga0070693_100243903 3300005547 Bacteria 1188
111 Ga0070693_100418612 3300005547 Bacteria 933
112 Ga0070665_100015080 3300005548 Bacteria 7759
113 Ga0070665_100075505 3300005548 Bacteria 3377
114 Ga0070665_100148849 3300005548 Bacteria 2344
115 Ga0070704_100046097 3300005549 Bacteria 3037
116 Ga0070704_100155304 3300005549 Bacteria 1804
117 Ga0068855_100000634 3300005563 Bacteria 42949
118 Ga0068855_100013140 3300005563 Bacteria 9985
119 Ga0068855_100025708 3300005563 Bacteria 7041
120 Ga0068855_100043030 3300005563 Bacteria 5351
121 Ga0070664_100000284 3300005564 Bacteria 36685
122 Ga0070664_100021720 3300005564 Bacteria 5293
123 Ga0068857_100077453 3300005577 Bacteria 2967
124 Ga0068857_100375847 3300005577 Bacteria 1319
125 Ga0068857_100631053 3300005577 Bacteria 1014
126 Ga0068854_100049038 3300005578 Bacteria 3015
127 Ga0068856_100002570 3300005614 Bacteria 18696
128 Ga0070702_100125329 3300005615 Bacteria 1614
129 Ga0068852_100002800 3300005616 Bacteria 12084
130 Ga0068852_100009134 3300005616 Bacteria 7341
131 Ga0068852_100138341 3300005616 Bacteria 2251
132 Ga0068859_100015900 3300005617 Bacteria 7563
133 Ga0068859_100051729 3300005617 Bacteria 4130
134 Ga0068859_100073533 3300005617 Bacteria 3456
135 Ga0068859_100085712 3300005617 Bacteria 3196
136 Ga0068859_100152412 3300005617 Bacteria 2387
137 Ga0068859_100276118 3300005617 Bacteria 1773
138 Ga0068859_100445009 3300005617 Bacteria 1392
139 Ga0068859_100449046 3300005617 Bacteria 1385
140 Ga0068864_100007878 3300005618 Bacteria 8779
141 Ga0068864_100129114 3300005618 Bacteria 2268
142 Ga0068864_100185590 3300005618 Bacteria 1903
143 Ga0068864_100234601 3300005618 Bacteria 1698
144 Ga0068864_100260593 3300005618 Bacteria 1613
145 Ga0068864_100362969 3300005618 Bacteria 1369
146 Ga0068864_100378721 3300005618 Bacteria 1340
147 Ga0068864_100634801 3300005618 Bacteria 1039
148 Ga0068866_10033452 3300005718 Bacteria 2495
149 Ga0068861_100027161 3300005719 Bacteria 4167
150 Ga0068861_100055829 3300005719 Bacteria 3013
151 Ga0068861_100200240 3300005719 Bacteria 1675
152 Ga0068851_10010798 3300005834 Bacteria 4270
153 Ga0068851_10091206 3300005834 Bacteria 1604
154 Ga0068863_100005626 3300005841 Bacteria 12313
155 Ga0068863_100020743 3300005841 Bacteria 6276
156 Ga0068863_100096665 3300005841 Bacteria 2804
157 Ga0068863_100172673 3300005841 Bacteria 2074
158 Ga0068863_100318451 3300005841 Bacteria 1510
159 Ga0068863_100531903 3300005841 Bacteria 1159
160 Ga0068858_100001792 3300005842 Bacteria 21909
161 Ga0068858_100037909 3300005842 Bacteria 4471
162 Ga0068858_100085205 3300005842 Bacteria 2939
163 Ga0068858_100089656 3300005842 Bacteria 2861
164 Ga0068858_100377723 3300005842 Bacteria 1360
165 Ga0068858_100458323 3300005842 Unclassified 1229
166 Ga0068858_100806786 3300005842 Bacteria 916
167 Ga0068860_100001537 3300005843 Bacteria 24868
168 Ga0068860_100006790 3300005843 Bacteria 11470
169 Ga0068860_100022341 3300005843 Bacteria 6120
170 Ga0068860_100121064 3300005843 Bacteria 2506
171 Ga0068860_100281938 3300005843 Bacteria 1624
172 Ga0068860_100348405 3300005843 Bacteria 1457
173 Ga0068860_100534128 3300005843 Bacteria 1173
174 Ga0068862_100086607 3300005844 Bacteria 2723
175 Ga0068862_100493706 3300005844 Bacteria 1161
176 Ga0068862_100830913 3300005844 Bacteria 904
177 Ga0081539_10026601 3300005985 Bacteria 3686
178 Ga0075368_10096022 3300006042 Bacteria 1215
179 Ga0075364_10004928 3300006051 Bacteria 7734
180 Ga0075432_10012877 3300006058 Bacteria 2843
181 Ga0075369_10000707 3300006186 Bacteria 10736
182 Ga0075369_10051633 3300006186 Bacteria 1780
183 Ga0075366_10009565 3300006195 Bacteria 5415
184 Ga0075366_10097921 3300006195 Bacteria 1759
185 Ga0097621_100004956 3300006237 Bacteria 9334
186 Ga0097621_100030965 3300006237 Bacteria 4241
187 Ga0097621_100074566 3300006237 Bacteria 2810
188 Ga0097621_100103720 3300006237 Bacteria 2396
189 Ga0097621_100183660 3300006237 Bacteria 1808
190 Ga0097621_100243257 3300006237 Bacteria 1573
191 Ga0097621_100312364 3300006237 Unclassified 1390
192 Ga0097621_100460720 3300006237 Bacteria 1147
193 Ga0097621_100532770 3300006237 Bacteria 1067
194 Ga0075370_10009479 3300006353 Bacteria 5058
195 Ga0068871_100001990 3300006358 Bacteria 13838
196 Ga0068871_100025542 3300006358 Bacteria 4598
197 Ga0068871_100126600 3300006358 Bacteria 2162
198 Ga0068871_100142299 3300006358 Bacteria 2040
199 Ga0068871_100229181 3300006358 Bacteria 1612
200 Ga0068871_100263412 3300006358 Bacteria 1504
201 Ga0068871_100410010 3300006358 Bacteria 1208
202 Ga0075428_100493819 3300006844 Bacteria 1310
203 Ga0075433_10255583 3300006852 Bacteria 1554
204 Ga0075434_100801482 3300006871 Bacteria 958
205 Ga0068865_100019556 3300006881 Bacteria 4384
206 Ga0068865_100046157 3300006881 Bacteria 2988
207 Ga0097620_100015901 3300006931 Bacteria 7563
208 Ga0097620_100051730 3300006931 Bacteria 4130
209 Ga0097620_100073530 3300006931 Bacteria 3456
210 Ga0097620_100085713 3300006931 Bacteria 3196
211 Ga0097620_100152410 3300006931 Bacteria 2387
212 Ga0097620_100276108 3300006931 Bacteria 1773
213 Ga0097620_100444995 3300006931 Bacteria 1392
214 Ga0097620_100449069 3300006931 Bacteria 1385
215 Ga0075435_100438411 3300007076 Bacteria 1126
216 Ga0105240_10014966 3300009093 Bacteria 10570
217 Ga0105240_10031185 3300009093 Bacteria 6917
218 Ga0105240_10080044 3300009093 Bacteria 4019
219 Ga0105240_10097440 3300009093 Bacteria 3583
220 Ga0105240_10119737 3300009093 Bacteria 3171
221 Ga0105240_10153438 3300009093 Bacteria 2741
222 Ga0105240_10226210 3300009093 Bacteria 2177
223 Ga0105240_10227047 3300009093 Bacteria 2172
224 Ga0111539_10003518 3300009094 Bacteria 20654
225 Ga0111539_10157686 3300009094 Bacteria 2655
226 Ga0105245_10068838 3300009098 Bacteria 3208
227 Ga0105245_10256834 3300009098 Bacteria 1699
228 Ga0105245_10292856 3300009098 Bacteria 1595
229 Ga0105245_10392217 3300009098 Bacteria 1385
230 Ga0105245_10838128 3300009098 Bacteria 959
231 Ga0105243_10162309 3300009148 Bacteria 1928
232 Ga0105243_10162362 3300009148 Bacteria 1928
233 Ga0105243_10343154 3300009148 Bacteria 1369
234 Ga0105241_10382204 3300009174 Bacteria 1231
235 Ga0105241_10489623 3300009174 Bacteria 1094
236 Ga0105242_10001143 3300009176 Bacteria 20918
237 Ga0105242_10038520 3300009176 Bacteria 3845
238 Ga0105242_10235123 3300009176 Bacteria 1644
239 Ga0105248_10041073 3300009177 Bacteria 5185
240 Ga0105248_10043944 3300009177 Bacteria 5011
241 Ga0105248_10061166 3300009177 Bacteria 4227
242 Ga0105248_10099672 3300009177 Bacteria 3274
243 Ga0105248_10252297 3300009177 Bacteria 1986
244 Ga0105248_10326271 3300009177 Bacteria 1729
245 Ga0105248_10363865 3300009177 Bacteria 1628
246 Ga0105248_10585954 3300009177 Bacteria 1258
247 Ga0105248_10682114 3300009177 Bacteria 1159
248 Ga0105237_10164076 3300009545 Bacteria 2220
249 Ga0105237_10227009 3300009545 Bacteria 1868
250 Ga0105238_10165929 3300009551 Bacteria 2184
251 Ga0105238_11059096 3300009551 Bacteria 833
252 Ga0105249_10359825 3300009553 Bacteria 1476
253 Ga0105249_10420356 3300009553 Bacteria 1370
254 Ga0105239_11444675 3300010375 Bacteria 794
255 Ga0157373_10000725 3300013100 Bacteria 25780
256 Ga0157373_10049968 3300013100 Bacteria 2979
257 Ga0157371_10000174 3300013102 Bacteria 93381
258 Ga0157371_10421718 3300013102 Bacteria 978
259 Ga0157370_10005552 3300013104 Bacteria 14141
260 Ga0157370_10217892 3300013104 Bacteria 1768
261 Ga0157370_10305119 3300013104 Bacteria 1469
262 Ga0157369_10037961 3300013105 Bacteria 5269
263 Ga0157369_10093235 3300013105 Bacteria 3214
264 Ga0157369_10117754 3300013105 Bacteria 2820
265 Ga0157374_10002680 3300013296 Bacteria 14978
266 Ga0157374_10068870 3300013296 Bacteria 3330
267 Ga0157374_10131636 3300013296 Bacteria 2421
268 Ga0157374_10195957 3300013296 Unclassified 1977
269 Ga0157374_11118606 3300013296 Bacteria 808
270 Ga0157378_10024063 3300013297 Bacteria 5357
271 Ga0157378_10054835 3300013297 Bacteria 3550
272 Ga0157378_10216390 3300013297 Bacteria 1819
273 Ga0157378_10856427 3300013297 Bacteria 937
274 Ga0163162_10000874 3300013306 Bacteria 28091
275 Ga0163162_10098300 3300013306 Bacteria 3016
276 Ga0163162_10153042 3300013306 Bacteria 2425
277 Ga0163162_10242891 3300013306 Bacteria 1932
278 Ga0163162_10288577 3300013306 Bacteria 1773
279 Ga0163162_10365839 3300013306 Bacteria 1575
280 Ga0163162_10710382 3300013306 Unclassified 1126
281 Ga0157372_10003340 3300013307 Bacteria 17321
282 Ga0157372_10104047 3300013307 Bacteria 3245
283 Ga0157372_10199703 3300013307 Bacteria 2316
284 Ga0157375_10022155 3300013308 Bacteria 5844
285 Ga0157375_10079029 3300013308 Bacteria 3324
286 Ga0157375_10106995 3300013308 Bacteria 2889
287 Ga0157375_10188235 3300013308 Bacteria 2218
288 Ga0157375_10242118 3300013308 Bacteria 1963
289 Ga0163163_10108928 3300014325 Bacteria 2797
290 Ga0163163_10151081 3300014325 Bacteria 2366
291 Ga0163163_10870092 3300014325 Bacteria 965
292 Ga0157380_10148510 3300014326 Bacteria 2023
293 Ga0157380_10812247 3300014326 Bacteria 953
294 Ga0157380_10865171 3300014326 Unclassified 927
295 Ga0157377_10040617 3300014745 Bacteria 2577
296 Ga0157379_10012835 3300014968 Bacteria 7326
297 Ga0157379_10027155 3300014968 Bacteria 5096
298 Ga0157379_10111286 3300014968 Bacteria 2460
299 Ga0157379_10213847 3300014968 Bacteria 1746
300 Ga0157379_10319534 3300014968 Bacteria 1417
301 Ga0157379_10401633 3300014968 Bacteria 1260
302 Ga0157376_10029815 3300014969 Bacteria 4349
303 Ga0157376_10117718 3300014969 Bacteria 2350
304 Ga0157376_10302929 3300014969 Bacteria 1513
305 Ga0157376_10524853 3300014969 Bacteria 1168
306 Ga0182006_1041046 3300015261 Bacteria 1819
307 Ga0163161_10008757 3300017792 Bacteria 6994
308 Ga0163161_10011177 3300017792 Bacteria 6219
309 Ga0163161_10072241 3300017792 Bacteria 2526
310 Ga0163161_10075864 3300017792 Bacteria 2468
311 Ga0213872_10000039 3300021361 Bacteria 123507
312 Ga0213872_10003535 3300021361 Bacteria 8627
313 Ga0213872_10018955 3300021361 Bacteria 3171
314 Ga0213872_10042168 3300021361 Bacteria 2081
315 Ga0207697_10026173 3300025315 Bacteria 2386
316 Ga0207656_10002499 3300025321 Bacteria 6213
317 Ga0207653_10020201 3300025885 Bacteria 2107
318 Ga0207642_10002800 3300025899 Bacteria 5442
319 Ga0207688_10035487 3300025901 Bacteria 2763
320 Ga0207680_10379191 3300025903 Bacteria 997
321 Ga0207699_10029358 3300025906 Bacteria 3067
322 Ga0207699_10212619 3300025906 Bacteria 1316
323 Ga0207645_10002076 3300025907 Bacteria 16034
324 Ga0207645_10027073 3300025907 Bacteria 3704
325 Ga0207645_10193592 3300025907 Bacteria 1336
326 Ga0207645_10196522 3300025907 Bacteria 1326
327 Ga0207643_10017909 3300025908 Bacteria 3879
328 Ga0207643_10019664 3300025908 Bacteria 3702
329 Ga0207643_10132103 3300025908 Bacteria 1486
330 Ga0207643_10152372 3300025908 Bacteria 1387
331 Ga0207705_10105736 3300025909 Bacteria 2075
332 Ga0207705_10294571 3300025909 Bacteria 1243
333 Ga0207654_10167275 3300025911 Bacteria 1425
334 Ga0207707_10144473 3300025912 Bacteria 2080
335 Ga0207695_10017450 3300025913 Bacteria 8354
336 Ga0207695_10033923 3300025913 Bacteria 5557
337 Ga0207695_10069360 3300025913 Bacteria 3608
338 Ga0207695_10085430 3300025913 Bacteria 3184
339 Ga0207671_10051611 3300025914 Bacteria 3048
340 Ga0207671_10141102 3300025914 Bacteria 1856
341 Ga0207660_10182858 3300025917 Bacteria 1629
342 Ga0207660_10654886 3300025917 Bacteria 856
343 Ga0207662_10091692 3300025918 Bacteria 1870
344 Ga0207657_10000234 3300025919 Bacteria 58447
345 Ga0207649_10406887 3300025920 Bacteria 1019
346 Ga0207652_10027918 3300025921 Bacteria 4707
347 Ga0207652_10053149 3300025921 Bacteria 3479
348 Ga0207681_10148940 3300025923 Bacteria 1751
349 Ga0207681_10437998 3300025923 Unclassified 1061
350 Ga0207694_10498968 3300025924 Unclassified 1019
351 Ga0207650_10055237 3300025925 Bacteria 2947
352 Ga0207650_10061109 3300025925 Bacteria 2812
353 Ga0207650_10157113 3300025925 Bacteria 1799
354 Ga0207650_10447813 3300025925 Bacteria 1074
355 Ga0207659_10001621 3300025926 Bacteria 13334
356 Ga0207659_10012764 3300025926 Bacteria 5362
357 Ga0207659_10024879 3300025926 Bacteria 4019
358 Ga0207659_10100240 3300025926 Bacteria 2182
359 Ga0207659_10189075 3300025926 Bacteria 1637
360 Ga0207687_10244340 3300025927 Unclassified 1424
361 Ga0207687_10252550 3300025927 Bacteria 1402
362 Ga0207687_10615377 3300025927 Bacteria 916
363 Ga0207700_10050944 3300025928 Bacteria 3087
364 Ga0207644_10061954 3300025931 Bacteria 2711
365 Ga0207690_10001827 3300025932 Bacteria 13063
366 Ga0207690_10096425 3300025932 Bacteria 2103
367 Ga0207690_10714454 3300025932 Bacteria 824
368 Ga0207706_10000097 3300025933 Bacteria 91923
369 Ga0207706_10031431 3300025933 Bacteria 4730
370 Ga0207686_10021789 3300025934 Bacteria 3683
371 Ga0207686_10030246 3300025934 Bacteria 3204
372 Ga0207686_10091602 3300025934 Bacteria 2008
373 Ga0207709_10214830 3300025935 Bacteria 1383
374 Ga0207709_10231332 3300025935 Bacteria 1339
375 Ga0207670_10002904 3300025936 Bacteria 9055
376 Ga0207670_10072433 3300025936 Bacteria 2385
377 Ga0207669_10357955 3300025937 Bacteria 1130
378 Ga0207704_10040950 3300025938 Bacteria 2713
379 Ga0207665_10112750 3300025939 Bacteria 1912
380 Ga0207691_10000560 3300025940 Bacteria 37165
381 Ga0207691_10001443 3300025940 Bacteria 23702
382 Ga0207691_10002036 3300025940 Bacteria 19776
383 Ga0207691_10070698 3300025940 Bacteria 3151
384 Ga0207711_10039000 3300025941 Bacteria 4040
385 Ga0207711_10307975 3300025941 Bacteria 1462
386 Ga0207689_10004023 3300025942 Bacteria 13366
387 Ga0207689_10006812 3300025942 Bacteria 10050
388 Ga0207689_10116175 3300025942 Bacteria 2199
389 Ga0207661_10688938 3300025944 Unclassified 940
390 Ga0207679_10005476 3300025945 Bacteria 7955
391 Ga0207679_10011985 3300025945 Bacteria 5636
392 Ga0207667_10007232 3300025949 Bacteria 13397
393 Ga0207667_10025479 3300025949 Bacteria 6471
394 Ga0207667_10084058 3300025949 Bacteria 3295
395 Ga0207651_10031284 3300025960 Bacteria 3400
396 Ga0207651_10107930 3300025960 Bacteria 2082
397 Ga0207651_10374176 3300025960 Bacteria 1206
398 Ga0207651_10476235 3300025960 Bacteria 1075
399 Ga0207712_10119717 3300025961 Bacteria 1990
400 Ga0207668_10081407 3300025972 Bacteria 2349
401 Ga0207668_10115132 3300025972 Bacteria 2025
402 Ga0207668_10139081 3300025972 Bacteria 1864
403 Ga0207640_10548987 3300025981 Bacteria 970
404 Ga0207658_10000919 3300025986 Bacteria 24357
405 Ga0207658_10006716 3300025986 Bacteria 7832
406 Ga0207658_10061373 3300025986 Bacteria 2809
407 Ga0207658_10065233 3300025986 Bacteria 2734
408 Ga0207658_10067716 3300025986 Bacteria 2691
409 Ga0207658_10104476 3300025986 Bacteria 2226
410 Ga0207658_10135676 3300025986 Bacteria 1984
411 Ga0207658_10291351 3300025986 Bacteria 1403
412 Ga0207658_10752160 3300025986 Bacteria 883
413 Ga0207677_10018826 3300026023 Bacteria 4154
414 Ga0207677_10121616 3300026023 Bacteria 1965
415 Ga0207703_10007993 3300026035 Bacteria 8357
416 Ga0207703_10031311 3300026035 Bacteria 4205
417 Ga0207703_10034431 3300026035 Bacteria 4019
418 Ga0207703_10380140 3300026035 Bacteria 1306
419 Ga0207639_10112452 3300026041 Bacteria 2222
420 Ga0207639_10901679 3300026041 Bacteria 826
421 Ga0207678_10008512 3300026067 Bacteria 9043
422 Ga0207678_10153657 3300026067 Bacteria 1965
423 Ga0207708_10226753 3300026075 Bacteria 1499
424 Ga0207702_10006007 3300026078 Bacteria 10540
425 Ga0207702_10331428 3300026078 Bacteria 1452
426 Ga0207702_10343008 3300026078 Bacteria 1427
427 Ga0207641_10001267 3300026088 Bacteria 25148
428 Ga0207641_10125237 3300026088 Unclassified 2299
429 Ga0207641_10153229 3300026088 Bacteria 2089
430 Ga0207641_10177309 3300026088 Bacteria 1949
431 Ga0207641_10234578 3300026088 Bacteria 1707
432 Ga0207641_10345818 3300026088 Bacteria 1416
433 Ga0207648_10000715 3300026089 Bacteria 37217
434 Ga0207648_10008800 3300026089 Bacteria 9725
435 Ga0207648_10027630 3300026089 Bacteria 5036
436 Ga0207648_10046341 3300026089 Bacteria 3812
437 Ga0207676_10050276 3300026095 Bacteria 3249
438 Ga0207676_10085586 3300026095 Bacteria 2573
439 Ga0207676_10142397 3300026095 Bacteria 2054
440 Ga0207676_10185756 3300026095 Bacteria 1824
441 Ga0207674_10015936 3300026116 Bacteria 8234
442 Ga0207674_10052798 3300026116 Bacteria 4145
443 Ga0207674_10808803 3300026116 Unclassified 904
444 Ga0207675_100011665 3300026118 Bacteria 8217
445 Ga0207675_100063074 3300026118 Bacteria 3462
446 Ga0207675_100124208 3300026118 Bacteria 2444
447 Ga0207683_10000219 3300026121 Bacteria 50089
448 Ga0207683_10014592 3300026121 Bacteria 6690
449 Ga0207683_10073123 3300026121 Bacteria 3032
450 Ga0207683_10160144 3300026121 Bacteria 2034
451 Ga0207683_10392641 3300026121 Bacteria 1276
452 Ga0207683_10859069 3300026121 Bacteria 842
453 Ga0207698_10016778 3300026142 Bacteria 4948
454 Ga0207698_10084170 3300026142 Bacteria 2577
455 Ga0207698_10108196 3300026142 Bacteria 2323
456 Ga0209983_1007518 3300027665 Unclassified 2232
457 Ga0209974_10010689 3300027876 Bacteria 3095
458 Ga0209974_10011124 3300027876 Bacteria 3027
459 Ga0209974_10027741 3300027876 Unclassified 1874
460 Ga0207428_10009022 3300027907 Bacteria 8978
461 Ga0268266_10410114 3300028379 Bacteria 1282
462 Ga0268266_10690482 3300028379 Bacteria 983
463 Ga0268265_10043796 3300028380 Bacteria 3329
464 Ga0268265_10150039 3300028380 Bacteria 1965
465 Ga0268264_10005529 3300028381 Bacteria 10716
466 Ga0268264_10026951 3300028381 Bacteria 4694
467 Ga0268264_10174991 3300028381 Bacteria 1944
468 Ga0268264_10175273 3300028381 Bacteria 1943
469 Ga0268264_10184782 3300028381 Bacteria 1896
470 Ga0307515_10000043 3300028794 Bacteria 304612
471 Ga0307515_10031745 3300028794 Bacteria 8784
472 Ga0265328_10000001 3300031239 Bacteria 371500
473 Ga0265316_10050849 3300031344 Bacteria 3258
474 Ga0307513_10003123 3300031456 Bacteria 22603
475 Ga0307509_10082106 3300031507 Bacteria 3326
476 Ga0307509_10085108 3300031507 Bacteria 3255
477 Ga0307408_100027666 3300031548 Bacteria 3910
478 Ga0307408_100034225 3300031548 Bacteria 3557
479 Ga0307408_100035671 3300031548 Bacteria 3491
480 Ga0307408_100551194 3300031548 Bacteria 1017
481 Ga0307508_10000163 3300031616 Bacteria 80086
482 Ga0316575_10006948 3300031665 Bacteria 4095
483 Ga0316579_10000184 3300031691 Bacteria 18109
484 Ga0316578_10000742 3300031728 Bacteria 11878
485 Ga0307405_10035194 3300031731 Bacteria 2988
486 Ga0307405_10195036 3300031731 Bacteria 1466
487 Ga0307413_10007125 3300031824 Bacteria 5163
488 Ga0307410_10129940 3300031852 Bacteria 1849
489 Ga0307410_10147647 3300031852 Bacteria 1747
490 Ga0307410_10376234 3300031852 Bacteria 1141
491 Ga0307406_10006344 3300031901 Bacteria 6524
492 Ga0307412_10030179 3300031911 Bacteria 3410
493 Ga0307409_100009797 3300031995 Bacteria 5909
494 Ga0307416_100014141 3300032002 Bacteria 5455
495 Ga0307416_100030432 3300032002 Bacteria 4050
496 Ga0307416_100049300 3300032002 Bacteria 3347
497 Ga0307416_100170681 3300032002 Bacteria 2024
498 Ga0307416_100478817 3300032002 Bacteria 1304
499 Ga0307416_100619383 3300032002 Bacteria 1164
500 Ga0307414_10042212 3300032004 Bacteria 3097
501 Ga0307414_10069020 3300032004 Bacteria 2539
502 Ga0307411_10001127 3300032005 Bacteria 10445
503 Ga0307415_100050588 3300032126 Bacteria 2816
504 Ga0316583_10002422 3300032133 Bacteria 6464
505 Ga0307510_10021393 3300033180 Bacteria 7537
506 Ga0307510_10157452 3300033180 Bacteria 1875
507 Ga0307510_10178262 3300033180 Bacteria 1692
508 Ga0373938_0077599 3300034957 Bacteria 804
509 Ga0373944_0009231 3300035089 Bacteria 2673
510 Ga0373952_0000139 3300035092 Bacteria 10580
511 Ga0373923_0098598 3300035111 Bacteria 1286
512 Ga0373956_0039698 3300035119 Bacteria 2087
513 Ga0373955_0044117 3300035172 Bacteria 2400
514 Ga0373924_0067583 3300035410 Bacteria 1503
515 Ga0373931_0045579 3300035691 Bacteria 2316
516 Ga0373927_0377892 3300035695 Bacteria 934
517 Ga0373937_0042517 3300036401 Bacteria 4146
518 Ga0373937_0696335 3300036401 Bacteria 963
519 Ga0373937_1078919 3300036401 Bacteria 752
520 Ga0316582_0002406 3300036647 Bacteria 8772
521 Ga0373925_0145458 3300037068 Unclassified 1858
522 Ga0395900_0037247 3300037418 Bacteria 5017
523 Ga0395900_0159573 3300037418 Bacteria 2301
524 Ga0395905_0048192 3300037471 Bacteria 3994
525 Ga0436365_0250047 3300039437 Bacteria 3038
526 Ga0436365_1085190 3300039437 Bacteria 3200
527 Ga0436361_0066314 3300039447 Bacteria 3515
528 Ga0436361_0140639 3300039447 Bacteria 6254
529 Ga0436361_0240373 3300039447 Bacteria 3038
530 Ga0436361_0410838 3300039447 Bacteria 2340
531 Ga0436361_0802941 3300039447 Bacteria 44636
532 Ga0439436_0004806 3300041404 Bacteria 4144
533 Ga0439438_001058 3300041405 Bacteria 12257
534 Ga0439447_002801 3300041407 Bacteria 6291
535 Ga0439461_0032289 3300041410 Bacteria 1097
536 Ga0439466_0009867 3300041411 Bacteria 3556
537 Ga0439466_0031669 3300041411 Bacteria 1807
538 Ga0451843_0708525 3300041509 Bacteria 2932
539 Ga0439431_0003072 3300041997 Bacteria 3665
540 Ga0439441_000060 3300042001 Bacteria 8277
541 Ga0439432_020125 3300042006 Bacteria 2220
542 Ga0439452_001765 3300042010 Bacteria 8442
543 Ga0450888_007440 3300042126 Unclassified 1212
544 Ga0439446_0020440 3300042156 Bacteria 1865
545 Ga0439434_0007658 3300042435 Bacteria 3164
546 Ga0451577_0007328 3300042876 Bacteria 10857
547 Ga0451577_0110938 3300042876 Bacteria 2454
548 Ga0451577_0141935 3300042876 Bacteria 2159
549 Ga0451577_0169456 3300042876 Bacteria 1968
550 Ga0451577_0466325 3300042876 Bacteria 1147
551 Ga0451577_0482143 3300042876 Bacteria 1126
552 Ga0466969_0002491 3300044656 Bacteria 9832
553 Ga0466965_0025036 3300044683 Bacteria 2888
554 Ga0466966_0040196 3300044684 Bacteria 3010
555 Ga0466966_0089452 3300044684 Bacteria 1913
556 Ga0466964_0024757 3300044706 Unclassified 2340
557 Ga0453684_0000623 3300044712 Bacteria 129254
558 Ga0453684_0062601 3300044712 Bacteria 4764
559 Ga0453684_0143838 3300044712 Bacteria 2843
560 Ga0453684_0570297 3300044712 Bacteria 1244
561 Ga0453684_0966980 3300044712 Bacteria 908
562 Ga0466957_0004733 3300044842 Bacteria 7622
563 Ga0466959_0002925 3300045049 Bacteria 11013
564 Ga0451576_0053704 3300045051 Bacteria 4220
565 Ga0451576_0061264 3300045051 Bacteria 3924
566 Ga0451576_0280596 3300045051 Bacteria 1742
567 Ga0451576_0401191 3300045051 Bacteria 1438
568 Ga0451576_0454519 3300045051 Bacteria 1345
569 Ga0466958_0035041 3300045836 Bacteria 2997
570 Ga0466967_0593959 3300045976 Bacteria 1092
571 Ga0495592_0000222 3300046454 Bacteria 48902
572 Ga0495651_0239803 3300046462 Bacteria 1244
573 Ga0495653_0115406 3300046463 Bacteria 1922
574 Ga0495650_0017208 3300046471 Bacteria 3629
575 Ga0495650_0078252 3300046471 Bacteria 1281
576 Ga0495662_0109903 3300046476 Bacteria 1351
577 Ga0495664_0341495 3300046477 Bacteria 902
578 Ga0495606_0000054 3300046507 Bacteria 200380
579 Ga0495610_0101165 3300046512 Bacteria 1291
580 Ga0495643_0000186 3300046522 Bacteria 99683
581 Ga0495643_0002089 3300046522 Bacteria 16522
582 Ga0495652_0017734 3300046529 Bacteria 6355
583 Ga0495587_0046497 3300046536 Bacteria 2576
584 Ga0495598_0130313 3300046537 Bacteria 862
585 Ga0495621_0004663 3300046539 Bacteria 3876
586 Ga0495645_0291511 3300046543 Bacteria 1069
587 Ga0495667_0009652 3300046559 Bacteria 6541
588 Ga0495634_0131675 3300046642 Unclassified 1594
589 Ga0495657_0052826 3300046675 Bacteria 2722
590 Ga0495599_0054613 3300046678 Bacteria 2502
591 Ga0495623_0026340 3300046679 Bacteria 3743
592 Ga0495671_0004823 3300046692 Bacteria 7969
593 Ga0495671_0044143 3300046692 Bacteria 2236
594 Ga0495649_0020354 3300046694 Bacteria 3722
595 Ga0495649_0046844 3300046694 Bacteria 2353
596 Ga0495660_0222688 3300046810 Bacteria 888
597 Ga0495604_0081249 3300047317 Bacteria 2427
598 Ga0495680_0067770 3300047322 Bacteria 2728
599 Ga0495675_0110969 3300047444 Bacteria 1712
600 Ga0496102_0006489 3300048905 Bacteria 9974
601 Ga0496102_0014353 3300048905 Bacteria 6882
602 Ga0496102_0021108 3300048905 Bacteria 5759
603 Ga0496103_0019865 3300048906 Bacteria 4034
604 Ga0496104_0015343 3300048907 Bacteria 6937
605 Ga0496104_0564221 3300048907 Bacteria 1049
606 Ga0496106_0003851 3300048909 Bacteria 11183
607 Ga0496108_0086157 3300048911 Bacteria 2667
608 Ga0496109_0158476 3300048912 Bacteria 2120
609 Ga0496109_0563803 3300048912 Bacteria 1074
610 Ga0496110_0039612 3300048913 Bacteria 4104
611 Ga0496114_0187136 3300048917 Bacteria 1810
612 Ga0501031_0265662 3300049568 Bacteria 1115
613 Ga0501032_0001096 3300049569 Bacteria 21627
614 Ga0501032_0008791 3300049569 Bacteria 7352
615 Ga0501034_0105821 3300049571 Bacteria 2806
616 Ga0501034_0117331 3300049571 Bacteria 2649
617 Ga0501034_0169666 3300049571 Bacteria 2150
618 Ga0501034_0439052 3300049571 Bacteria 1224
619 Ga0501036_0058036 3300049572 Bacteria 3279
620 Ga0501036_0482543 3300049572 Bacteria 1032
621 Ga0501036_0505937 3300049572 Unclassified 1005
622 Ga0501037_0125666 3300049573 Bacteria 1842
623 Ga0501037_0194247 3300049573 Bacteria 1436
624 Ga0501038_0005073 3300049574 Bacteria 12239
625 Ga0501038_0039146 3300049574 Bacteria 4148
626 Ga0501038_0055716 3300049574 Bacteria 3396
627 Ga0501039_0013309 3300049575 Bacteria 6290
628 Ga0501039_0054123 3300049575 Bacteria 3106
629 Ga0501040_0014856 3300049576 Bacteria 5140
630 Ga0501041_0020796 3300049577 Bacteria 3926
631 Ga0501041_0109163 3300049577 Bacteria 1716
632 Ga0501043_0184872 3300049579 Bacteria 1623
633 Ga0501046_0052373 3300049580 Bacteria 3217
634 Ga0501046_0432716 3300049580 Bacteria 947
635 Ga0501047_0001767 3300049581 Bacteria 20898
636 Ga0501047_0091807 3300049581 Bacteria 2915
637 Ga0501047_0429895 3300049581 Bacteria 1151
638 Ga0501048_0034588 3300049582 Bacteria 3644
639 Ga0501067_0002963 3300049583 Bacteria 9366
640 Ga0501068_0074422 3300049584 Bacteria 2076
641 Ga0501069_0014023 3300049585 Bacteria 4281
642 Ga0501069_0064473 3300049585 Bacteria 2048
643 Ga0501070_0010157 3300049586 Bacteria 7968
644 Ga0501071_0044189 3300049587 Bacteria 3195
645 Ga0501071_0252297 3300049587 Bacteria 1332
646 Ga0501072_0001755 3300049588 Bacteria 16124
647 Ga0501072_0236394 3300049588 Bacteria 1455
648 Ga0501072_0375371 3300049588 Bacteria 1128
649 Ga0501072_0549255 3300049588 Bacteria 912
650 Ga0501073_0000384 3300049589 Bacteria 29894
651 Ga0501073_0071197 3300049589 Bacteria 2423
652 Ga0501073_0319761 3300049589 Bacteria 1071
653 Ga0501074_0000123 3300049590 Bacteria 39312
654 Ga0501074_0127231 3300049590 Bacteria 1823
655 Ga0501075_0077275 3300049591 Bacteria 2519
656 Ga0501075_0079003 3300049591 Bacteria 2490
657 Ga0501076_0000185 3300049592 Bacteria 37179
658 Ga0501076_0349873 3300049592 Bacteria 1213
659 Ga0501076_0505825 3300049592 Bacteria 996
660 Ga0501079_0004001 3300049741 Bacteria 10899
661 Ga0501079_0053365 3300049741 Bacteria 3118
662 Ga0501080_0008926 3300049742 Bacteria 9117
663 Ga0501080_0012021 3300049742 Bacteria 7928
664 Ga0501080_0025348 3300049742 Bacteria 5502
665 Ga0501080_0096675 3300049742 Bacteria 2742
666 Ga0501080_0131558 3300049742 Bacteria 2317
667 Ga0501081_0001180 3300049743 Bacteria 15796
668 Ga0501081_0187973 3300049743 Bacteria 1495
669 Ga0501083_0000252 3300049744 Bacteria 34143
670 Ga0501083_0079511 3300049744 Bacteria 2174
671 Ga0501035_0221999 3300049822 Bacteria 1613
672 Ga0501044_0372736 3300049823 Bacteria 1344
673 Ga0501044_0419900 3300049823 Bacteria 1248
674 nmdc:mga00v17_120563_c1 3300050491 Bacteria 1669
675 nmdc:mga00v17_1746_c1 3300050491 Bacteria 11303
676 nmdc:mga0k408_178115_c1 3300050493 Bacteria 1268
677 nmdc:mga0k408_85851_c1 3300050493 Bacteria 1847
678 nmdc:mga0k408_9828_c1 3300050493 Bacteria 5166
679 nmdc:mga06z11_296264_c1 3300050494 Bacteria 961
680 nmdc:mga07m45_86384_c1 3300050496 Bacteria 1795
681 nmdc:mga0qj67_16651_c1 3300050509 Bacteria 5579
682 nmdc:mga0qj67_259814_c1 3300050509 Bacteria 1409
683 nmdc:mga06r32_332786_c1 3300050510 Bacteria 1504
684 nmdc:mga08y16_13025_c1 3300050511 Bacteria 8752
685 nmdc:mga08y16_543842_c1 3300050511 Bacteria 1176
686 nmdc:mga0n895_203532_c1 3300050512 Bacteria 2010
687 nmdc:mga0n895_922322_c1 3300050512 Bacteria 858
688 Ga0495601_0143273 3300053077 Bacteria 1559
689 Ga0495619_0038614 3300053085 Bacteria 3115
690 Ga0500641_0021741 3300053096 Bacteria 2450
691 Ga0500594_0000988 3300053118 Bacteria 6110
692 Ga0500614_019266 3300053123 Bacteria 1562
693 Ga0500652_041329 3300053131 Bacteria 1857
694 Ga0500655_004929 3300053133 Bacteria 2398
695 Ga0500559_0000011 3300053136 Bacteria 164751
696 Ga0500564_099218 3300053138 Bacteria 1289
697 Ga0500620_100742 3300053155 Bacteria 1010
698 Ga0500622_0002322 3300053156 Bacteria 13902
699 Ga0500636_0245373 3300053177 Bacteria 917
700 Ga0500587_002239 3300053739 Bacteria 2754
701 Ga0501084_0104315 3300054114 Bacteria 2381
702 Ga0501084_0369880 3300054114 Bacteria 1211
703 Ga0501082_0071382 3300060353 Bacteria 2990
704 Ga0530510_0047085 3300061734 Bacteria 3115

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0221999 Ga0501035_0221999_903_1523 201
2 3300005841 Ga0068863_100005626 Ga0068863_10000562610 203
3 3300005843 Ga0068860_100001537 Ga0068860_10000153719 203
4 3300006358 Ga0068871_100001990 Ga0068871_10000199012 203
5 3300025315 Ga0207697_10026173 Ga0207697_100261732 203
6 3300025923 Ga0207681_10148940 Ga0207681_101489402 203
7 3300025925 Ga0207650_10055237 Ga0207650_100552373 203
8 3300025940 Ga0207691_10000560 Ga0207691_1000056029 203
9 3300025972 Ga0207668_10139081 Ga0207668_101390811 203
10 3300026088 Ga0207641_10001267 Ga0207641_1000126710 203
11 3300046537 Ga0495598_0130313 Ga0495598_0130313_189_821 205
12 3300050494 nmdc:mga06z11_296264_c1 nmdc:mga06z11_296264_c1_110_742 207
13 3300041410 Ga0439461_0032289 Ga0439461_0032289_35_766 213
14 3300041997 Ga0439431_0003072 Ga0439431_0003072_821_1552 213
15 3300046471 Ga0495650_0017208 Ga0495650_0017208_2788_3495 219
16 3300005544 Ga0070686_100491366 Ga0070686_1004913661 222
17 3300005617 Ga0068859_100085712 Ga0068859_1000857123 222
18 3300005843 Ga0068860_100281938 Ga0068860_1002819382 222
19 3300006931 Ga0097620_100085713 Ga0097620_1000857133 222
20 3300028381 Ga0268264_10184782 Ga0268264_101847822 222
21 3300005356 Ga0070674_100028183 Ga0070674_1000281832 224
22 iso_pu_bacteria 2554235132 2554815979 224
23 iso_pu_bacteria 2606217733 2608382351 224
24 iso_pu_bacteria 8011350971 8011353108 224
25 3300036401 Ga0373937_1078919 Ga0373937_1078919_22_729 225
26 3300028794 Ga0307515_10000043 Ga0307515_1000004397 226
27 iso_pu_bacteria 2738543020 2739288323 226
28 iso_pu_bacteria 2738543021 2739293635 226
29 iso_pu_bacteria 2808606379 2808943360 226
30 iso_pu_bacteria 2811994881 2812366001 226
31 iso_pu_bacteria 2842805378 2842810017 226
32 iso_pu_bacteria 2923519811 2923520022 226
33 3300049571 Ga0501034_0105821 Ga0501034_0105821_910_1614 228
34 3300049574 Ga0501038_0055716 Ga0501038_0055716_1395_2099 228
35 3300049742 Ga0501080_0131558 Ga0501080_0131558_553_1266 228
36 3300005336 Ga0070680_100459243 Ga0070680_1004592432 229
37 3300005344 Ga0070661_100269692 Ga0070661_1002696922 229
38 3300005458 Ga0070681_10022463 Ga0070681_100224633 229
39 3300005530 Ga0070679_100036286 Ga0070679_1000362864 229
40 3300005539 Ga0068853_100141253 Ga0068853_1001412532 229
41 3300009177 Ga0105248_10682114 Ga0105248_106821142 229
42 3300013100 Ga0157373_10049968 Ga0157373_100499682 229
43 3300013297 Ga0157378_10216390 Ga0157378_102163903 229
44 3300021361 Ga0213872_10000039 Ga0213872_1000003917 229
45 3300021361 Ga0213872_10003535 Ga0213872_100035356 229
46 3300025912 Ga0207707_10144473 Ga0207707_101444732 229
47 3300025917 Ga0207660_10654886 Ga0207660_106548861 229
48 3300025920 Ga0207649_10406887 Ga0207649_104068871 229
49 3300026041 Ga0207639_10901679 Ga0207639_109016791 229
50 3300026078 Ga0207702_10331428 Ga0207702_103314282 229
51 3300035410 Ga0373924_0067583 Ga0373924_0067583_682_1383 229
52 3300039447 Ga0436361_0066314 Ga0436361_0066314_301_1002 229
53 3300039447 Ga0436361_0140639 Ga0436361_0140639_3584_4285 229
54 3300039447 Ga0436361_0802941 Ga0436361_0802941_13826_14527 229
55 3300049571 Ga0501034_0169666 Ga0501034_0169666_1261_1962 229
56 3300049581 Ga0501047_0091807 Ga0501047_0091807_465_1166 229
57 3300049583 Ga0501067_0002963 Ga0501067_0002963_6456_7157 229
58 3300049585 Ga0501069_0064473 Ga0501069_0064473_134_835 229
59 3300049586 Ga0501070_0010157 Ga0501070_0010157_6265_6966 229
60 3300049588 Ga0501072_0375371 Ga0501072_0375371_134_835 229
61 3300049589 Ga0501073_0071197 Ga0501073_0071197_400_1101 229
62 3300049742 Ga0501080_0012021 Ga0501080_0012021_2004_2705 229
63 3300049744 Ga0501083_0079511 Ga0501083_0079511_269_970 229
64 3300013104 Ga0157370_10217892 Ga0157370_102178922 230
65 3300015261 Ga0182006_1041046 Ga0182006_10410461 230
66 3300017792 Ga0163161_10075864 Ga0163161_100758643 230
67 3300025960 Ga0207651_10374176 Ga0207651_103741763 230
68 3300025981 Ga0207640_10548987 Ga0207640_105489872 230
69 3300032002 Ga0307416_100619383 Ga0307416_1006193831 230
70 3300032004 Ga0307414_10042212 Ga0307414_100422124 230
71 3300041404 Ga0439436_0004806 Ga0439436_0004806_3327_4034 230
72 3300041405 Ga0439438_001058 Ga0439438_001058_6602_7309 230
73 3300041407 Ga0439447_002801 Ga0439447_002801_1131_1838 230
74 3300041411 Ga0439466_0009867 Ga0439466_0009867_203_910 230
75 3300041411 Ga0439466_0031669 Ga0439466_0031669_455_1243 230
76 3300042006 Ga0439432_020125 Ga0439432_020125_966_1673 230
77 3300042010 Ga0439452_001765 Ga0439452_001765_5929_6636 230
78 3300042435 Ga0439434_0007658 Ga0439434_0007658_418_1125 230
79 3300044656 Ga0466969_0002491 Ga0466969_0002491_6182_6883 230
80 3300044683 Ga0466965_0025036 Ga0466965_0025036_1043_1744 230
81 3300044684 Ga0466966_0040196 Ga0466966_0040196_220_921 230
82 3300044706 Ga0466964_0024757 Ga0466964_0024757_49_750 230
83 3300045049 Ga0466959_0002925 Ga0466959_0002925_5754_6455 230
84 3300046507 Ga0495606_0000054 Ga0495606_0000054_45476_46183 230
85 3300046522 Ga0495643_0000186 Ga0495643_0000186_1347_2054 230
86 3300046522 Ga0495643_0002089 Ga0495643_0002089_1275_1982 230
87 3300046692 Ga0495671_0004823 Ga0495671_0004823_1684_2391 230
88 3300046694 Ga0495649_0020354 Ga0495649_0020354_284_991 230
89 3300046694 Ga0495649_0046844 Ga0495649_0046844_565_1272 230
90 3300046810 Ga0495660_0222688 Ga0495660_0222688_129_869 230
91 3300049569 Ga0501032_0008791 Ga0501032_0008791_2162_2950 230
92 3300005328 Ga0070676_10000988 Ga0070676_100009882 231
93 3300005328 Ga0070676_10032638 Ga0070676_100326382 231
94 3300005328 Ga0070676_10059241 Ga0070676_100592412 231
95 3300005328 Ga0070676_10197125 Ga0070676_101971252 231
96 3300005330 Ga0070690_100223598 Ga0070690_1002235982 231
97 3300005331 Ga0070670_100011047 Ga0070670_1000110473 231
98 3300005331 Ga0070670_100027074 Ga0070670_1000270742 231
99 3300005331 Ga0070670_100029619 Ga0070670_1000296194 231
100 3300005331 Ga0070670_100128779 Ga0070670_1001287792 231
101 3300005331 Ga0070670_100234413 Ga0070670_1002344132 231
102 3300005331 Ga0070670_100808522 Ga0070670_1008085221 231
103 3300005333 Ga0070677_10041781 Ga0070677_100417812 231
104 3300005334 Ga0068869_100005217 Ga0068869_1000052176 231
105 3300005334 Ga0068869_100007185 Ga0068869_1000071855 231
106 3300005335 Ga0070666_10001990 Ga0070666_1000199010 231
107 3300005335 Ga0070666_10081007 Ga0070666_100810072 231
108 3300005335 Ga0070666_10546603 Ga0070666_105466031 231
109 3300005336 Ga0070680_100651511 Ga0070680_1006515111 231
110 3300005338 Ga0068868_100007819 Ga0068868_1000078196 231
111 3300005338 Ga0068868_100351500 Ga0068868_1003515001 231
112 3300005339 Ga0070660_100001840 Ga0070660_1000018405 231
113 3300005340 Ga0070689_100030639 Ga0070689_1000306392 231
114 3300005340 Ga0070689_100057351 Ga0070689_1000573512 231
115 3300005343 Ga0070687_100075003 Ga0070687_1000750033 231
116 3300005344 Ga0070661_100007211 Ga0070661_1000072113 231
117 3300005347 Ga0070668_100007290 Ga0070668_1000072902 231
118 3300005347 Ga0070668_100163744 Ga0070668_1001637441 231
119 3300005347 Ga0070668_100393515 Ga0070668_1003935152 231
120 3300005353 Ga0070669_100001481 Ga0070669_1000014818 231
121 3300005353 Ga0070669_100151055 Ga0070669_1001510552 231
122 3300005353 Ga0070669_100177476 Ga0070669_1001774762 231
123 3300005354 Ga0070675_100003903 Ga0070675_1000039032 231
124 3300005354 Ga0070675_100003952 Ga0070675_1000039522 231
125 3300005354 Ga0070675_100016457 Ga0070675_1000164577 231
126 3300005354 Ga0070675_100163285 Ga0070675_1001632851 231
127 3300005355 Ga0070671_100001117 Ga0070671_10000111712 231
128 3300005355 Ga0070671_100017774 Ga0070671_1000177742 231
129 3300005355 Ga0070671_100095852 Ga0070671_1000958522 231
130 3300005356 Ga0070674_100275437 Ga0070674_1002754371 231
131 3300005364 Ga0070673_100026652 Ga0070673_1000266522 231
132 3300005364 Ga0070673_100034104 Ga0070673_1000341043 231
133 3300005364 Ga0070673_100036746 Ga0070673_1000367462 231
134 3300005364 Ga0070673_100360607 Ga0070673_1003606072 231
135 3300005365 Ga0070688_100105802 Ga0070688_1001058023 231
136 3300005365 Ga0070688_100147238 Ga0070688_1001472382 231
137 3300005366 Ga0070659_100003840 Ga0070659_1000038403 231
138 3300005366 Ga0070659_100206080 Ga0070659_1002060802 231
139 3300005367 Ga0070667_100006553 Ga0070667_1000065532 231
140 3300005367 Ga0070667_100087072 Ga0070667_1000870722 231
141 3300005367 Ga0070667_100138879 Ga0070667_1001388792 231
142 3300005367 Ga0070667_100165886 Ga0070667_1001658862 231
143 3300005367 Ga0070667_100242661 Ga0070667_1002426612 231
144 3300005367 Ga0070667_100501969 Ga0070667_1005019692 231
145 3300005367 Ga0070667_100510692 Ga0070667_1005106921 231
146 3300005434 Ga0070709_10064574 Ga0070709_100645742 231
147 3300005434 Ga0070709_10356203 Ga0070709_103562031 231
148 3300005440 Ga0070705_100014585 Ga0070705_1000145852 231
149 3300005441 Ga0070700_100028894 Ga0070700_1000288943 231
150 3300005441 Ga0070700_100105481 Ga0070700_1001054812 231
151 3300005444 Ga0070694_100137251 Ga0070694_1001372512 231
152 3300005455 Ga0070663_100100178 Ga0070663_1001001782 231
153 3300005456 Ga0070678_100001068 Ga0070678_1000010683 231
154 3300005456 Ga0070678_100074216 Ga0070678_1000742162 231
155 3300005457 Ga0070662_100000568 Ga0070662_10000056810 231
156 3300005457 Ga0070662_100026453 Ga0070662_1000264534 231
157 3300005459 Ga0068867_100008617 Ga0068867_1000086174 231
158 3300005539 Ga0068853_100007620 Ga0068853_1000076206 231
159 3300005539 Ga0068853_100037771 Ga0068853_1000377713 231
160 3300005539 Ga0068853_100577885 Ga0068853_1005778852 231
161 3300005543 Ga0070672_100002490 Ga0070672_10000249011 231
162 3300005543 Ga0070672_100020253 Ga0070672_1000202533 231
163 3300005543 Ga0070672_100030145 Ga0070672_1000301452 231
164 3300005543 Ga0070672_100040170 Ga0070672_1000401703 231
165 3300005543 Ga0070672_100057707 Ga0070672_1000577072 231
166 3300005548 Ga0070665_100015080 Ga0070665_1000150802 231
167 3300005548 Ga0070665_100148849 Ga0070665_1001488492 231
168 3300005549 Ga0070704_100046097 Ga0070704_1000460972 231
169 3300005549 Ga0070704_100155304 Ga0070704_1001553042 231
170 3300005563 Ga0068855_100000634 Ga0068855_1000006348 231
171 3300005564 Ga0070664_100000284 Ga0070664_10000028431 231
172 3300005564 Ga0070664_100021720 Ga0070664_1000217202 231
173 3300005577 Ga0068857_100375847 Ga0068857_1003758472 231
174 3300005577 Ga0068857_100631053 Ga0068857_1006310532 231
175 3300005578 Ga0068854_100049038 Ga0068854_1000490383 231
176 3300005614 Ga0068856_100002570 Ga0068856_10000257011 231
177 3300005616 Ga0068852_100138341 Ga0068852_1001383412 231
178 3300005617 Ga0068859_100015900 Ga0068859_1000159006 231
179 3300005617 Ga0068859_100051729 Ga0068859_1000517294 231
180 3300005617 Ga0068859_100449046 Ga0068859_1004490462 231
181 3300005618 Ga0068864_100007878 Ga0068864_1000078785 231
182 3300005618 Ga0068864_100129114 Ga0068864_1001291143 231
183 3300005618 Ga0068864_100185590 Ga0068864_1001855902 231
184 3300005618 Ga0068864_100378721 Ga0068864_1003787212 231
185 3300005618 Ga0068864_100634801 Ga0068864_1006348011 231
186 3300005718 Ga0068866_10033452 Ga0068866_100334522 231
187 3300005719 Ga0068861_100027161 Ga0068861_1000271612 231
188 3300005719 Ga0068861_100055829 Ga0068861_1000558292 231
189 3300005719 Ga0068861_100200240 Ga0068861_1002002402 231
190 3300005841 Ga0068863_100020743 Ga0068863_1000207435 231
191 3300005841 Ga0068863_100096665 Ga0068863_1000966652 231
192 3300005841 Ga0068863_100318451 Ga0068863_1003184512 231
193 3300005841 Ga0068863_100531903 Ga0068863_1005319032 231
194 3300005842 Ga0068858_100001792 Ga0068858_1000017922 231
195 3300005842 Ga0068858_100085205 Ga0068858_1000852053 231
196 3300005842 Ga0068858_100089656 Ga0068858_1000896563 231
197 3300005842 Ga0068858_100458323 Ga0068858_1004583232 231
198 3300005842 Ga0068858_100806786 Ga0068858_1008067862 231
199 3300005843 Ga0068860_100006790 Ga0068860_1000067903 231
200 3300005843 Ga0068860_100022341 Ga0068860_1000223412 231
201 3300005843 Ga0068860_100121064 Ga0068860_1001210643 231
202 3300005843 Ga0068860_100534128 Ga0068860_1005341282 231
203 3300005844 Ga0068862_100086607 Ga0068862_1000866072 231
204 3300005844 Ga0068862_100493706 Ga0068862_1004937061 231
205 3300005844 Ga0068862_100830913 Ga0068862_1008309131 231
206 3300006237 Ga0097621_100004956 Ga0097621_1000049567 231
207 3300006237 Ga0097621_100030965 Ga0097621_1000309653 231
208 3300006237 Ga0097621_100103720 Ga0097621_1001037202 231
209 3300006237 Ga0097621_100460720 Ga0097621_1004607202 231
210 3300006237 Ga0097621_100532770 Ga0097621_1005327702 231
211 3300006358 Ga0068871_100126600 Ga0068871_1001266002 231
212 3300006844 Ga0075428_100493819 Ga0075428_1004938192 231
213 3300006881 Ga0068865_100019556 Ga0068865_1000195564 231
214 3300006881 Ga0068865_100046157 Ga0068865_1000461572 231
215 3300006931 Ga0097620_100015901 Ga0097620_1000159016 231
216 3300006931 Ga0097620_100051730 Ga0097620_1000517302 231
217 3300006931 Ga0097620_100449069 Ga0097620_1004490692 231
218 3300009093 Ga0105240_10153438 Ga0105240_101534382 231
219 3300009094 Ga0111539_10157686 Ga0111539_101576864 231
220 3300009098 Ga0105245_10838128 Ga0105245_108381282 231
221 3300009148 Ga0105243_10162362 Ga0105243_101623622 231
222 3300009174 Ga0105241_10382204 Ga0105241_103822042 231
223 3300009177 Ga0105248_10043944 Ga0105248_100439442 231
224 3300009177 Ga0105248_10061166 Ga0105248_100611662 231
225 3300009177 Ga0105248_10099672 Ga0105248_100996723 231
226 3300009177 Ga0105248_10363865 Ga0105248_103638652 231
227 3300009545 Ga0105237_10164076 Ga0105237_101640762 231
228 3300009545 Ga0105237_10227009 Ga0105237_102270092 231
229 3300009551 Ga0105238_11059096 Ga0105238_110590961 231
230 3300009553 Ga0105249_10359825 Ga0105249_103598251 231
231 3300009553 Ga0105249_10420356 Ga0105249_104203562 231
232 3300010375 Ga0105239_11444675 Ga0105239_114446751 231
233 3300013100 Ga0157373_10000725 Ga0157373_1000072530 231
234 3300013102 Ga0157371_10000174 Ga0157371_1000017429 231
235 3300013105 Ga0157369_10037961 Ga0157369_100379612 231
236 3300013105 Ga0157369_10093235 Ga0157369_100932352 231
237 3300013296 Ga0157374_10002680 Ga0157374_100026805 231
238 3300013296 Ga0157374_10131636 Ga0157374_101316362 231
239 3300013296 Ga0157374_11118606 Ga0157374_111186061 231
240 3300013297 Ga0157378_10024063 Ga0157378_100240633 231
241 3300013306 Ga0163162_10000874 Ga0163162_1000087414 231
242 3300013306 Ga0163162_10288577 Ga0163162_102885772 231
243 3300013306 Ga0163162_10365839 Ga0163162_103658392 231
244 3300013306 Ga0163162_10710382 Ga0163162_107103822 231
245 3300013307 Ga0157372_10003340 Ga0157372_100033404 231
246 3300013307 Ga0157372_10104047 Ga0157372_101040472 231
247 3300013308 Ga0157375_10022155 Ga0157375_100221553 231
248 3300013308 Ga0157375_10106995 Ga0157375_101069953 231
249 3300013308 Ga0157375_10242118 Ga0157375_102421182 231
250 3300014325 Ga0163163_10108928 Ga0163163_101089282 231
251 3300014325 Ga0163163_10151081 Ga0163163_101510812 231
252 3300014325 Ga0163163_10870092 Ga0163163_108700922 231
253 3300014326 Ga0157380_10148510 Ga0157380_101485103 231
254 3300014326 Ga0157380_10812247 Ga0157380_108122471 231
255 3300014968 Ga0157379_10027155 Ga0157379_100271552 231
256 3300014968 Ga0157379_10401633 Ga0157379_104016332 231
257 3300014969 Ga0157376_10029815 Ga0157376_100298153 231
258 3300014969 Ga0157376_10302929 Ga0157376_103029292 231
259 3300014969 Ga0157376_10524853 Ga0157376_105248532 231
260 3300017792 Ga0163161_10008757 Ga0163161_100087577 231
261 3300017792 Ga0163161_10011177 Ga0163161_100111773 231
262 3300017792 Ga0163161_10072241 Ga0163161_100722413 231
263 3300021361 Ga0213872_10018955 Ga0213872_100189555 231
264 3300021361 Ga0213872_10042168 Ga0213872_100421681 231
265 3300025899 Ga0207642_10002800 Ga0207642_100028002 231
266 3300025903 Ga0207680_10379191 Ga0207680_103791912 231
267 3300025906 Ga0207699_10029358 Ga0207699_100293582 231
268 3300025907 Ga0207645_10002076 Ga0207645_100020762 231
269 3300025907 Ga0207645_10027073 Ga0207645_100270732 231
270 3300025907 Ga0207645_10193592 Ga0207645_101935922 231
271 3300025907 Ga0207645_10196522 Ga0207645_101965222 231
272 3300025908 Ga0207643_10132103 Ga0207643_101321032 231
273 3300025908 Ga0207643_10152372 Ga0207643_101523722 231
274 3300025913 Ga0207695_10033923 Ga0207695_100339236 231
275 3300025914 Ga0207671_10051611 Ga0207671_100516112 231
276 3300025914 Ga0207671_10141102 Ga0207671_101411022 231
277 3300025917 Ga0207660_10182858 Ga0207660_101828582 231
278 3300025918 Ga0207662_10091692 Ga0207662_100916923 231
279 3300025919 Ga0207657_10000234 Ga0207657_1000023425 231
280 3300025923 Ga0207681_10437998 Ga0207681_104379982 231
281 3300025925 Ga0207650_10061109 Ga0207650_100611092 231
282 3300025925 Ga0207650_10157113 Ga0207650_101571132 231
283 3300025925 Ga0207650_10447813 Ga0207650_104478131 231
284 3300025926 Ga0207659_10001621 Ga0207659_100016214 231
285 3300025926 Ga0207659_10012764 Ga0207659_100127645 231
286 3300025926 Ga0207659_10024879 Ga0207659_100248792 231
287 3300025926 Ga0207659_10189075 Ga0207659_101890751 231
288 3300025931 Ga0207644_10061954 Ga0207644_100619542 231
289 3300025932 Ga0207690_10001827 Ga0207690_1000182710 231
290 3300025932 Ga0207690_10096425 Ga0207690_100964252 231
291 3300025933 Ga0207706_10000097 Ga0207706_1000009717 231
292 3300025933 Ga0207706_10031431 Ga0207706_100314313 231
293 3300025937 Ga0207669_10357955 Ga0207669_103579552 231
294 3300025938 Ga0207704_10040950 Ga0207704_100409502 231
295 3300025939 Ga0207665_10112750 Ga0207665_101127502 231
296 3300025940 Ga0207691_10001443 Ga0207691_1000144320 231
297 3300025940 Ga0207691_10002036 Ga0207691_100020363 231
298 3300025940 Ga0207691_10070698 Ga0207691_100706982 231
299 3300025941 Ga0207711_10039000 Ga0207711_100390004 231
300 3300025941 Ga0207711_10307975 Ga0207711_103079752 231
301 3300025942 Ga0207689_10004023 Ga0207689_1000402311 231
302 3300025942 Ga0207689_10006812 Ga0207689_100068125 231
303 3300025942 Ga0207689_10116175 Ga0207689_101161752 231
304 3300025945 Ga0207679_10005476 Ga0207679_100054762 231
305 3300025945 Ga0207679_10011985 Ga0207679_100119852 231
306 3300025949 Ga0207667_10007232 Ga0207667_100072325 231
307 3300025960 Ga0207651_10031284 Ga0207651_100312843 231
308 3300025960 Ga0207651_10476235 Ga0207651_104762352 231
309 3300025972 Ga0207668_10081407 Ga0207668_100814072 231
310 3300025972 Ga0207668_10115132 Ga0207668_101151322 231
311 3300025986 Ga0207658_10006716 Ga0207658_100067162 231
312 3300025986 Ga0207658_10061373 Ga0207658_100613732 231
313 3300025986 Ga0207658_10065233 Ga0207658_100652332 231
314 3300025986 Ga0207658_10067716 Ga0207658_100677162 231
315 3300025986 Ga0207658_10104476 Ga0207658_101044762 231
316 3300025986 Ga0207658_10135676 Ga0207658_101356762 231
317 3300025986 Ga0207658_10291351 Ga0207658_102913512 231
318 3300025986 Ga0207658_10752160 Ga0207658_107521602 231
319 3300026035 Ga0207703_10007993 Ga0207703_100079932 231
320 3300026035 Ga0207703_10031311 Ga0207703_100313115 231
321 3300026035 Ga0207703_10034431 Ga0207703_100344312 231
322 3300026035 Ga0207703_10380140 Ga0207703_103801402 231
323 3300026067 Ga0207678_10008512 Ga0207678_100085122 231
324 3300026067 Ga0207678_10153657 Ga0207678_101536573 231
325 3300026075 Ga0207708_10226753 Ga0207708_102267532 231
326 3300026078 Ga0207702_10006007 Ga0207702_100060073 231
327 3300026088 Ga0207641_10125237 Ga0207641_101252373 231
328 3300026088 Ga0207641_10177309 Ga0207641_101773093 231
329 3300026088 Ga0207641_10234578 Ga0207641_102345782 231
330 3300026088 Ga0207641_10345818 Ga0207641_103458182 231
331 3300026089 Ga0207648_10000715 Ga0207648_1000071529 231
332 3300026089 Ga0207648_10027630 Ga0207648_100276304 231
333 3300026089 Ga0207648_10046341 Ga0207648_100463412 231
334 3300026095 Ga0207676_10050276 Ga0207676_100502763 231
335 3300026095 Ga0207676_10085586 Ga0207676_100855862 231
336 3300026095 Ga0207676_10142397 Ga0207676_101423972 231
337 3300026095 Ga0207676_10185756 Ga0207676_101857562 231
338 3300026116 Ga0207674_10015936 Ga0207674_100159367 231
339 3300026116 Ga0207674_10808803 Ga0207674_108088031 231
340 3300026118 Ga0207675_100011665 Ga0207675_1000116654 231
341 3300026118 Ga0207675_100063074 Ga0207675_1000630742 231
342 3300026121 Ga0207683_10000219 Ga0207683_1000021919 231
343 3300026121 Ga0207683_10014592 Ga0207683_100145927 231
344 3300026121 Ga0207683_10160144 Ga0207683_101601443 231
345 3300026121 Ga0207683_10392641 Ga0207683_103926412 231
346 3300026121 Ga0207683_10859069 Ga0207683_108590691 231
347 3300026142 Ga0207698_10108196 Ga0207698_101081962 231
348 3300027665 Ga0209983_1007518 Ga0209983_10075182 231
349 3300027876 Ga0209974_10010689 Ga0209974_100106893 231
350 3300027876 Ga0209974_10027741 Ga0209974_100277411 231
351 3300028379 Ga0268266_10690482 Ga0268266_106904821 231
352 3300028380 Ga0268265_10043796 Ga0268265_100437962 231
353 3300028380 Ga0268265_10150039 Ga0268265_101500392 231
354 3300028381 Ga0268264_10005529 Ga0268264_100055298 231
355 3300028381 Ga0268264_10026951 Ga0268264_100269515 231
356 3300028381 Ga0268264_10174991 Ga0268264_101749912 231
357 3300028381 Ga0268264_10175273 Ga0268264_101752732 231
358 3300031548 Ga0307408_100027666 Ga0307408_1000276662 231
359 3300031548 Ga0307408_100034225 Ga0307408_1000342252 231
360 3300031548 Ga0307408_100035671 Ga0307408_1000356714 231
361 3300031731 Ga0307405_10035194 Ga0307405_100351942 231
362 3300031824 Ga0307413_10007125 Ga0307413_100071255 231
363 3300031852 Ga0307410_10129940 Ga0307410_101299402 231
364 3300031852 Ga0307410_10147647 Ga0307410_101476472 231
365 3300031852 Ga0307410_10376234 Ga0307410_103762341 231
366 3300031901 Ga0307406_10006344 Ga0307406_100063446 231
367 3300031911 Ga0307412_10030179 Ga0307412_100301791 231
368 3300031995 Ga0307409_100009797 Ga0307409_1000097975 231
369 3300032002 Ga0307416_100049300 Ga0307416_1000493002 231
370 3300032004 Ga0307414_10069020 Ga0307414_100690202 231
371 3300032005 Ga0307411_10001127 Ga0307411_100011275 231
372 3300032126 Ga0307415_100050588 Ga0307415_1000505882 231
373 3300035089 Ga0373944_0009231 Ga0373944_0009231_1592_2299 231
374 3300035092 Ga0373952_0000139 Ga0373952_0000139_6612_7403 231
375 3300035111 Ga0373923_0098598 Ga0373923_0098598_422_1129 231
376 3300035691 Ga0373931_0045579 Ga0373931_0045579_1186_1893 231
377 3300035695 Ga0373927_0377892 Ga0373927_0377892_46_879 231
378 3300036401 Ga0373937_0696335 Ga0373937_0696335_245_952 231
379 3300037418 Ga0395900_0159573 Ga0395900_0159573_627_1331 231
380 3300039447 Ga0436361_0240373 Ga0436361_0240373_2117_2830 231
381 3300039447 Ga0436361_0410838 Ga0436361_0410838_709_1422 231
382 3300042876 Ga0451577_0141935 Ga0451577_0141935_1144_1851 231
383 3300045051 Ga0451576_0280596 Ga0451576_0280596_366_1073 231
384 3300045976 Ga0466967_0593959 Ga0466967_0593959_328_1035 231
385 3300048905 Ga0496102_0006489 Ga0496102_0006489_6493_7200 231
386 3300048905 Ga0496102_0021108 Ga0496102_0021108_3293_4033 231
387 3300048906 Ga0496103_0019865 Ga0496103_0019865_2722_3429 231
388 3300048907 Ga0496104_0564221 Ga0496104_0564221_290_997 231
389 3300048909 Ga0496106_0003851 Ga0496106_0003851_9538_10245 231
390 3300048911 Ga0496108_0086157 Ga0496108_0086157_1159_1866 231
391 3300048912 Ga0496109_0158476 Ga0496109_0158476_1283_1990 231
392 3300048917 Ga0496114_0187136 Ga0496114_0187136_432_1139 231
393 3300049569 Ga0501032_0001096 Ga0501032_0001096_8246_8950 231
394 3300049571 Ga0501034_0117331 Ga0501034_0117331_1439_2143 231
395 3300049573 Ga0501037_0194247 Ga0501037_0194247_337_1041 231
396 3300049574 Ga0501038_0005073 Ga0501038_0005073_4198_4905 231
397 3300049823 Ga0501044_0372736 Ga0501044_0372736_278_979 231
398 3300050511 nmdc:mga08y16_543842_c1 nmdc:mga08y16_543842_c1_241_954 231
399 iso_pu_bacteria 2643221654 2644304778 231
400 3300005333 Ga0070677_10102207 Ga0070677_101022072 232
401 3300005340 Ga0070689_100006107 Ga0070689_1000061079 232
402 3300005340 Ga0070689_100031394 Ga0070689_1000313944 232
403 3300005340 Ga0070689_100107539 Ga0070689_1001075394 232
404 3300005364 Ga0070673_100102030 Ga0070673_1001020303 232
405 3300005366 Ga0070659_100488884 Ga0070659_1004888842 232
406 3300005434 Ga0070709_10094017 Ga0070709_100940172 232
407 3300005543 Ga0070672_100018765 Ga0070672_1000187656 232
408 3300005547 Ga0070693_100002437 Ga0070693_1000024372 232
409 3300005547 Ga0070693_100031171 Ga0070693_1000311713 232
410 3300005563 Ga0068855_100025708 Ga0068855_1000257085 232
411 3300005577 Ga0068857_100077453 Ga0068857_1000774534 232
412 3300005615 Ga0070702_100125329 Ga0070702_1001253292 232
413 3300005617 Ga0068859_100276118 Ga0068859_1002761182 232
414 3300005617 Ga0068859_100445009 Ga0068859_1004450092 232
415 3300005618 Ga0068864_100234601 Ga0068864_1002346012 232
416 3300005618 Ga0068864_100260593 Ga0068864_1002605932 232
417 3300005842 Ga0068858_100037909 Ga0068858_1000379094 232
418 3300005842 Ga0068858_100377723 Ga0068858_1003777231 232
419 3300006051 Ga0075364_10004928 Ga0075364_100049284 232
420 3300006058 Ga0075432_10012877 Ga0075432_100128774 232
421 3300006186 Ga0075369_10000707 Ga0075369_1000070710 232
422 3300006195 Ga0075366_10009565 Ga0075366_100095653 232
423 3300006237 Ga0097621_100074566 Ga0097621_1000745663 232
424 3300006237 Ga0097621_100243257 Ga0097621_1002432572 232
425 3300006237 Ga0097621_100312364 Ga0097621_1003123642 232
426 3300006358 Ga0068871_100142299 Ga0068871_1001422992 232
427 3300006358 Ga0068871_100229181 Ga0068871_1002291813 232
428 3300006852 Ga0075433_10255583 Ga0075433_102555832 232
429 3300006931 Ga0097620_100276108 Ga0097620_1002761082 232
430 3300006931 Ga0097620_100444995 Ga0097620_1004449952 232
431 3300009093 Ga0105240_10014966 Ga0105240_100149668 232
432 3300009093 Ga0105240_10080044 Ga0105240_100800445 232
433 3300009093 Ga0105240_10119737 Ga0105240_101197372 232
434 3300009094 Ga0111539_10003518 Ga0111539_1000351812 232
435 3300009098 Ga0105245_10068838 Ga0105245_100688384 232
436 3300009098 Ga0105245_10256834 Ga0105245_102568343 232
437 3300009148 Ga0105243_10162309 Ga0105243_101623092 232
438 3300009148 Ga0105243_10343154 Ga0105243_103431542 232
439 3300009176 Ga0105242_10001143 Ga0105242_1000114321 232
440 3300009176 Ga0105242_10038520 Ga0105242_100385204 232
441 3300009176 Ga0105242_10235123 Ga0105242_102351232 232
442 3300009177 Ga0105248_10041073 Ga0105248_100410736 232
443 3300009177 Ga0105248_10252297 Ga0105248_102522972 232
444 3300009177 Ga0105248_10326271 Ga0105248_103262712 232
445 3300009177 Ga0105248_10585954 Ga0105248_105859542 232
446 3300009551 Ga0105238_10165929 Ga0105238_101659292 232
447 3300013102 Ga0157371_10421718 Ga0157371_104217182 232
448 3300013296 Ga0157374_10068870 Ga0157374_100688704 232
449 3300013297 Ga0157378_10054835 Ga0157378_100548354 232
450 3300013297 Ga0157378_10856427 Ga0157378_108564272 232
451 3300013306 Ga0163162_10098300 Ga0163162_100983004 232
452 3300013306 Ga0163162_10153042 Ga0163162_101530422 232
453 3300013306 Ga0163162_10242891 Ga0163162_102428912 232
454 3300013308 Ga0157375_10079029 Ga0157375_100790294 232
455 3300014745 Ga0157377_10040617 Ga0157377_100406172 232
456 3300014968 Ga0157379_10319534 Ga0157379_103195342 232
457 3300014969 Ga0157376_10117718 Ga0157376_101177183 232
458 3300025885 Ga0207653_10020201 Ga0207653_100202013 232
459 3300025901 Ga0207688_10035487 Ga0207688_100354874 232
460 3300025906 Ga0207699_10212619 Ga0207699_102126192 232
461 3300025908 Ga0207643_10017909 Ga0207643_100179094 232
462 3300025908 Ga0207643_10019664 Ga0207643_100196645 232
463 3300025926 Ga0207659_10100240 Ga0207659_101002402 232
464 3300025927 Ga0207687_10244340 Ga0207687_102443402 232
465 3300025928 Ga0207700_10050944 Ga0207700_100509444 232
466 3300025932 Ga0207690_10714454 Ga0207690_107144541 232
467 3300025934 Ga0207686_10021789 Ga0207686_100217895 232
468 3300025934 Ga0207686_10030246 Ga0207686_100302462 232
469 3300025934 Ga0207686_10091602 Ga0207686_100916023 232
470 3300025935 Ga0207709_10214830 Ga0207709_102148302 232
471 3300025935 Ga0207709_10231332 Ga0207709_102313321 232
472 3300025936 Ga0207670_10002904 Ga0207670_1000290410 232
473 3300025936 Ga0207670_10072433 Ga0207670_100724333 232
474 3300025960 Ga0207651_10107930 Ga0207651_101079303 232
475 3300025961 Ga0207712_10119717 Ga0207712_101197174 232
476 3300026023 Ga0207677_10121616 Ga0207677_101216163 232
477 3300026089 Ga0207648_10008800 Ga0207648_100088009 232
478 3300026116 Ga0207674_10052798 Ga0207674_100527985 232
479 3300026118 Ga0207675_100124208 Ga0207675_1001242083 232
480 3300026121 Ga0207683_10073123 Ga0207683_100731234 232
481 3300027907 Ga0207428_10009022 Ga0207428_100090223 232
482 3300028379 Ga0268266_10410114 Ga0268266_104101142 232
483 3300031239 Ga0265328_10000001 Ga0265328_10000001240 232
484 3300031344 Ga0265316_10050849 Ga0265316_100508494 232
485 3300031548 Ga0307408_100551194 Ga0307408_1005511942 232
486 3300031665 Ga0316575_10006948 Ga0316575_100069483 232
487 3300031691 Ga0316579_10000184 Ga0316579_100001846 232
488 3300031728 Ga0316578_10000742 Ga0316578_100007425 232
489 3300031731 Ga0307405_10195036 Ga0307405_101950362 232
490 3300032002 Ga0307416_100014141 Ga0307416_1000141413 232
491 3300032002 Ga0307416_100170681 Ga0307416_1001706813 232
492 3300032133 Ga0316583_10002422 Ga0316583_100024227 232
493 3300034957 Ga0373938_0077599 Ga0373938_0077599_77_790 232
494 3300035119 Ga0373956_0039698 Ga0373956_0039698_987_1706 232
495 3300035172 Ga0373955_0044117 Ga0373955_0044117_1448_2167 232
496 3300036401 Ga0373937_0042517 Ga0373937_0042517_3237_3956 232
497 3300036647 Ga0316582_0002406 Ga0316582_0002406_5861_6574 232
498 3300037418 Ga0395900_0037247 Ga0395900_0037247_2224_2937 232
499 3300037471 Ga0395905_0048192 Ga0395905_0048192_287_1000 232
500 3300041509 Ga0451843_0708525 Ga0451843_0708525_1426_2139 232
501 3300042001 Ga0439441_000060 Ga0439441_000060_5893_6606 232
502 3300042156 Ga0439446_0020440 Ga0439446_0020440_959_1672 232
503 3300042876 Ga0451577_0110938 Ga0451577_0110938_404_1117 232
504 3300042876 Ga0451577_0169456 Ga0451577_0169456_678_1388 232
505 3300042876 Ga0451577_0466325 Ga0451577_0466325_28_741 232
506 3300044684 Ga0466966_0089452 Ga0466966_0089452_471_1184 232
507 3300044712 Ga0453684_0000623 Ga0453684_0000623_55571_56284 232
508 3300044712 Ga0453684_0062601 Ga0453684_0062601_1880_2593 232
509 3300044712 Ga0453684_0570297 Ga0453684_0570297_241_954 232
510 3300044842 Ga0466957_0004733 Ga0466957_0004733_6300_7013 232
511 3300045051 Ga0451576_0454519 Ga0451576_0454519_388_1113 232
512 3300045836 Ga0466958_0035041 Ga0466958_0035041_698_1411 232
513 3300046462 Ga0495651_0239803 Ga0495651_0239803_282_1001 232
514 3300046463 Ga0495653_0115406 Ga0495653_0115406_331_1050 232
515 3300046476 Ga0495662_0109903 Ga0495662_0109903_437_1156 232
516 3300046477 Ga0495664_0341495 Ga0495664_0341495_118_837 232
517 3300046529 Ga0495652_0017734 Ga0495652_0017734_3202_3921 232
518 3300046536 Ga0495587_0046497 Ga0495587_0046497_191_910 232
519 3300046543 Ga0495645_0291511 Ga0495645_0291511_38_757 232
520 3300046559 Ga0495667_0009652 Ga0495667_0009652_946_1665 232
521 3300046642 Ga0495634_0131675 Ga0495634_0131675_315_1034 232
522 3300046675 Ga0495657_0052826 Ga0495657_0052826_1934_2653 232
523 3300046678 Ga0495599_0054613 Ga0495599_0054613_1612_2331 232
524 3300046679 Ga0495623_0026340 Ga0495623_0026340_3000_3719 232
525 3300047317 Ga0495604_0081249 Ga0495604_0081249_456_1175 232
526 3300047322 Ga0495680_0067770 Ga0495680_0067770_855_1574 232
527 3300047444 Ga0495675_0110969 Ga0495675_0110969_87_806 232
528 3300049568 Ga0501031_0265662 Ga0501031_0265662_359_1072 232
529 3300049572 Ga0501036_0058036 Ga0501036_0058036_437_1150 232
530 3300049573 Ga0501037_0125666 Ga0501037_0125666_23_736 232
531 3300049574 Ga0501038_0039146 Ga0501038_0039146_280_993 232
532 3300049575 Ga0501039_0013309 Ga0501039_0013309_3829_4542 232
533 3300049575 Ga0501039_0054123 Ga0501039_0054123_1028_1741 232
534 3300049576 Ga0501040_0014856 Ga0501040_0014856_2349_3062 232
535 3300049577 Ga0501041_0020796 Ga0501041_0020796_2495_3208 232
536 3300049577 Ga0501041_0109163 Ga0501041_0109163_782_1495 232
537 3300049579 Ga0501043_0184872 Ga0501043_0184872_594_1307 232
538 3300049580 Ga0501046_0432716 Ga0501046_0432716_17_730 232
539 3300049582 Ga0501048_0034588 Ga0501048_0034588_2841_3554 232
540 3300049587 Ga0501071_0044189 Ga0501071_0044189_2129_2842 232
541 3300049587 Ga0501071_0252297 Ga0501071_0252297_189_902 232
542 3300049588 Ga0501072_0001755 Ga0501072_0001755_11742_12455 232
543 3300049588 Ga0501072_0236394 Ga0501072_0236394_145_858 232
544 3300049590 Ga0501074_0127231 Ga0501074_0127231_612_1325 232
545 3300049591 Ga0501075_0077275 Ga0501075_0077275_769_1482 232
546 3300049591 Ga0501075_0079003 Ga0501075_0079003_1195_1908 232
547 3300049592 Ga0501076_0000185 Ga0501076_0000185_29348_30061 232
548 3300049592 Ga0501076_0349873 Ga0501076_0349873_345_1058 232
549 3300049741 Ga0501079_0053365 Ga0501079_0053365_728_1441 232
550 3300049742 Ga0501080_0096675 Ga0501080_0096675_1389_2102 232
551 3300049743 Ga0501081_0001180 Ga0501081_0001180_14919_15632 232
552 3300049743 Ga0501081_0187973 Ga0501081_0187973_313_1026 232
553 3300049823 Ga0501044_0419900 Ga0501044_0419900_267_980 232
554 3300050491 nmdc:mga00v17_120563_c1 nmdc:mga00v17_120563_c1_62_892 232
555 3300050491 nmdc:mga00v17_1746_c1 nmdc:mga00v17_1746_c1_4477_5184 232
556 3300050493 nmdc:mga0k408_9828_c1 nmdc:mga0k408_9828_c1_2133_2840 232
557 3300050509 nmdc:mga0qj67_16651_c1 nmdc:mga0qj67_16651_c1_2187_2894 232
558 3300050509 nmdc:mga0qj67_259814_c1 nmdc:mga0qj67_259814_c1_164_865 232
559 3300050510 nmdc:mga06r32_332786_c1 nmdc:mga06r32_332786_c1_639_1340 232
560 3300050511 nmdc:mga08y16_13025_c1 nmdc:mga08y16_13025_c1_457_1284 232
561 3300053077 Ga0495601_0143273 Ga0495601_0143273_808_1527 232
562 3300053085 Ga0495619_0038614 Ga0495619_0038614_1719_2438 232
563 3300053096 Ga0500641_0021741 Ga0500641_0021741_1259_1972 232
564 3300054114 Ga0501084_0104315 Ga0501084_0104315_580_1293 232
565 3300060353 Ga0501082_0071382 Ga0501082_0071382_222_935 232
566 3300061734 Ga0530510_0047085 Ga0530510_0047085_1761_2474 232
567 3300005327 Ga0070658_10095822 Ga0070658_100958223 233
568 3300005327 Ga0070658_10203122 Ga0070658_102031223 233
569 3300005327 Ga0070658_10480851 Ga0070658_104808512 233
570 3300005345 Ga0070692_10090688 Ga0070692_100906883 233
571 3300005355 Ga0070671_100151526 Ga0070671_1001515263 233
572 3300005364 Ga0070673_100385599 Ga0070673_1003855991 233
573 3300005458 Ga0070681_10308802 Ga0070681_103088021 233
574 3300005466 Ga0070685_10090259 Ga0070685_100902592 233
575 3300005530 Ga0070679_100136476 Ga0070679_1001364762 233
576 3300005530 Ga0070679_100630482 Ga0070679_1006304821 233
577 3300005539 Ga0068853_100121579 Ga0068853_1001215793 233
578 3300005546 Ga0070696_100483194 Ga0070696_1004831942 233
579 3300005547 Ga0070693_100243903 Ga0070693_1002439032 233
580 3300005547 Ga0070693_100418612 Ga0070693_1004186122 233
581 3300005563 Ga0068855_100013140 Ga0068855_1000131406 233
582 3300005563 Ga0068855_100043030 Ga0068855_1000430303 233
583 3300005616 Ga0068852_100002800 Ga0068852_1000028004 233
584 3300005616 Ga0068852_100009134 Ga0068852_1000091348 233
585 3300005834 Ga0068851_10010798 Ga0068851_100107984 233
586 3300005834 Ga0068851_10091206 Ga0068851_100912062 233
587 3300005985 Ga0081539_10026601 Ga0081539_100266013 233
588 3300006358 Ga0068871_100025542 Ga0068871_1000255424 233
589 3300006871 Ga0075434_100801482 Ga0075434_1008014821 233
590 3300007076 Ga0075435_100438411 Ga0075435_1004384112 233
591 3300009093 Ga0105240_10031185 Ga0105240_100311851 233
592 3300009093 Ga0105240_10097440 Ga0105240_100974404 233
593 3300009093 Ga0105240_10226210 Ga0105240_102262102 233
594 3300009093 Ga0105240_10227047 Ga0105240_102270472 233
595 3300009098 Ga0105245_10292856 Ga0105245_102928562 233
596 3300009174 Ga0105241_10489623 Ga0105241_104896232 233
597 3300013104 Ga0157370_10005552 Ga0157370_1000555210 233
598 3300013104 Ga0157370_10305119 Ga0157370_103051192 233
599 3300013105 Ga0157369_10117754 Ga0157369_101177543 233
600 3300013296 Ga0157374_10195957 Ga0157374_101959572 233
601 3300013307 Ga0157372_10199703 Ga0157372_101997033 233
602 3300014326 Ga0157380_10865171 Ga0157380_108651711 233
603 3300025321 Ga0207656_10002499 Ga0207656_100024993 233
604 3300025909 Ga0207705_10105736 Ga0207705_101057362 233
605 3300025909 Ga0207705_10294571 Ga0207705_102945712 233
606 3300025911 Ga0207654_10167275 Ga0207654_101672752 233
607 3300025913 Ga0207695_10017450 Ga0207695_100174503 233
608 3300025913 Ga0207695_10069360 Ga0207695_100693604 233
609 3300025913 Ga0207695_10085430 Ga0207695_100854304 233
610 3300025921 Ga0207652_10027918 Ga0207652_100279183 233
611 3300025921 Ga0207652_10053149 Ga0207652_100531493 233
612 3300025924 Ga0207694_10498968 Ga0207694_104989681 233
613 3300025927 Ga0207687_10252550 Ga0207687_102525502 233
614 3300025944 Ga0207661_10688938 Ga0207661_106889382 233
615 3300025949 Ga0207667_10025479 Ga0207667_100254794 233
616 3300025949 Ga0207667_10084058 Ga0207667_100840584 233
617 3300026023 Ga0207677_10018826 Ga0207677_100188263 233
618 3300026041 Ga0207639_10112452 Ga0207639_101124522 233
619 3300026078 Ga0207702_10343008 Ga0207702_103430082 233
620 3300026142 Ga0207698_10016778 Ga0207698_100167782 233
621 3300026142 Ga0207698_10084170 Ga0207698_100841704 233
622 3300027876 Ga0209974_10011124 Ga0209974_100111243 233
623 3300032002 Ga0307416_100030432 Ga0307416_1000304323 233
624 3300032002 Ga0307416_100478817 Ga0307416_1004788172 233
625 3300037068 Ga0373925_0145458 Ga0373925_0145458_688_1404 233
626 3300039437 Ga0436365_0250047 Ga0436365_0250047_350_1069 233
627 3300039437 Ga0436365_1085190 Ga0436365_1085190_533_1249 233
628 3300042126 Ga0450888_007440 Ga0450888_007440_258_989 233
629 3300042876 Ga0451577_0482143 Ga0451577_0482143_306_1019 233
630 3300045051 Ga0451576_0053704 Ga0451576_0053704_2287_3003 233
631 3300045051 Ga0451576_0061264 Ga0451576_0061264_1753_2469 233
632 3300045051 Ga0451576_0401191 Ga0451576_0401191_281_1015 233
633 3300046539 Ga0495621_0004663 Ga0495621_0004663_3003_3719 233
634 3300048907 Ga0496104_0015343 Ga0496104_0015343_4081_4797 233
635 3300048912 Ga0496109_0563803 Ga0496109_0563803_342_1058 233
636 3300048913 Ga0496110_0039612 Ga0496110_0039612_2155_2871 233
637 3300049571 Ga0501034_0439052 Ga0501034_0439052_402_1115 233
638 3300049572 Ga0501036_0482543 Ga0501036_0482543_48_782 233
639 3300049572 Ga0501036_0505937 Ga0501036_0505937_157_915 233
640 3300049580 Ga0501046_0052373 Ga0501046_0052373_804_1517 233
641 3300049581 Ga0501047_0001767 Ga0501047_0001767_19387_20100 233
642 3300049581 Ga0501047_0429895 Ga0501047_0429895_183_896 233
643 3300049584 Ga0501068_0074422 Ga0501068_0074422_223_936 233
644 3300049585 Ga0501069_0014023 Ga0501069_0014023_29_742 233
645 3300049588 Ga0501072_0549255 Ga0501072_0549255_28_786 233
646 3300049589 Ga0501073_0000384 Ga0501073_0000384_24290_25003 233
647 3300049589 Ga0501073_0319761 Ga0501073_0319761_92_805 233
648 3300049590 Ga0501074_0000123 Ga0501074_0000123_12853_13566 233
649 3300049592 Ga0501076_0505825 Ga0501076_0505825_191_949 233
650 3300049741 Ga0501079_0004001 Ga0501079_0004001_7771_8484 233
651 3300049742 Ga0501080_0008926 Ga0501080_0008926_1568_2281 233
652 3300049742 Ga0501080_0025348 Ga0501080_0025348_267_980 233
653 3300049744 Ga0501083_0000252 Ga0501083_0000252_24033_24746 233
654 3300050512 nmdc:mga0n895_203532_c1 nmdc:mga0n895_203532_c1_751_1467 233
655 3300050512 nmdc:mga0n895_922322_c1 nmdc:mga0n895_922322_c1_74_790 233
656 3300054114 Ga0501084_0369880 Ga0501084_0369880_454_1167 233
657 3300003322 rootL2_10193919 rootL2_101939192 234
658 3300005338 Ga0068868_100052336 Ga0068868_1000523362 234
659 3300005367 Ga0070667_100005528 Ga0070667_1000055287 234
660 3300005445 Ga0070708_100122759 Ga0070708_1001227591 234
661 3300005456 Ga0070678_100249834 Ga0070678_1002498341 234
662 3300005467 Ga0070706_100002403 Ga0070706_1000024034 234
663 3300005548 Ga0070665_100075505 Ga0070665_1000755052 234
664 3300005617 Ga0068859_100073533 Ga0068859_1000735332 234
665 3300005617 Ga0068859_100152412 Ga0068859_1001524121 234
666 3300005618 Ga0068864_100362969 Ga0068864_1003629691 234
667 3300005841 Ga0068863_100172673 Ga0068863_1001726732 234
668 3300005843 Ga0068860_100348405 Ga0068860_1003484052 234
669 3300006042 Ga0075368_10096022 Ga0075368_100960222 234
670 3300006186 Ga0075369_10051633 Ga0075369_100516333 234
671 3300006195 Ga0075366_10097921 Ga0075366_100979212 234
672 3300006237 Ga0097621_100183660 Ga0097621_1001836602 234
673 3300006353 Ga0075370_10009479 Ga0075370_100094795 234
674 3300006358 Ga0068871_100263412 Ga0068871_1002634122 234
675 3300006358 Ga0068871_100410010 Ga0068871_1004100102 234
676 3300006931 Ga0097620_100073530 Ga0097620_1000735302 234
677 3300006931 Ga0097620_100152410 Ga0097620_1001524101 234
678 3300009098 Ga0105245_10392217 Ga0105245_103922172 234
679 3300013308 Ga0157375_10188235 Ga0157375_101882352 234
680 3300014968 Ga0157379_10012835 Ga0157379_100128357 234
681 3300014968 Ga0157379_10111286 Ga0157379_101112863 234
682 3300014968 Ga0157379_10213847 Ga0157379_102138471 234
683 3300025927 Ga0207687_10615377 Ga0207687_106153771 234
684 3300025986 Ga0207658_10000919 Ga0207658_100009198 234
685 3300026088 Ga0207641_10153229 Ga0207641_101532292 234
686 3300028794 Ga0307515_10031745 Ga0307515_100317452 234
687 3300031456 Ga0307513_10003123 Ga0307513_100031232 234
688 3300031507 Ga0307509_10082106 Ga0307509_100821063 234
689 3300031507 Ga0307509_10085108 Ga0307509_100851082 234
690 3300031616 Ga0307508_10000163 Ga0307508_1000016352 234
691 3300033180 Ga0307510_10021393 Ga0307510_100213935 234
692 3300033180 Ga0307510_10157452 Ga0307510_101574522 234
693 3300033180 Ga0307510_10178262 Ga0307510_101782622 234
694 3300042876 Ga0451577_0007328 Ga0451577_0007328_223_933 234
695 3300044712 Ga0453684_0143838 Ga0453684_0143838_472_1209 234
696 3300044712 Ga0453684_0966980 Ga0453684_0966980_69_809 234
697 3300046454 Ga0495592_0000222 Ga0495592_0000222_31710_32414 234
698 3300046471 Ga0495650_0078252 Ga0495650_0078252_447_1241 234
699 3300046512 Ga0495610_0101165 Ga0495610_0101165_50_754 234
700 3300046692 Ga0495671_0044143 Ga0495671_0044143_1148_1858 234
701 3300048905 Ga0496102_0014353 Ga0496102_0014353_3903_4616 234
702 3300050493 nmdc:mga0k408_178115_c1 nmdc:mga0k408_178115_c1_440_1153 234
703 3300050493 nmdc:mga0k408_85851_c1 nmdc:mga0k408_85851_c1_423_1130 234
704 3300050496 nmdc:mga07m45_86384_c1 nmdc:mga07m45_86384_c1_642_1355 234
705 3300053118 Ga0500594_0000988 Ga0500594_0000988_1577_2281 234
706 3300053123 Ga0500614_019266 Ga0500614_019266_341_1045 234
707 3300053131 Ga0500652_041329 Ga0500652_041329_679_1386 234
708 3300053133 Ga0500655_004929 Ga0500655_004929_252_956 234
709 3300053136 Ga0500559_0000011 Ga0500559_0000011_38599_39303 234
710 3300053138 Ga0500564_099218 Ga0500564_099218_343_1047 234
711 3300053155 Ga0500620_100742 Ga0500620_100742_202_906 234
712 3300053156 Ga0500622_0002322 Ga0500622_0002322_12991_13695 234
713 3300053177 Ga0500636_0245373 Ga0500636_0245373_55_762 234
714 3300053739 Ga0500587_002239 Ga0500587_002239_1221_1925 234
715 iso_pu_bacteria 2919704043 2919706170 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07722

Peptidase_C26

Peptidase C26

110

164

0.92

PF00117

GATase

Glutamine amidotransferase class-I

61

233

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3p-assembly1.cif.gz_A crystal structure of glutamine amido transferase from methylobacillus flagellatus 0.9266 1 233
3m3p-assembly1.cif.gz_A crystal structure of glutamine amido transferase from methylobacillus flagellatus 0.9189 1 233
3l7n-assembly1.cif.gz_A crystal structure of smu.1228c 0.9156 3 230
1o1y-assembly1.cif.gz_A crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution 0.8903 3 231
1o1y-assembly1.cif.gz_A crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution 0.8647 3 231
ID Description Score Start End Superfamily
3l83A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9261 3 233 3.40.50.880
3l7nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9156 3 230 3.40.50.880
3l83A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9106 3 233 3.40.50.880
af_Q4DQH7_1_252_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8888 1 204 3.40.50.880
1o1yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8813 3 230 3.40.50.880
ID Description Score Start End GO Terms
AF-I0HSH0-F1-model_v4 Glutamine amidotransferase class-I 0.9994 1 233 GO:0005829
GO:0006541
GO:0016740
AF-A0A4Q6FGP1-F1-model_v4 deleted 0.9944 2 95
AF-I0HSH0-F1-model_v4 Glutamine amidotransferase class-I 0.9909 1 233 GO:0005829
GO:0006541
GO:0016740
AF-A0A2N2UA71-F1-model_v4 deleted 0.9856 2 233
AF-A0A7W0JT62-F1-model_v4 Type 1 glutamine amidotransferase 0.983 1 102 GO:0005829
GO:0016740

Feature Viewer

pLDDT pTM Quality
96.68 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map