F476998
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 715 | 326 | 704 | 237 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0377892|Ga0373927_0377892_46_879 |
| Length | 277 |
| Sequence | MLTIALSLNRPTTDMLVAHAVVQASPPAAIIIATVFFLRDIMRPVLVFRHSPTEGPGYFTTFLDRHGIPWKLVRIDAGDSVPENLNGASGVCLMGGPMSVNDDLPWIPPLLALIRQAVASDIPVIGHCLGGQLMSKALGGTVGANPVKEIGWGDVRITDADAARSWLGNTTQPMLAFHWHGETFSLPPGATRLLDSAFCANQAYVLNDRHIGMQCHVEMTPELIASWCDNGAAEIAVSDSPGVQSPDAIQADLPTRTARLHELADKIYSRWIQGLRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 2 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 3 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 4 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 5 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 6 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 7 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 8 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 9 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 10 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 182 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 183 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 186 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 195 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 196 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 197 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 198 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 201 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 207 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 208 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 217 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 218 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 219 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 220 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 221 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 224 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 225 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 226 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 227 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 228 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 229 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 236 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 237 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 238 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 239 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 240 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 266 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 267 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 305 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 314 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 315 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 316 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 317 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 318 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 319 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 320 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 321 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 323 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 326 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.46 |
| Metatranscriptomes | 0 |
| Isolates | 1.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.5 |
| Nodule | 0 |
| Rhizoplane | 1.82 |
| Rhizosphere | 91.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10193919 | 3300003322 | Bacteria | 1154 |
| 2 | Ga0070658_10095822 | 3300005327 | Bacteria | 2450 |
| 3 | Ga0070658_10203122 | 3300005327 | Bacteria | 1672 |
| 4 | Ga0070658_10480851 | 3300005327 | Bacteria | 1072 |
| 5 | Ga0070676_10000988 | 3300005328 | Bacteria | 14116 |
| 6 | Ga0070676_10032638 | 3300005328 | Bacteria | 2984 |
| 7 | Ga0070676_10059241 | 3300005328 | Bacteria | 2271 |
| 8 | Ga0070676_10197125 | 3300005328 | Bacteria | 1318 |
| 9 | Ga0070690_100223598 | 3300005330 | Bacteria | 1320 |
| 10 | Ga0070670_100011047 | 3300005331 | Bacteria | 7714 |
| 11 | Ga0070670_100027074 | 3300005331 | Bacteria | 4931 |
| 12 | Ga0070670_100029619 | 3300005331 | Bacteria | 4713 |
| 13 | Ga0070670_100128779 | 3300005331 | Bacteria | 2185 |
| 14 | Ga0070670_100234413 | 3300005331 | Bacteria | 1597 |
| 15 | Ga0070670_100808522 | 3300005331 | Bacteria | 847 |
| 16 | Ga0070677_10041781 | 3300005333 | Bacteria | 1812 |
| 17 | Ga0070677_10102207 | 3300005333 | Bacteria | 1266 |
| 18 | Ga0068869_100005217 | 3300005334 | Bacteria | 8157 |
| 19 | Ga0068869_100007185 | 3300005334 | Bacteria | 7099 |
| 20 | Ga0070666_10001990 | 3300005335 | Bacteria | 12436 |
| 21 | Ga0070666_10081007 | 3300005335 | Bacteria | 2219 |
| 22 | Ga0070666_10546603 | 3300005335 | Bacteria | 842 |
| 23 | Ga0070680_100459243 | 3300005336 | Bacteria | 1088 |
| 24 | Ga0070680_100651511 | 3300005336 | Bacteria | 905 |
| 25 | Ga0068868_100007819 | 3300005338 | Bacteria | 7633 |
| 26 | Ga0068868_100052336 | 3300005338 | Bacteria | 3214 |
| 27 | Ga0068868_100351500 | 3300005338 | Bacteria | 1262 |
| 28 | Ga0070660_100001840 | 3300005339 | Bacteria | 14582 |
| 29 | Ga0070689_100006107 | 3300005340 | Bacteria | 8301 |
| 30 | Ga0070689_100030639 | 3300005340 | Bacteria | 4084 |
| 31 | Ga0070689_100031394 | 3300005340 | Bacteria | 4036 |
| 32 | Ga0070689_100057351 | 3300005340 | Bacteria | 3022 |
| 33 | Ga0070689_100107539 | 3300005340 | Bacteria | 2214 |
| 34 | Ga0070687_100075003 | 3300005343 | Bacteria | 1828 |
| 35 | Ga0070661_100007211 | 3300005344 | Bacteria | 7662 |
| 36 | Ga0070661_100269692 | 3300005344 | Bacteria | 1318 |
| 37 | Ga0070692_10090688 | 3300005345 | Bacteria | 1661 |
| 38 | Ga0070668_100007290 | 3300005347 | Bacteria | 8205 |
| 39 | Ga0070668_100163744 | 3300005347 | Bacteria | 1806 |
| 40 | Ga0070668_100393515 | 3300005347 | Bacteria | 1182 |
| 41 | Ga0070669_100001481 | 3300005353 | Bacteria | 16988 |
| 42 | Ga0070669_100151055 | 3300005353 | Bacteria | 1798 |
| 43 | Ga0070669_100177476 | 3300005353 | Bacteria | 1664 |
| 44 | Ga0070675_100003903 | 3300005354 | Bacteria | 11300 |
| 45 | Ga0070675_100003952 | 3300005354 | Bacteria | 11238 |
| 46 | Ga0070675_100016457 | 3300005354 | Bacteria | 5870 |
| 47 | Ga0070675_100163285 | 3300005354 | Bacteria | 1917 |
| 48 | Ga0070671_100001117 | 3300005355 | Bacteria | 19906 |
| 49 | Ga0070671_100017774 | 3300005355 | Bacteria | 5766 |
| 50 | Ga0070671_100095852 | 3300005355 | Bacteria | 2487 |
| 51 | Ga0070671_100151526 | 3300005355 | Bacteria | 1958 |
| 52 | Ga0070674_100028183 | 3300005356 | Bacteria | 3687 |
| 53 | Ga0070674_100275437 | 3300005356 | Bacteria | 1332 |
| 54 | Ga0070673_100026652 | 3300005364 | Bacteria | 4272 |
| 55 | Ga0070673_100034104 | 3300005364 | Bacteria | 3848 |
| 56 | Ga0070673_100036746 | 3300005364 | Bacteria | 3726 |
| 57 | Ga0070673_100102030 | 3300005364 | Bacteria | 2365 |
| 58 | Ga0070673_100360607 | 3300005364 | Bacteria | 1292 |
| 59 | Ga0070673_100385599 | 3300005364 | Bacteria | 1250 |
| 60 | Ga0070688_100105802 | 3300005365 | Bacteria | 1863 |
| 61 | Ga0070688_100147238 | 3300005365 | Bacteria | 1606 |
| 62 | Ga0070659_100003840 | 3300005366 | Bacteria | 10713 |
| 63 | Ga0070659_100206080 | 3300005366 | Bacteria | 1620 |
| 64 | Ga0070659_100488884 | 3300005366 | Bacteria | 1048 |
| 65 | Ga0070667_100005528 | 3300005367 | Bacteria | 10550 |
| 66 | Ga0070667_100006553 | 3300005367 | Bacteria | 9678 |
| 67 | Ga0070667_100087072 | 3300005367 | Bacteria | 2681 |
| 68 | Ga0070667_100138879 | 3300005367 | Bacteria | 2126 |
| 69 | Ga0070667_100165886 | 3300005367 | Bacteria | 1948 |
| 70 | Ga0070667_100242661 | 3300005367 | Bacteria | 1609 |
| 71 | Ga0070667_100501969 | 3300005367 | Bacteria | 1112 |
| 72 | Ga0070667_100510692 | 3300005367 | Bacteria | 1102 |
| 73 | Ga0070709_10064574 | 3300005434 | Bacteria | 2341 |
| 74 | Ga0070709_10094017 | 3300005434 | Bacteria | 1983 |
| 75 | Ga0070709_10356203 | 3300005434 | Unclassified | 1082 |
| 76 | Ga0070705_100014585 | 3300005440 | Bacteria | 4046 |
| 77 | Ga0070700_100028894 | 3300005441 | Bacteria | 3303 |
| 78 | Ga0070700_100105481 | 3300005441 | Bacteria | 1864 |
| 79 | Ga0070694_100137251 | 3300005444 | Bacteria | 1773 |
| 80 | Ga0070708_100122759 | 3300005445 | Bacteria | 2398 |
| 81 | Ga0070663_100100178 | 3300005455 | Bacteria | 2161 |
| 82 | Ga0070678_100001068 | 3300005456 | Bacteria | 14327 |
| 83 | Ga0070678_100074216 | 3300005456 | Bacteria | 2555 |
| 84 | Ga0070678_100249834 | 3300005456 | Bacteria | 1487 |
| 85 | Ga0070662_100000568 | 3300005457 | Bacteria | 22525 |
| 86 | Ga0070662_100026453 | 3300005457 | Bacteria | 4019 |
| 87 | Ga0070681_10022463 | 3300005458 | Bacteria | 6334 |
| 88 | Ga0070681_10308802 | 3300005458 | Bacteria | 1491 |
| 89 | Ga0068867_100008617 | 3300005459 | Bacteria | 7201 |
| 90 | Ga0070685_10090259 | 3300005466 | Bacteria | 1853 |
| 91 | Ga0070706_100002403 | 3300005467 | Bacteria | 18889 |
| 92 | Ga0070679_100036286 | 3300005530 | Bacteria | 4892 |
| 93 | Ga0070679_100136476 | 3300005530 | Bacteria | 2434 |
| 94 | Ga0070679_100630482 | 3300005530 | Bacteria | 1015 |
| 95 | Ga0068853_100007620 | 3300005539 | Bacteria | 8673 |
| 96 | Ga0068853_100037771 | 3300005539 | Bacteria | 4111 |
| 97 | Ga0068853_100121579 | 3300005539 | Bacteria | 2330 |
| 98 | Ga0068853_100141253 | 3300005539 | Bacteria | 2162 |
| 99 | Ga0068853_100577885 | 3300005539 | Bacteria | 1066 |
| 100 | Ga0070672_100002490 | 3300005543 | Bacteria | 11720 |
| 101 | Ga0070672_100018765 | 3300005543 | Bacteria | 5009 |
| 102 | Ga0070672_100020253 | 3300005543 | Bacteria | 4848 |
| 103 | Ga0070672_100030145 | 3300005543 | Bacteria | 4072 |
| 104 | Ga0070672_100040170 | 3300005543 | Bacteria | 3587 |
| 105 | Ga0070672_100057707 | 3300005543 | Bacteria | 3048 |
| 106 | Ga0070686_100491366 | 3300005544 | Bacteria | 951 |
| 107 | Ga0070696_100483194 | 3300005546 | Bacteria | 983 |
| 108 | Ga0070693_100002437 | 3300005547 | Bacteria | 8566 |
| 109 | Ga0070693_100031171 | 3300005547 | Bacteria | 2920 |
| 110 | Ga0070693_100243903 | 3300005547 | Bacteria | 1188 |
| 111 | Ga0070693_100418612 | 3300005547 | Bacteria | 933 |
| 112 | Ga0070665_100015080 | 3300005548 | Bacteria | 7759 |
| 113 | Ga0070665_100075505 | 3300005548 | Bacteria | 3377 |
| 114 | Ga0070665_100148849 | 3300005548 | Bacteria | 2344 |
| 115 | Ga0070704_100046097 | 3300005549 | Bacteria | 3037 |
| 116 | Ga0070704_100155304 | 3300005549 | Bacteria | 1804 |
| 117 | Ga0068855_100000634 | 3300005563 | Bacteria | 42949 |
| 118 | Ga0068855_100013140 | 3300005563 | Bacteria | 9985 |
| 119 | Ga0068855_100025708 | 3300005563 | Bacteria | 7041 |
| 120 | Ga0068855_100043030 | 3300005563 | Bacteria | 5351 |
| 121 | Ga0070664_100000284 | 3300005564 | Bacteria | 36685 |
| 122 | Ga0070664_100021720 | 3300005564 | Bacteria | 5293 |
| 123 | Ga0068857_100077453 | 3300005577 | Bacteria | 2967 |
| 124 | Ga0068857_100375847 | 3300005577 | Bacteria | 1319 |
| 125 | Ga0068857_100631053 | 3300005577 | Bacteria | 1014 |
| 126 | Ga0068854_100049038 | 3300005578 | Bacteria | 3015 |
| 127 | Ga0068856_100002570 | 3300005614 | Bacteria | 18696 |
| 128 | Ga0070702_100125329 | 3300005615 | Bacteria | 1614 |
| 129 | Ga0068852_100002800 | 3300005616 | Bacteria | 12084 |
| 130 | Ga0068852_100009134 | 3300005616 | Bacteria | 7341 |
| 131 | Ga0068852_100138341 | 3300005616 | Bacteria | 2251 |
| 132 | Ga0068859_100015900 | 3300005617 | Bacteria | 7563 |
| 133 | Ga0068859_100051729 | 3300005617 | Bacteria | 4130 |
| 134 | Ga0068859_100073533 | 3300005617 | Bacteria | 3456 |
| 135 | Ga0068859_100085712 | 3300005617 | Bacteria | 3196 |
| 136 | Ga0068859_100152412 | 3300005617 | Bacteria | 2387 |
| 137 | Ga0068859_100276118 | 3300005617 | Bacteria | 1773 |
| 138 | Ga0068859_100445009 | 3300005617 | Bacteria | 1392 |
| 139 | Ga0068859_100449046 | 3300005617 | Bacteria | 1385 |
| 140 | Ga0068864_100007878 | 3300005618 | Bacteria | 8779 |
| 141 | Ga0068864_100129114 | 3300005618 | Bacteria | 2268 |
| 142 | Ga0068864_100185590 | 3300005618 | Bacteria | 1903 |
| 143 | Ga0068864_100234601 | 3300005618 | Bacteria | 1698 |
| 144 | Ga0068864_100260593 | 3300005618 | Bacteria | 1613 |
| 145 | Ga0068864_100362969 | 3300005618 | Bacteria | 1369 |
| 146 | Ga0068864_100378721 | 3300005618 | Bacteria | 1340 |
| 147 | Ga0068864_100634801 | 3300005618 | Bacteria | 1039 |
| 148 | Ga0068866_10033452 | 3300005718 | Bacteria | 2495 |
| 149 | Ga0068861_100027161 | 3300005719 | Bacteria | 4167 |
| 150 | Ga0068861_100055829 | 3300005719 | Bacteria | 3013 |
| 151 | Ga0068861_100200240 | 3300005719 | Bacteria | 1675 |
| 152 | Ga0068851_10010798 | 3300005834 | Bacteria | 4270 |
| 153 | Ga0068851_10091206 | 3300005834 | Bacteria | 1604 |
| 154 | Ga0068863_100005626 | 3300005841 | Bacteria | 12313 |
| 155 | Ga0068863_100020743 | 3300005841 | Bacteria | 6276 |
| 156 | Ga0068863_100096665 | 3300005841 | Bacteria | 2804 |
| 157 | Ga0068863_100172673 | 3300005841 | Bacteria | 2074 |
| 158 | Ga0068863_100318451 | 3300005841 | Bacteria | 1510 |
| 159 | Ga0068863_100531903 | 3300005841 | Bacteria | 1159 |
| 160 | Ga0068858_100001792 | 3300005842 | Bacteria | 21909 |
| 161 | Ga0068858_100037909 | 3300005842 | Bacteria | 4471 |
| 162 | Ga0068858_100085205 | 3300005842 | Bacteria | 2939 |
| 163 | Ga0068858_100089656 | 3300005842 | Bacteria | 2861 |
| 164 | Ga0068858_100377723 | 3300005842 | Bacteria | 1360 |
| 165 | Ga0068858_100458323 | 3300005842 | Unclassified | 1229 |
| 166 | Ga0068858_100806786 | 3300005842 | Bacteria | 916 |
| 167 | Ga0068860_100001537 | 3300005843 | Bacteria | 24868 |
| 168 | Ga0068860_100006790 | 3300005843 | Bacteria | 11470 |
| 169 | Ga0068860_100022341 | 3300005843 | Bacteria | 6120 |
| 170 | Ga0068860_100121064 | 3300005843 | Bacteria | 2506 |
| 171 | Ga0068860_100281938 | 3300005843 | Bacteria | 1624 |
| 172 | Ga0068860_100348405 | 3300005843 | Bacteria | 1457 |
| 173 | Ga0068860_100534128 | 3300005843 | Bacteria | 1173 |
| 174 | Ga0068862_100086607 | 3300005844 | Bacteria | 2723 |
| 175 | Ga0068862_100493706 | 3300005844 | Bacteria | 1161 |
| 176 | Ga0068862_100830913 | 3300005844 | Bacteria | 904 |
| 177 | Ga0081539_10026601 | 3300005985 | Bacteria | 3686 |
| 178 | Ga0075368_10096022 | 3300006042 | Bacteria | 1215 |
| 179 | Ga0075364_10004928 | 3300006051 | Bacteria | 7734 |
| 180 | Ga0075432_10012877 | 3300006058 | Bacteria | 2843 |
| 181 | Ga0075369_10000707 | 3300006186 | Bacteria | 10736 |
| 182 | Ga0075369_10051633 | 3300006186 | Bacteria | 1780 |
| 183 | Ga0075366_10009565 | 3300006195 | Bacteria | 5415 |
| 184 | Ga0075366_10097921 | 3300006195 | Bacteria | 1759 |
| 185 | Ga0097621_100004956 | 3300006237 | Bacteria | 9334 |
| 186 | Ga0097621_100030965 | 3300006237 | Bacteria | 4241 |
| 187 | Ga0097621_100074566 | 3300006237 | Bacteria | 2810 |
| 188 | Ga0097621_100103720 | 3300006237 | Bacteria | 2396 |
| 189 | Ga0097621_100183660 | 3300006237 | Bacteria | 1808 |
| 190 | Ga0097621_100243257 | 3300006237 | Bacteria | 1573 |
| 191 | Ga0097621_100312364 | 3300006237 | Unclassified | 1390 |
| 192 | Ga0097621_100460720 | 3300006237 | Bacteria | 1147 |
| 193 | Ga0097621_100532770 | 3300006237 | Bacteria | 1067 |
| 194 | Ga0075370_10009479 | 3300006353 | Bacteria | 5058 |
| 195 | Ga0068871_100001990 | 3300006358 | Bacteria | 13838 |
| 196 | Ga0068871_100025542 | 3300006358 | Bacteria | 4598 |
| 197 | Ga0068871_100126600 | 3300006358 | Bacteria | 2162 |
| 198 | Ga0068871_100142299 | 3300006358 | Bacteria | 2040 |
| 199 | Ga0068871_100229181 | 3300006358 | Bacteria | 1612 |
| 200 | Ga0068871_100263412 | 3300006358 | Bacteria | 1504 |
| 201 | Ga0068871_100410010 | 3300006358 | Bacteria | 1208 |
| 202 | Ga0075428_100493819 | 3300006844 | Bacteria | 1310 |
| 203 | Ga0075433_10255583 | 3300006852 | Bacteria | 1554 |
| 204 | Ga0075434_100801482 | 3300006871 | Bacteria | 958 |
| 205 | Ga0068865_100019556 | 3300006881 | Bacteria | 4384 |
| 206 | Ga0068865_100046157 | 3300006881 | Bacteria | 2988 |
| 207 | Ga0097620_100015901 | 3300006931 | Bacteria | 7563 |
| 208 | Ga0097620_100051730 | 3300006931 | Bacteria | 4130 |
| 209 | Ga0097620_100073530 | 3300006931 | Bacteria | 3456 |
| 210 | Ga0097620_100085713 | 3300006931 | Bacteria | 3196 |
| 211 | Ga0097620_100152410 | 3300006931 | Bacteria | 2387 |
| 212 | Ga0097620_100276108 | 3300006931 | Bacteria | 1773 |
| 213 | Ga0097620_100444995 | 3300006931 | Bacteria | 1392 |
| 214 | Ga0097620_100449069 | 3300006931 | Bacteria | 1385 |
| 215 | Ga0075435_100438411 | 3300007076 | Bacteria | 1126 |
| 216 | Ga0105240_10014966 | 3300009093 | Bacteria | 10570 |
| 217 | Ga0105240_10031185 | 3300009093 | Bacteria | 6917 |
| 218 | Ga0105240_10080044 | 3300009093 | Bacteria | 4019 |
| 219 | Ga0105240_10097440 | 3300009093 | Bacteria | 3583 |
| 220 | Ga0105240_10119737 | 3300009093 | Bacteria | 3171 |
| 221 | Ga0105240_10153438 | 3300009093 | Bacteria | 2741 |
| 222 | Ga0105240_10226210 | 3300009093 | Bacteria | 2177 |
| 223 | Ga0105240_10227047 | 3300009093 | Bacteria | 2172 |
| 224 | Ga0111539_10003518 | 3300009094 | Bacteria | 20654 |
| 225 | Ga0111539_10157686 | 3300009094 | Bacteria | 2655 |
| 226 | Ga0105245_10068838 | 3300009098 | Bacteria | 3208 |
| 227 | Ga0105245_10256834 | 3300009098 | Bacteria | 1699 |
| 228 | Ga0105245_10292856 | 3300009098 | Bacteria | 1595 |
| 229 | Ga0105245_10392217 | 3300009098 | Bacteria | 1385 |
| 230 | Ga0105245_10838128 | 3300009098 | Bacteria | 959 |
| 231 | Ga0105243_10162309 | 3300009148 | Bacteria | 1928 |
| 232 | Ga0105243_10162362 | 3300009148 | Bacteria | 1928 |
| 233 | Ga0105243_10343154 | 3300009148 | Bacteria | 1369 |
| 234 | Ga0105241_10382204 | 3300009174 | Bacteria | 1231 |
| 235 | Ga0105241_10489623 | 3300009174 | Bacteria | 1094 |
| 236 | Ga0105242_10001143 | 3300009176 | Bacteria | 20918 |
| 237 | Ga0105242_10038520 | 3300009176 | Bacteria | 3845 |
| 238 | Ga0105242_10235123 | 3300009176 | Bacteria | 1644 |
| 239 | Ga0105248_10041073 | 3300009177 | Bacteria | 5185 |
| 240 | Ga0105248_10043944 | 3300009177 | Bacteria | 5011 |
| 241 | Ga0105248_10061166 | 3300009177 | Bacteria | 4227 |
| 242 | Ga0105248_10099672 | 3300009177 | Bacteria | 3274 |
| 243 | Ga0105248_10252297 | 3300009177 | Bacteria | 1986 |
| 244 | Ga0105248_10326271 | 3300009177 | Bacteria | 1729 |
| 245 | Ga0105248_10363865 | 3300009177 | Bacteria | 1628 |
| 246 | Ga0105248_10585954 | 3300009177 | Bacteria | 1258 |
| 247 | Ga0105248_10682114 | 3300009177 | Bacteria | 1159 |
| 248 | Ga0105237_10164076 | 3300009545 | Bacteria | 2220 |
| 249 | Ga0105237_10227009 | 3300009545 | Bacteria | 1868 |
| 250 | Ga0105238_10165929 | 3300009551 | Bacteria | 2184 |
| 251 | Ga0105238_11059096 | 3300009551 | Bacteria | 833 |
| 252 | Ga0105249_10359825 | 3300009553 | Bacteria | 1476 |
| 253 | Ga0105249_10420356 | 3300009553 | Bacteria | 1370 |
| 254 | Ga0105239_11444675 | 3300010375 | Bacteria | 794 |
| 255 | Ga0157373_10000725 | 3300013100 | Bacteria | 25780 |
| 256 | Ga0157373_10049968 | 3300013100 | Bacteria | 2979 |
| 257 | Ga0157371_10000174 | 3300013102 | Bacteria | 93381 |
| 258 | Ga0157371_10421718 | 3300013102 | Bacteria | 978 |
| 259 | Ga0157370_10005552 | 3300013104 | Bacteria | 14141 |
| 260 | Ga0157370_10217892 | 3300013104 | Bacteria | 1768 |
| 261 | Ga0157370_10305119 | 3300013104 | Bacteria | 1469 |
| 262 | Ga0157369_10037961 | 3300013105 | Bacteria | 5269 |
| 263 | Ga0157369_10093235 | 3300013105 | Bacteria | 3214 |
| 264 | Ga0157369_10117754 | 3300013105 | Bacteria | 2820 |
| 265 | Ga0157374_10002680 | 3300013296 | Bacteria | 14978 |
| 266 | Ga0157374_10068870 | 3300013296 | Bacteria | 3330 |
| 267 | Ga0157374_10131636 | 3300013296 | Bacteria | 2421 |
| 268 | Ga0157374_10195957 | 3300013296 | Unclassified | 1977 |
| 269 | Ga0157374_11118606 | 3300013296 | Bacteria | 808 |
| 270 | Ga0157378_10024063 | 3300013297 | Bacteria | 5357 |
| 271 | Ga0157378_10054835 | 3300013297 | Bacteria | 3550 |
| 272 | Ga0157378_10216390 | 3300013297 | Bacteria | 1819 |
| 273 | Ga0157378_10856427 | 3300013297 | Bacteria | 937 |
| 274 | Ga0163162_10000874 | 3300013306 | Bacteria | 28091 |
| 275 | Ga0163162_10098300 | 3300013306 | Bacteria | 3016 |
| 276 | Ga0163162_10153042 | 3300013306 | Bacteria | 2425 |
| 277 | Ga0163162_10242891 | 3300013306 | Bacteria | 1932 |
| 278 | Ga0163162_10288577 | 3300013306 | Bacteria | 1773 |
| 279 | Ga0163162_10365839 | 3300013306 | Bacteria | 1575 |
| 280 | Ga0163162_10710382 | 3300013306 | Unclassified | 1126 |
| 281 | Ga0157372_10003340 | 3300013307 | Bacteria | 17321 |
| 282 | Ga0157372_10104047 | 3300013307 | Bacteria | 3245 |
| 283 | Ga0157372_10199703 | 3300013307 | Bacteria | 2316 |
| 284 | Ga0157375_10022155 | 3300013308 | Bacteria | 5844 |
| 285 | Ga0157375_10079029 | 3300013308 | Bacteria | 3324 |
| 286 | Ga0157375_10106995 | 3300013308 | Bacteria | 2889 |
| 287 | Ga0157375_10188235 | 3300013308 | Bacteria | 2218 |
| 288 | Ga0157375_10242118 | 3300013308 | Bacteria | 1963 |
| 289 | Ga0163163_10108928 | 3300014325 | Bacteria | 2797 |
| 290 | Ga0163163_10151081 | 3300014325 | Bacteria | 2366 |
| 291 | Ga0163163_10870092 | 3300014325 | Bacteria | 965 |
| 292 | Ga0157380_10148510 | 3300014326 | Bacteria | 2023 |
| 293 | Ga0157380_10812247 | 3300014326 | Bacteria | 953 |
| 294 | Ga0157380_10865171 | 3300014326 | Unclassified | 927 |
| 295 | Ga0157377_10040617 | 3300014745 | Bacteria | 2577 |
| 296 | Ga0157379_10012835 | 3300014968 | Bacteria | 7326 |
| 297 | Ga0157379_10027155 | 3300014968 | Bacteria | 5096 |
| 298 | Ga0157379_10111286 | 3300014968 | Bacteria | 2460 |
| 299 | Ga0157379_10213847 | 3300014968 | Bacteria | 1746 |
| 300 | Ga0157379_10319534 | 3300014968 | Bacteria | 1417 |
| 301 | Ga0157379_10401633 | 3300014968 | Bacteria | 1260 |
| 302 | Ga0157376_10029815 | 3300014969 | Bacteria | 4349 |
| 303 | Ga0157376_10117718 | 3300014969 | Bacteria | 2350 |
| 304 | Ga0157376_10302929 | 3300014969 | Bacteria | 1513 |
| 305 | Ga0157376_10524853 | 3300014969 | Bacteria | 1168 |
| 306 | Ga0182006_1041046 | 3300015261 | Bacteria | 1819 |
| 307 | Ga0163161_10008757 | 3300017792 | Bacteria | 6994 |
| 308 | Ga0163161_10011177 | 3300017792 | Bacteria | 6219 |
| 309 | Ga0163161_10072241 | 3300017792 | Bacteria | 2526 |
| 310 | Ga0163161_10075864 | 3300017792 | Bacteria | 2468 |
| 311 | Ga0213872_10000039 | 3300021361 | Bacteria | 123507 |
| 312 | Ga0213872_10003535 | 3300021361 | Bacteria | 8627 |
| 313 | Ga0213872_10018955 | 3300021361 | Bacteria | 3171 |
| 314 | Ga0213872_10042168 | 3300021361 | Bacteria | 2081 |
| 315 | Ga0207697_10026173 | 3300025315 | Bacteria | 2386 |
| 316 | Ga0207656_10002499 | 3300025321 | Bacteria | 6213 |
| 317 | Ga0207653_10020201 | 3300025885 | Bacteria | 2107 |
| 318 | Ga0207642_10002800 | 3300025899 | Bacteria | 5442 |
| 319 | Ga0207688_10035487 | 3300025901 | Bacteria | 2763 |
| 320 | Ga0207680_10379191 | 3300025903 | Bacteria | 997 |
| 321 | Ga0207699_10029358 | 3300025906 | Bacteria | 3067 |
| 322 | Ga0207699_10212619 | 3300025906 | Bacteria | 1316 |
| 323 | Ga0207645_10002076 | 3300025907 | Bacteria | 16034 |
| 324 | Ga0207645_10027073 | 3300025907 | Bacteria | 3704 |
| 325 | Ga0207645_10193592 | 3300025907 | Bacteria | 1336 |
| 326 | Ga0207645_10196522 | 3300025907 | Bacteria | 1326 |
| 327 | Ga0207643_10017909 | 3300025908 | Bacteria | 3879 |
| 328 | Ga0207643_10019664 | 3300025908 | Bacteria | 3702 |
| 329 | Ga0207643_10132103 | 3300025908 | Bacteria | 1486 |
| 330 | Ga0207643_10152372 | 3300025908 | Bacteria | 1387 |
| 331 | Ga0207705_10105736 | 3300025909 | Bacteria | 2075 |
| 332 | Ga0207705_10294571 | 3300025909 | Bacteria | 1243 |
| 333 | Ga0207654_10167275 | 3300025911 | Bacteria | 1425 |
| 334 | Ga0207707_10144473 | 3300025912 | Bacteria | 2080 |
| 335 | Ga0207695_10017450 | 3300025913 | Bacteria | 8354 |
| 336 | Ga0207695_10033923 | 3300025913 | Bacteria | 5557 |
| 337 | Ga0207695_10069360 | 3300025913 | Bacteria | 3608 |
| 338 | Ga0207695_10085430 | 3300025913 | Bacteria | 3184 |
| 339 | Ga0207671_10051611 | 3300025914 | Bacteria | 3048 |
| 340 | Ga0207671_10141102 | 3300025914 | Bacteria | 1856 |
| 341 | Ga0207660_10182858 | 3300025917 | Bacteria | 1629 |
| 342 | Ga0207660_10654886 | 3300025917 | Bacteria | 856 |
| 343 | Ga0207662_10091692 | 3300025918 | Bacteria | 1870 |
| 344 | Ga0207657_10000234 | 3300025919 | Bacteria | 58447 |
| 345 | Ga0207649_10406887 | 3300025920 | Bacteria | 1019 |
| 346 | Ga0207652_10027918 | 3300025921 | Bacteria | 4707 |
| 347 | Ga0207652_10053149 | 3300025921 | Bacteria | 3479 |
| 348 | Ga0207681_10148940 | 3300025923 | Bacteria | 1751 |
| 349 | Ga0207681_10437998 | 3300025923 | Unclassified | 1061 |
| 350 | Ga0207694_10498968 | 3300025924 | Unclassified | 1019 |
| 351 | Ga0207650_10055237 | 3300025925 | Bacteria | 2947 |
| 352 | Ga0207650_10061109 | 3300025925 | Bacteria | 2812 |
| 353 | Ga0207650_10157113 | 3300025925 | Bacteria | 1799 |
| 354 | Ga0207650_10447813 | 3300025925 | Bacteria | 1074 |
| 355 | Ga0207659_10001621 | 3300025926 | Bacteria | 13334 |
| 356 | Ga0207659_10012764 | 3300025926 | Bacteria | 5362 |
| 357 | Ga0207659_10024879 | 3300025926 | Bacteria | 4019 |
| 358 | Ga0207659_10100240 | 3300025926 | Bacteria | 2182 |
| 359 | Ga0207659_10189075 | 3300025926 | Bacteria | 1637 |
| 360 | Ga0207687_10244340 | 3300025927 | Unclassified | 1424 |
| 361 | Ga0207687_10252550 | 3300025927 | Bacteria | 1402 |
| 362 | Ga0207687_10615377 | 3300025927 | Bacteria | 916 |
| 363 | Ga0207700_10050944 | 3300025928 | Bacteria | 3087 |
| 364 | Ga0207644_10061954 | 3300025931 | Bacteria | 2711 |
| 365 | Ga0207690_10001827 | 3300025932 | Bacteria | 13063 |
| 366 | Ga0207690_10096425 | 3300025932 | Bacteria | 2103 |
| 367 | Ga0207690_10714454 | 3300025932 | Bacteria | 824 |
| 368 | Ga0207706_10000097 | 3300025933 | Bacteria | 91923 |
| 369 | Ga0207706_10031431 | 3300025933 | Bacteria | 4730 |
| 370 | Ga0207686_10021789 | 3300025934 | Bacteria | 3683 |
| 371 | Ga0207686_10030246 | 3300025934 | Bacteria | 3204 |
| 372 | Ga0207686_10091602 | 3300025934 | Bacteria | 2008 |
| 373 | Ga0207709_10214830 | 3300025935 | Bacteria | 1383 |
| 374 | Ga0207709_10231332 | 3300025935 | Bacteria | 1339 |
| 375 | Ga0207670_10002904 | 3300025936 | Bacteria | 9055 |
| 376 | Ga0207670_10072433 | 3300025936 | Bacteria | 2385 |
| 377 | Ga0207669_10357955 | 3300025937 | Bacteria | 1130 |
| 378 | Ga0207704_10040950 | 3300025938 | Bacteria | 2713 |
| 379 | Ga0207665_10112750 | 3300025939 | Bacteria | 1912 |
| 380 | Ga0207691_10000560 | 3300025940 | Bacteria | 37165 |
| 381 | Ga0207691_10001443 | 3300025940 | Bacteria | 23702 |
| 382 | Ga0207691_10002036 | 3300025940 | Bacteria | 19776 |
| 383 | Ga0207691_10070698 | 3300025940 | Bacteria | 3151 |
| 384 | Ga0207711_10039000 | 3300025941 | Bacteria | 4040 |
| 385 | Ga0207711_10307975 | 3300025941 | Bacteria | 1462 |
| 386 | Ga0207689_10004023 | 3300025942 | Bacteria | 13366 |
| 387 | Ga0207689_10006812 | 3300025942 | Bacteria | 10050 |
| 388 | Ga0207689_10116175 | 3300025942 | Bacteria | 2199 |
| 389 | Ga0207661_10688938 | 3300025944 | Unclassified | 940 |
| 390 | Ga0207679_10005476 | 3300025945 | Bacteria | 7955 |
| 391 | Ga0207679_10011985 | 3300025945 | Bacteria | 5636 |
| 392 | Ga0207667_10007232 | 3300025949 | Bacteria | 13397 |
| 393 | Ga0207667_10025479 | 3300025949 | Bacteria | 6471 |
| 394 | Ga0207667_10084058 | 3300025949 | Bacteria | 3295 |
| 395 | Ga0207651_10031284 | 3300025960 | Bacteria | 3400 |
| 396 | Ga0207651_10107930 | 3300025960 | Bacteria | 2082 |
| 397 | Ga0207651_10374176 | 3300025960 | Bacteria | 1206 |
| 398 | Ga0207651_10476235 | 3300025960 | Bacteria | 1075 |
| 399 | Ga0207712_10119717 | 3300025961 | Bacteria | 1990 |
| 400 | Ga0207668_10081407 | 3300025972 | Bacteria | 2349 |
| 401 | Ga0207668_10115132 | 3300025972 | Bacteria | 2025 |
| 402 | Ga0207668_10139081 | 3300025972 | Bacteria | 1864 |
| 403 | Ga0207640_10548987 | 3300025981 | Bacteria | 970 |
| 404 | Ga0207658_10000919 | 3300025986 | Bacteria | 24357 |
| 405 | Ga0207658_10006716 | 3300025986 | Bacteria | 7832 |
| 406 | Ga0207658_10061373 | 3300025986 | Bacteria | 2809 |
| 407 | Ga0207658_10065233 | 3300025986 | Bacteria | 2734 |
| 408 | Ga0207658_10067716 | 3300025986 | Bacteria | 2691 |
| 409 | Ga0207658_10104476 | 3300025986 | Bacteria | 2226 |
| 410 | Ga0207658_10135676 | 3300025986 | Bacteria | 1984 |
| 411 | Ga0207658_10291351 | 3300025986 | Bacteria | 1403 |
| 412 | Ga0207658_10752160 | 3300025986 | Bacteria | 883 |
| 413 | Ga0207677_10018826 | 3300026023 | Bacteria | 4154 |
| 414 | Ga0207677_10121616 | 3300026023 | Bacteria | 1965 |
| 415 | Ga0207703_10007993 | 3300026035 | Bacteria | 8357 |
| 416 | Ga0207703_10031311 | 3300026035 | Bacteria | 4205 |
| 417 | Ga0207703_10034431 | 3300026035 | Bacteria | 4019 |
| 418 | Ga0207703_10380140 | 3300026035 | Bacteria | 1306 |
| 419 | Ga0207639_10112452 | 3300026041 | Bacteria | 2222 |
| 420 | Ga0207639_10901679 | 3300026041 | Bacteria | 826 |
| 421 | Ga0207678_10008512 | 3300026067 | Bacteria | 9043 |
| 422 | Ga0207678_10153657 | 3300026067 | Bacteria | 1965 |
| 423 | Ga0207708_10226753 | 3300026075 | Bacteria | 1499 |
| 424 | Ga0207702_10006007 | 3300026078 | Bacteria | 10540 |
| 425 | Ga0207702_10331428 | 3300026078 | Bacteria | 1452 |
| 426 | Ga0207702_10343008 | 3300026078 | Bacteria | 1427 |
| 427 | Ga0207641_10001267 | 3300026088 | Bacteria | 25148 |
| 428 | Ga0207641_10125237 | 3300026088 | Unclassified | 2299 |
| 429 | Ga0207641_10153229 | 3300026088 | Bacteria | 2089 |
| 430 | Ga0207641_10177309 | 3300026088 | Bacteria | 1949 |
| 431 | Ga0207641_10234578 | 3300026088 | Bacteria | 1707 |
| 432 | Ga0207641_10345818 | 3300026088 | Bacteria | 1416 |
| 433 | Ga0207648_10000715 | 3300026089 | Bacteria | 37217 |
| 434 | Ga0207648_10008800 | 3300026089 | Bacteria | 9725 |
| 435 | Ga0207648_10027630 | 3300026089 | Bacteria | 5036 |
| 436 | Ga0207648_10046341 | 3300026089 | Bacteria | 3812 |
| 437 | Ga0207676_10050276 | 3300026095 | Bacteria | 3249 |
| 438 | Ga0207676_10085586 | 3300026095 | Bacteria | 2573 |
| 439 | Ga0207676_10142397 | 3300026095 | Bacteria | 2054 |
| 440 | Ga0207676_10185756 | 3300026095 | Bacteria | 1824 |
| 441 | Ga0207674_10015936 | 3300026116 | Bacteria | 8234 |
| 442 | Ga0207674_10052798 | 3300026116 | Bacteria | 4145 |
| 443 | Ga0207674_10808803 | 3300026116 | Unclassified | 904 |
| 444 | Ga0207675_100011665 | 3300026118 | Bacteria | 8217 |
| 445 | Ga0207675_100063074 | 3300026118 | Bacteria | 3462 |
| 446 | Ga0207675_100124208 | 3300026118 | Bacteria | 2444 |
| 447 | Ga0207683_10000219 | 3300026121 | Bacteria | 50089 |
| 448 | Ga0207683_10014592 | 3300026121 | Bacteria | 6690 |
| 449 | Ga0207683_10073123 | 3300026121 | Bacteria | 3032 |
| 450 | Ga0207683_10160144 | 3300026121 | Bacteria | 2034 |
| 451 | Ga0207683_10392641 | 3300026121 | Bacteria | 1276 |
| 452 | Ga0207683_10859069 | 3300026121 | Bacteria | 842 |
| 453 | Ga0207698_10016778 | 3300026142 | Bacteria | 4948 |
| 454 | Ga0207698_10084170 | 3300026142 | Bacteria | 2577 |
| 455 | Ga0207698_10108196 | 3300026142 | Bacteria | 2323 |
| 456 | Ga0209983_1007518 | 3300027665 | Unclassified | 2232 |
| 457 | Ga0209974_10010689 | 3300027876 | Bacteria | 3095 |
| 458 | Ga0209974_10011124 | 3300027876 | Bacteria | 3027 |
| 459 | Ga0209974_10027741 | 3300027876 | Unclassified | 1874 |
| 460 | Ga0207428_10009022 | 3300027907 | Bacteria | 8978 |
| 461 | Ga0268266_10410114 | 3300028379 | Bacteria | 1282 |
| 462 | Ga0268266_10690482 | 3300028379 | Bacteria | 983 |
| 463 | Ga0268265_10043796 | 3300028380 | Bacteria | 3329 |
| 464 | Ga0268265_10150039 | 3300028380 | Bacteria | 1965 |
| 465 | Ga0268264_10005529 | 3300028381 | Bacteria | 10716 |
| 466 | Ga0268264_10026951 | 3300028381 | Bacteria | 4694 |
| 467 | Ga0268264_10174991 | 3300028381 | Bacteria | 1944 |
| 468 | Ga0268264_10175273 | 3300028381 | Bacteria | 1943 |
| 469 | Ga0268264_10184782 | 3300028381 | Bacteria | 1896 |
| 470 | Ga0307515_10000043 | 3300028794 | Bacteria | 304612 |
| 471 | Ga0307515_10031745 | 3300028794 | Bacteria | 8784 |
| 472 | Ga0265328_10000001 | 3300031239 | Bacteria | 371500 |
| 473 | Ga0265316_10050849 | 3300031344 | Bacteria | 3258 |
| 474 | Ga0307513_10003123 | 3300031456 | Bacteria | 22603 |
| 475 | Ga0307509_10082106 | 3300031507 | Bacteria | 3326 |
| 476 | Ga0307509_10085108 | 3300031507 | Bacteria | 3255 |
| 477 | Ga0307408_100027666 | 3300031548 | Bacteria | 3910 |
| 478 | Ga0307408_100034225 | 3300031548 | Bacteria | 3557 |
| 479 | Ga0307408_100035671 | 3300031548 | Bacteria | 3491 |
| 480 | Ga0307408_100551194 | 3300031548 | Bacteria | 1017 |
| 481 | Ga0307508_10000163 | 3300031616 | Bacteria | 80086 |
| 482 | Ga0316575_10006948 | 3300031665 | Bacteria | 4095 |
| 483 | Ga0316579_10000184 | 3300031691 | Bacteria | 18109 |
| 484 | Ga0316578_10000742 | 3300031728 | Bacteria | 11878 |
| 485 | Ga0307405_10035194 | 3300031731 | Bacteria | 2988 |
| 486 | Ga0307405_10195036 | 3300031731 | Bacteria | 1466 |
| 487 | Ga0307413_10007125 | 3300031824 | Bacteria | 5163 |
| 488 | Ga0307410_10129940 | 3300031852 | Bacteria | 1849 |
| 489 | Ga0307410_10147647 | 3300031852 | Bacteria | 1747 |
| 490 | Ga0307410_10376234 | 3300031852 | Bacteria | 1141 |
| 491 | Ga0307406_10006344 | 3300031901 | Bacteria | 6524 |
| 492 | Ga0307412_10030179 | 3300031911 | Bacteria | 3410 |
| 493 | Ga0307409_100009797 | 3300031995 | Bacteria | 5909 |
| 494 | Ga0307416_100014141 | 3300032002 | Bacteria | 5455 |
| 495 | Ga0307416_100030432 | 3300032002 | Bacteria | 4050 |
| 496 | Ga0307416_100049300 | 3300032002 | Bacteria | 3347 |
| 497 | Ga0307416_100170681 | 3300032002 | Bacteria | 2024 |
| 498 | Ga0307416_100478817 | 3300032002 | Bacteria | 1304 |
| 499 | Ga0307416_100619383 | 3300032002 | Bacteria | 1164 |
| 500 | Ga0307414_10042212 | 3300032004 | Bacteria | 3097 |
| 501 | Ga0307414_10069020 | 3300032004 | Bacteria | 2539 |
| 502 | Ga0307411_10001127 | 3300032005 | Bacteria | 10445 |
| 503 | Ga0307415_100050588 | 3300032126 | Bacteria | 2816 |
| 504 | Ga0316583_10002422 | 3300032133 | Bacteria | 6464 |
| 505 | Ga0307510_10021393 | 3300033180 | Bacteria | 7537 |
| 506 | Ga0307510_10157452 | 3300033180 | Bacteria | 1875 |
| 507 | Ga0307510_10178262 | 3300033180 | Bacteria | 1692 |
| 508 | Ga0373938_0077599 | 3300034957 | Bacteria | 804 |
| 509 | Ga0373944_0009231 | 3300035089 | Bacteria | 2673 |
| 510 | Ga0373952_0000139 | 3300035092 | Bacteria | 10580 |
| 511 | Ga0373923_0098598 | 3300035111 | Bacteria | 1286 |
| 512 | Ga0373956_0039698 | 3300035119 | Bacteria | 2087 |
| 513 | Ga0373955_0044117 | 3300035172 | Bacteria | 2400 |
| 514 | Ga0373924_0067583 | 3300035410 | Bacteria | 1503 |
| 515 | Ga0373931_0045579 | 3300035691 | Bacteria | 2316 |
| 516 | Ga0373927_0377892 | 3300035695 | Bacteria | 934 |
| 517 | Ga0373937_0042517 | 3300036401 | Bacteria | 4146 |
| 518 | Ga0373937_0696335 | 3300036401 | Bacteria | 963 |
| 519 | Ga0373937_1078919 | 3300036401 | Bacteria | 752 |
| 520 | Ga0316582_0002406 | 3300036647 | Bacteria | 8772 |
| 521 | Ga0373925_0145458 | 3300037068 | Unclassified | 1858 |
| 522 | Ga0395900_0037247 | 3300037418 | Bacteria | 5017 |
| 523 | Ga0395900_0159573 | 3300037418 | Bacteria | 2301 |
| 524 | Ga0395905_0048192 | 3300037471 | Bacteria | 3994 |
| 525 | Ga0436365_0250047 | 3300039437 | Bacteria | 3038 |
| 526 | Ga0436365_1085190 | 3300039437 | Bacteria | 3200 |
| 527 | Ga0436361_0066314 | 3300039447 | Bacteria | 3515 |
| 528 | Ga0436361_0140639 | 3300039447 | Bacteria | 6254 |
| 529 | Ga0436361_0240373 | 3300039447 | Bacteria | 3038 |
| 530 | Ga0436361_0410838 | 3300039447 | Bacteria | 2340 |
| 531 | Ga0436361_0802941 | 3300039447 | Bacteria | 44636 |
| 532 | Ga0439436_0004806 | 3300041404 | Bacteria | 4144 |
| 533 | Ga0439438_001058 | 3300041405 | Bacteria | 12257 |
| 534 | Ga0439447_002801 | 3300041407 | Bacteria | 6291 |
| 535 | Ga0439461_0032289 | 3300041410 | Bacteria | 1097 |
| 536 | Ga0439466_0009867 | 3300041411 | Bacteria | 3556 |
| 537 | Ga0439466_0031669 | 3300041411 | Bacteria | 1807 |
| 538 | Ga0451843_0708525 | 3300041509 | Bacteria | 2932 |
| 539 | Ga0439431_0003072 | 3300041997 | Bacteria | 3665 |
| 540 | Ga0439441_000060 | 3300042001 | Bacteria | 8277 |
| 541 | Ga0439432_020125 | 3300042006 | Bacteria | 2220 |
| 542 | Ga0439452_001765 | 3300042010 | Bacteria | 8442 |
| 543 | Ga0450888_007440 | 3300042126 | Unclassified | 1212 |
| 544 | Ga0439446_0020440 | 3300042156 | Bacteria | 1865 |
| 545 | Ga0439434_0007658 | 3300042435 | Bacteria | 3164 |
| 546 | Ga0451577_0007328 | 3300042876 | Bacteria | 10857 |
| 547 | Ga0451577_0110938 | 3300042876 | Bacteria | 2454 |
| 548 | Ga0451577_0141935 | 3300042876 | Bacteria | 2159 |
| 549 | Ga0451577_0169456 | 3300042876 | Bacteria | 1968 |
| 550 | Ga0451577_0466325 | 3300042876 | Bacteria | 1147 |
| 551 | Ga0451577_0482143 | 3300042876 | Bacteria | 1126 |
| 552 | Ga0466969_0002491 | 3300044656 | Bacteria | 9832 |
| 553 | Ga0466965_0025036 | 3300044683 | Bacteria | 2888 |
| 554 | Ga0466966_0040196 | 3300044684 | Bacteria | 3010 |
| 555 | Ga0466966_0089452 | 3300044684 | Bacteria | 1913 |
| 556 | Ga0466964_0024757 | 3300044706 | Unclassified | 2340 |
| 557 | Ga0453684_0000623 | 3300044712 | Bacteria | 129254 |
| 558 | Ga0453684_0062601 | 3300044712 | Bacteria | 4764 |
| 559 | Ga0453684_0143838 | 3300044712 | Bacteria | 2843 |
| 560 | Ga0453684_0570297 | 3300044712 | Bacteria | 1244 |
| 561 | Ga0453684_0966980 | 3300044712 | Bacteria | 908 |
| 562 | Ga0466957_0004733 | 3300044842 | Bacteria | 7622 |
| 563 | Ga0466959_0002925 | 3300045049 | Bacteria | 11013 |
| 564 | Ga0451576_0053704 | 3300045051 | Bacteria | 4220 |
| 565 | Ga0451576_0061264 | 3300045051 | Bacteria | 3924 |
| 566 | Ga0451576_0280596 | 3300045051 | Bacteria | 1742 |
| 567 | Ga0451576_0401191 | 3300045051 | Bacteria | 1438 |
| 568 | Ga0451576_0454519 | 3300045051 | Bacteria | 1345 |
| 569 | Ga0466958_0035041 | 3300045836 | Bacteria | 2997 |
| 570 | Ga0466967_0593959 | 3300045976 | Bacteria | 1092 |
| 571 | Ga0495592_0000222 | 3300046454 | Bacteria | 48902 |
| 572 | Ga0495651_0239803 | 3300046462 | Bacteria | 1244 |
| 573 | Ga0495653_0115406 | 3300046463 | Bacteria | 1922 |
| 574 | Ga0495650_0017208 | 3300046471 | Bacteria | 3629 |
| 575 | Ga0495650_0078252 | 3300046471 | Bacteria | 1281 |
| 576 | Ga0495662_0109903 | 3300046476 | Bacteria | 1351 |
| 577 | Ga0495664_0341495 | 3300046477 | Bacteria | 902 |
| 578 | Ga0495606_0000054 | 3300046507 | Bacteria | 200380 |
| 579 | Ga0495610_0101165 | 3300046512 | Bacteria | 1291 |
| 580 | Ga0495643_0000186 | 3300046522 | Bacteria | 99683 |
| 581 | Ga0495643_0002089 | 3300046522 | Bacteria | 16522 |
| 582 | Ga0495652_0017734 | 3300046529 | Bacteria | 6355 |
| 583 | Ga0495587_0046497 | 3300046536 | Bacteria | 2576 |
| 584 | Ga0495598_0130313 | 3300046537 | Bacteria | 862 |
| 585 | Ga0495621_0004663 | 3300046539 | Bacteria | 3876 |
| 586 | Ga0495645_0291511 | 3300046543 | Bacteria | 1069 |
| 587 | Ga0495667_0009652 | 3300046559 | Bacteria | 6541 |
| 588 | Ga0495634_0131675 | 3300046642 | Unclassified | 1594 |
| 589 | Ga0495657_0052826 | 3300046675 | Bacteria | 2722 |
| 590 | Ga0495599_0054613 | 3300046678 | Bacteria | 2502 |
| 591 | Ga0495623_0026340 | 3300046679 | Bacteria | 3743 |
| 592 | Ga0495671_0004823 | 3300046692 | Bacteria | 7969 |
| 593 | Ga0495671_0044143 | 3300046692 | Bacteria | 2236 |
| 594 | Ga0495649_0020354 | 3300046694 | Bacteria | 3722 |
| 595 | Ga0495649_0046844 | 3300046694 | Bacteria | 2353 |
| 596 | Ga0495660_0222688 | 3300046810 | Bacteria | 888 |
| 597 | Ga0495604_0081249 | 3300047317 | Bacteria | 2427 |
| 598 | Ga0495680_0067770 | 3300047322 | Bacteria | 2728 |
| 599 | Ga0495675_0110969 | 3300047444 | Bacteria | 1712 |
| 600 | Ga0496102_0006489 | 3300048905 | Bacteria | 9974 |
| 601 | Ga0496102_0014353 | 3300048905 | Bacteria | 6882 |
| 602 | Ga0496102_0021108 | 3300048905 | Bacteria | 5759 |
| 603 | Ga0496103_0019865 | 3300048906 | Bacteria | 4034 |
| 604 | Ga0496104_0015343 | 3300048907 | Bacteria | 6937 |
| 605 | Ga0496104_0564221 | 3300048907 | Bacteria | 1049 |
| 606 | Ga0496106_0003851 | 3300048909 | Bacteria | 11183 |
| 607 | Ga0496108_0086157 | 3300048911 | Bacteria | 2667 |
| 608 | Ga0496109_0158476 | 3300048912 | Bacteria | 2120 |
| 609 | Ga0496109_0563803 | 3300048912 | Bacteria | 1074 |
| 610 | Ga0496110_0039612 | 3300048913 | Bacteria | 4104 |
| 611 | Ga0496114_0187136 | 3300048917 | Bacteria | 1810 |
| 612 | Ga0501031_0265662 | 3300049568 | Bacteria | 1115 |
| 613 | Ga0501032_0001096 | 3300049569 | Bacteria | 21627 |
| 614 | Ga0501032_0008791 | 3300049569 | Bacteria | 7352 |
| 615 | Ga0501034_0105821 | 3300049571 | Bacteria | 2806 |
| 616 | Ga0501034_0117331 | 3300049571 | Bacteria | 2649 |
| 617 | Ga0501034_0169666 | 3300049571 | Bacteria | 2150 |
| 618 | Ga0501034_0439052 | 3300049571 | Bacteria | 1224 |
| 619 | Ga0501036_0058036 | 3300049572 | Bacteria | 3279 |
| 620 | Ga0501036_0482543 | 3300049572 | Bacteria | 1032 |
| 621 | Ga0501036_0505937 | 3300049572 | Unclassified | 1005 |
| 622 | Ga0501037_0125666 | 3300049573 | Bacteria | 1842 |
| 623 | Ga0501037_0194247 | 3300049573 | Bacteria | 1436 |
| 624 | Ga0501038_0005073 | 3300049574 | Bacteria | 12239 |
| 625 | Ga0501038_0039146 | 3300049574 | Bacteria | 4148 |
| 626 | Ga0501038_0055716 | 3300049574 | Bacteria | 3396 |
| 627 | Ga0501039_0013309 | 3300049575 | Bacteria | 6290 |
| 628 | Ga0501039_0054123 | 3300049575 | Bacteria | 3106 |
| 629 | Ga0501040_0014856 | 3300049576 | Bacteria | 5140 |
| 630 | Ga0501041_0020796 | 3300049577 | Bacteria | 3926 |
| 631 | Ga0501041_0109163 | 3300049577 | Bacteria | 1716 |
| 632 | Ga0501043_0184872 | 3300049579 | Bacteria | 1623 |
| 633 | Ga0501046_0052373 | 3300049580 | Bacteria | 3217 |
| 634 | Ga0501046_0432716 | 3300049580 | Bacteria | 947 |
| 635 | Ga0501047_0001767 | 3300049581 | Bacteria | 20898 |
| 636 | Ga0501047_0091807 | 3300049581 | Bacteria | 2915 |
| 637 | Ga0501047_0429895 | 3300049581 | Bacteria | 1151 |
| 638 | Ga0501048_0034588 | 3300049582 | Bacteria | 3644 |
| 639 | Ga0501067_0002963 | 3300049583 | Bacteria | 9366 |
| 640 | Ga0501068_0074422 | 3300049584 | Bacteria | 2076 |
| 641 | Ga0501069_0014023 | 3300049585 | Bacteria | 4281 |
| 642 | Ga0501069_0064473 | 3300049585 | Bacteria | 2048 |
| 643 | Ga0501070_0010157 | 3300049586 | Bacteria | 7968 |
| 644 | Ga0501071_0044189 | 3300049587 | Bacteria | 3195 |
| 645 | Ga0501071_0252297 | 3300049587 | Bacteria | 1332 |
| 646 | Ga0501072_0001755 | 3300049588 | Bacteria | 16124 |
| 647 | Ga0501072_0236394 | 3300049588 | Bacteria | 1455 |
| 648 | Ga0501072_0375371 | 3300049588 | Bacteria | 1128 |
| 649 | Ga0501072_0549255 | 3300049588 | Bacteria | 912 |
| 650 | Ga0501073_0000384 | 3300049589 | Bacteria | 29894 |
| 651 | Ga0501073_0071197 | 3300049589 | Bacteria | 2423 |
| 652 | Ga0501073_0319761 | 3300049589 | Bacteria | 1071 |
| 653 | Ga0501074_0000123 | 3300049590 | Bacteria | 39312 |
| 654 | Ga0501074_0127231 | 3300049590 | Bacteria | 1823 |
| 655 | Ga0501075_0077275 | 3300049591 | Bacteria | 2519 |
| 656 | Ga0501075_0079003 | 3300049591 | Bacteria | 2490 |
| 657 | Ga0501076_0000185 | 3300049592 | Bacteria | 37179 |
| 658 | Ga0501076_0349873 | 3300049592 | Bacteria | 1213 |
| 659 | Ga0501076_0505825 | 3300049592 | Bacteria | 996 |
| 660 | Ga0501079_0004001 | 3300049741 | Bacteria | 10899 |
| 661 | Ga0501079_0053365 | 3300049741 | Bacteria | 3118 |
| 662 | Ga0501080_0008926 | 3300049742 | Bacteria | 9117 |
| 663 | Ga0501080_0012021 | 3300049742 | Bacteria | 7928 |
| 664 | Ga0501080_0025348 | 3300049742 | Bacteria | 5502 |
| 665 | Ga0501080_0096675 | 3300049742 | Bacteria | 2742 |
| 666 | Ga0501080_0131558 | 3300049742 | Bacteria | 2317 |
| 667 | Ga0501081_0001180 | 3300049743 | Bacteria | 15796 |
| 668 | Ga0501081_0187973 | 3300049743 | Bacteria | 1495 |
| 669 | Ga0501083_0000252 | 3300049744 | Bacteria | 34143 |
| 670 | Ga0501083_0079511 | 3300049744 | Bacteria | 2174 |
| 671 | Ga0501035_0221999 | 3300049822 | Bacteria | 1613 |
| 672 | Ga0501044_0372736 | 3300049823 | Bacteria | 1344 |
| 673 | Ga0501044_0419900 | 3300049823 | Bacteria | 1248 |
| 674 | nmdc:mga00v17_120563_c1 | 3300050491 | Bacteria | 1669 |
| 675 | nmdc:mga00v17_1746_c1 | 3300050491 | Bacteria | 11303 |
| 676 | nmdc:mga0k408_178115_c1 | 3300050493 | Bacteria | 1268 |
| 677 | nmdc:mga0k408_85851_c1 | 3300050493 | Bacteria | 1847 |
| 678 | nmdc:mga0k408_9828_c1 | 3300050493 | Bacteria | 5166 |
| 679 | nmdc:mga06z11_296264_c1 | 3300050494 | Bacteria | 961 |
| 680 | nmdc:mga07m45_86384_c1 | 3300050496 | Bacteria | 1795 |
| 681 | nmdc:mga0qj67_16651_c1 | 3300050509 | Bacteria | 5579 |
| 682 | nmdc:mga0qj67_259814_c1 | 3300050509 | Bacteria | 1409 |
| 683 | nmdc:mga06r32_332786_c1 | 3300050510 | Bacteria | 1504 |
| 684 | nmdc:mga08y16_13025_c1 | 3300050511 | Bacteria | 8752 |
| 685 | nmdc:mga08y16_543842_c1 | 3300050511 | Bacteria | 1176 |
| 686 | nmdc:mga0n895_203532_c1 | 3300050512 | Bacteria | 2010 |
| 687 | nmdc:mga0n895_922322_c1 | 3300050512 | Bacteria | 858 |
| 688 | Ga0495601_0143273 | 3300053077 | Bacteria | 1559 |
| 689 | Ga0495619_0038614 | 3300053085 | Bacteria | 3115 |
| 690 | Ga0500641_0021741 | 3300053096 | Bacteria | 2450 |
| 691 | Ga0500594_0000988 | 3300053118 | Bacteria | 6110 |
| 692 | Ga0500614_019266 | 3300053123 | Bacteria | 1562 |
| 693 | Ga0500652_041329 | 3300053131 | Bacteria | 1857 |
| 694 | Ga0500655_004929 | 3300053133 | Bacteria | 2398 |
| 695 | Ga0500559_0000011 | 3300053136 | Bacteria | 164751 |
| 696 | Ga0500564_099218 | 3300053138 | Bacteria | 1289 |
| 697 | Ga0500620_100742 | 3300053155 | Bacteria | 1010 |
| 698 | Ga0500622_0002322 | 3300053156 | Bacteria | 13902 |
| 699 | Ga0500636_0245373 | 3300053177 | Bacteria | 917 |
| 700 | Ga0500587_002239 | 3300053739 | Bacteria | 2754 |
| 701 | Ga0501084_0104315 | 3300054114 | Bacteria | 2381 |
| 702 | Ga0501084_0369880 | 3300054114 | Bacteria | 1211 |
| 703 | Ga0501082_0071382 | 3300060353 | Bacteria | 2990 |
| 704 | Ga0530510_0047085 | 3300061734 | Bacteria | 3115 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0221999 | Ga0501035_0221999_903_1523 | 201 |
| 2 | 3300005841 | Ga0068863_100005626 | Ga0068863_10000562610 | 203 |
| 3 | 3300005843 | Ga0068860_100001537 | Ga0068860_10000153719 | 203 |
| 4 | 3300006358 | Ga0068871_100001990 | Ga0068871_10000199012 | 203 |
| 5 | 3300025315 | Ga0207697_10026173 | Ga0207697_100261732 | 203 |
| 6 | 3300025923 | Ga0207681_10148940 | Ga0207681_101489402 | 203 |
| 7 | 3300025925 | Ga0207650_10055237 | Ga0207650_100552373 | 203 |
| 8 | 3300025940 | Ga0207691_10000560 | Ga0207691_1000056029 | 203 |
| 9 | 3300025972 | Ga0207668_10139081 | Ga0207668_101390811 | 203 |
| 10 | 3300026088 | Ga0207641_10001267 | Ga0207641_1000126710 | 203 |
| 11 | 3300046537 | Ga0495598_0130313 | Ga0495598_0130313_189_821 | 205 |
| 12 | 3300050494 | nmdc:mga06z11_296264_c1 | nmdc:mga06z11_296264_c1_110_742 | 207 |
| 13 | 3300041410 | Ga0439461_0032289 | Ga0439461_0032289_35_766 | 213 |
| 14 | 3300041997 | Ga0439431_0003072 | Ga0439431_0003072_821_1552 | 213 |
| 15 | 3300046471 | Ga0495650_0017208 | Ga0495650_0017208_2788_3495 | 219 |
| 16 | 3300005544 | Ga0070686_100491366 | Ga0070686_1004913661 | 222 |
| 17 | 3300005617 | Ga0068859_100085712 | Ga0068859_1000857123 | 222 |
| 18 | 3300005843 | Ga0068860_100281938 | Ga0068860_1002819382 | 222 |
| 19 | 3300006931 | Ga0097620_100085713 | Ga0097620_1000857133 | 222 |
| 20 | 3300028381 | Ga0268264_10184782 | Ga0268264_101847822 | 222 |
| 21 | 3300005356 | Ga0070674_100028183 | Ga0070674_1000281832 | 224 |
| 22 | iso_pu_bacteria | 2554235132 | 2554815979 | 224 |
| 23 | iso_pu_bacteria | 2606217733 | 2608382351 | 224 |
| 24 | iso_pu_bacteria | 8011350971 | 8011353108 | 224 |
| 25 | 3300036401 | Ga0373937_1078919 | Ga0373937_1078919_22_729 | 225 |
| 26 | 3300028794 | Ga0307515_10000043 | Ga0307515_1000004397 | 226 |
| 27 | iso_pu_bacteria | 2738543020 | 2739288323 | 226 |
| 28 | iso_pu_bacteria | 2738543021 | 2739293635 | 226 |
| 29 | iso_pu_bacteria | 2808606379 | 2808943360 | 226 |
| 30 | iso_pu_bacteria | 2811994881 | 2812366001 | 226 |
| 31 | iso_pu_bacteria | 2842805378 | 2842810017 | 226 |
| 32 | iso_pu_bacteria | 2923519811 | 2923520022 | 226 |
| 33 | 3300049571 | Ga0501034_0105821 | Ga0501034_0105821_910_1614 | 228 |
| 34 | 3300049574 | Ga0501038_0055716 | Ga0501038_0055716_1395_2099 | 228 |
| 35 | 3300049742 | Ga0501080_0131558 | Ga0501080_0131558_553_1266 | 228 |
| 36 | 3300005336 | Ga0070680_100459243 | Ga0070680_1004592432 | 229 |
| 37 | 3300005344 | Ga0070661_100269692 | Ga0070661_1002696922 | 229 |
| 38 | 3300005458 | Ga0070681_10022463 | Ga0070681_100224633 | 229 |
| 39 | 3300005530 | Ga0070679_100036286 | Ga0070679_1000362864 | 229 |
| 40 | 3300005539 | Ga0068853_100141253 | Ga0068853_1001412532 | 229 |
| 41 | 3300009177 | Ga0105248_10682114 | Ga0105248_106821142 | 229 |
| 42 | 3300013100 | Ga0157373_10049968 | Ga0157373_100499682 | 229 |
| 43 | 3300013297 | Ga0157378_10216390 | Ga0157378_102163903 | 229 |
| 44 | 3300021361 | Ga0213872_10000039 | Ga0213872_1000003917 | 229 |
| 45 | 3300021361 | Ga0213872_10003535 | Ga0213872_100035356 | 229 |
| 46 | 3300025912 | Ga0207707_10144473 | Ga0207707_101444732 | 229 |
| 47 | 3300025917 | Ga0207660_10654886 | Ga0207660_106548861 | 229 |
| 48 | 3300025920 | Ga0207649_10406887 | Ga0207649_104068871 | 229 |
| 49 | 3300026041 | Ga0207639_10901679 | Ga0207639_109016791 | 229 |
| 50 | 3300026078 | Ga0207702_10331428 | Ga0207702_103314282 | 229 |
| 51 | 3300035410 | Ga0373924_0067583 | Ga0373924_0067583_682_1383 | 229 |
| 52 | 3300039447 | Ga0436361_0066314 | Ga0436361_0066314_301_1002 | 229 |
| 53 | 3300039447 | Ga0436361_0140639 | Ga0436361_0140639_3584_4285 | 229 |
| 54 | 3300039447 | Ga0436361_0802941 | Ga0436361_0802941_13826_14527 | 229 |
| 55 | 3300049571 | Ga0501034_0169666 | Ga0501034_0169666_1261_1962 | 229 |
| 56 | 3300049581 | Ga0501047_0091807 | Ga0501047_0091807_465_1166 | 229 |
| 57 | 3300049583 | Ga0501067_0002963 | Ga0501067_0002963_6456_7157 | 229 |
| 58 | 3300049585 | Ga0501069_0064473 | Ga0501069_0064473_134_835 | 229 |
| 59 | 3300049586 | Ga0501070_0010157 | Ga0501070_0010157_6265_6966 | 229 |
| 60 | 3300049588 | Ga0501072_0375371 | Ga0501072_0375371_134_835 | 229 |
| 61 | 3300049589 | Ga0501073_0071197 | Ga0501073_0071197_400_1101 | 229 |
| 62 | 3300049742 | Ga0501080_0012021 | Ga0501080_0012021_2004_2705 | 229 |
| 63 | 3300049744 | Ga0501083_0079511 | Ga0501083_0079511_269_970 | 229 |
| 64 | 3300013104 | Ga0157370_10217892 | Ga0157370_102178922 | 230 |
| 65 | 3300015261 | Ga0182006_1041046 | Ga0182006_10410461 | 230 |
| 66 | 3300017792 | Ga0163161_10075864 | Ga0163161_100758643 | 230 |
| 67 | 3300025960 | Ga0207651_10374176 | Ga0207651_103741763 | 230 |
| 68 | 3300025981 | Ga0207640_10548987 | Ga0207640_105489872 | 230 |
| 69 | 3300032002 | Ga0307416_100619383 | Ga0307416_1006193831 | 230 |
| 70 | 3300032004 | Ga0307414_10042212 | Ga0307414_100422124 | 230 |
| 71 | 3300041404 | Ga0439436_0004806 | Ga0439436_0004806_3327_4034 | 230 |
| 72 | 3300041405 | Ga0439438_001058 | Ga0439438_001058_6602_7309 | 230 |
| 73 | 3300041407 | Ga0439447_002801 | Ga0439447_002801_1131_1838 | 230 |
| 74 | 3300041411 | Ga0439466_0009867 | Ga0439466_0009867_203_910 | 230 |
| 75 | 3300041411 | Ga0439466_0031669 | Ga0439466_0031669_455_1243 | 230 |
| 76 | 3300042006 | Ga0439432_020125 | Ga0439432_020125_966_1673 | 230 |
| 77 | 3300042010 | Ga0439452_001765 | Ga0439452_001765_5929_6636 | 230 |
| 78 | 3300042435 | Ga0439434_0007658 | Ga0439434_0007658_418_1125 | 230 |
| 79 | 3300044656 | Ga0466969_0002491 | Ga0466969_0002491_6182_6883 | 230 |
| 80 | 3300044683 | Ga0466965_0025036 | Ga0466965_0025036_1043_1744 | 230 |
| 81 | 3300044684 | Ga0466966_0040196 | Ga0466966_0040196_220_921 | 230 |
| 82 | 3300044706 | Ga0466964_0024757 | Ga0466964_0024757_49_750 | 230 |
| 83 | 3300045049 | Ga0466959_0002925 | Ga0466959_0002925_5754_6455 | 230 |
| 84 | 3300046507 | Ga0495606_0000054 | Ga0495606_0000054_45476_46183 | 230 |
| 85 | 3300046522 | Ga0495643_0000186 | Ga0495643_0000186_1347_2054 | 230 |
| 86 | 3300046522 | Ga0495643_0002089 | Ga0495643_0002089_1275_1982 | 230 |
| 87 | 3300046692 | Ga0495671_0004823 | Ga0495671_0004823_1684_2391 | 230 |
| 88 | 3300046694 | Ga0495649_0020354 | Ga0495649_0020354_284_991 | 230 |
| 89 | 3300046694 | Ga0495649_0046844 | Ga0495649_0046844_565_1272 | 230 |
| 90 | 3300046810 | Ga0495660_0222688 | Ga0495660_0222688_129_869 | 230 |
| 91 | 3300049569 | Ga0501032_0008791 | Ga0501032_0008791_2162_2950 | 230 |
| 92 | 3300005328 | Ga0070676_10000988 | Ga0070676_100009882 | 231 |
| 93 | 3300005328 | Ga0070676_10032638 | Ga0070676_100326382 | 231 |
| 94 | 3300005328 | Ga0070676_10059241 | Ga0070676_100592412 | 231 |
| 95 | 3300005328 | Ga0070676_10197125 | Ga0070676_101971252 | 231 |
| 96 | 3300005330 | Ga0070690_100223598 | Ga0070690_1002235982 | 231 |
| 97 | 3300005331 | Ga0070670_100011047 | Ga0070670_1000110473 | 231 |
| 98 | 3300005331 | Ga0070670_100027074 | Ga0070670_1000270742 | 231 |
| 99 | 3300005331 | Ga0070670_100029619 | Ga0070670_1000296194 | 231 |
| 100 | 3300005331 | Ga0070670_100128779 | Ga0070670_1001287792 | 231 |
| 101 | 3300005331 | Ga0070670_100234413 | Ga0070670_1002344132 | 231 |
| 102 | 3300005331 | Ga0070670_100808522 | Ga0070670_1008085221 | 231 |
| 103 | 3300005333 | Ga0070677_10041781 | Ga0070677_100417812 | 231 |
| 104 | 3300005334 | Ga0068869_100005217 | Ga0068869_1000052176 | 231 |
| 105 | 3300005334 | Ga0068869_100007185 | Ga0068869_1000071855 | 231 |
| 106 | 3300005335 | Ga0070666_10001990 | Ga0070666_1000199010 | 231 |
| 107 | 3300005335 | Ga0070666_10081007 | Ga0070666_100810072 | 231 |
| 108 | 3300005335 | Ga0070666_10546603 | Ga0070666_105466031 | 231 |
| 109 | 3300005336 | Ga0070680_100651511 | Ga0070680_1006515111 | 231 |
| 110 | 3300005338 | Ga0068868_100007819 | Ga0068868_1000078196 | 231 |
| 111 | 3300005338 | Ga0068868_100351500 | Ga0068868_1003515001 | 231 |
| 112 | 3300005339 | Ga0070660_100001840 | Ga0070660_1000018405 | 231 |
| 113 | 3300005340 | Ga0070689_100030639 | Ga0070689_1000306392 | 231 |
| 114 | 3300005340 | Ga0070689_100057351 | Ga0070689_1000573512 | 231 |
| 115 | 3300005343 | Ga0070687_100075003 | Ga0070687_1000750033 | 231 |
| 116 | 3300005344 | Ga0070661_100007211 | Ga0070661_1000072113 | 231 |
| 117 | 3300005347 | Ga0070668_100007290 | Ga0070668_1000072902 | 231 |
| 118 | 3300005347 | Ga0070668_100163744 | Ga0070668_1001637441 | 231 |
| 119 | 3300005347 | Ga0070668_100393515 | Ga0070668_1003935152 | 231 |
| 120 | 3300005353 | Ga0070669_100001481 | Ga0070669_1000014818 | 231 |
| 121 | 3300005353 | Ga0070669_100151055 | Ga0070669_1001510552 | 231 |
| 122 | 3300005353 | Ga0070669_100177476 | Ga0070669_1001774762 | 231 |
| 123 | 3300005354 | Ga0070675_100003903 | Ga0070675_1000039032 | 231 |
| 124 | 3300005354 | Ga0070675_100003952 | Ga0070675_1000039522 | 231 |
| 125 | 3300005354 | Ga0070675_100016457 | Ga0070675_1000164577 | 231 |
| 126 | 3300005354 | Ga0070675_100163285 | Ga0070675_1001632851 | 231 |
| 127 | 3300005355 | Ga0070671_100001117 | Ga0070671_10000111712 | 231 |
| 128 | 3300005355 | Ga0070671_100017774 | Ga0070671_1000177742 | 231 |
| 129 | 3300005355 | Ga0070671_100095852 | Ga0070671_1000958522 | 231 |
| 130 | 3300005356 | Ga0070674_100275437 | Ga0070674_1002754371 | 231 |
| 131 | 3300005364 | Ga0070673_100026652 | Ga0070673_1000266522 | 231 |
| 132 | 3300005364 | Ga0070673_100034104 | Ga0070673_1000341043 | 231 |
| 133 | 3300005364 | Ga0070673_100036746 | Ga0070673_1000367462 | 231 |
| 134 | 3300005364 | Ga0070673_100360607 | Ga0070673_1003606072 | 231 |
| 135 | 3300005365 | Ga0070688_100105802 | Ga0070688_1001058023 | 231 |
| 136 | 3300005365 | Ga0070688_100147238 | Ga0070688_1001472382 | 231 |
| 137 | 3300005366 | Ga0070659_100003840 | Ga0070659_1000038403 | 231 |
| 138 | 3300005366 | Ga0070659_100206080 | Ga0070659_1002060802 | 231 |
| 139 | 3300005367 | Ga0070667_100006553 | Ga0070667_1000065532 | 231 |
| 140 | 3300005367 | Ga0070667_100087072 | Ga0070667_1000870722 | 231 |
| 141 | 3300005367 | Ga0070667_100138879 | Ga0070667_1001388792 | 231 |
| 142 | 3300005367 | Ga0070667_100165886 | Ga0070667_1001658862 | 231 |
| 143 | 3300005367 | Ga0070667_100242661 | Ga0070667_1002426612 | 231 |
| 144 | 3300005367 | Ga0070667_100501969 | Ga0070667_1005019692 | 231 |
| 145 | 3300005367 | Ga0070667_100510692 | Ga0070667_1005106921 | 231 |
| 146 | 3300005434 | Ga0070709_10064574 | Ga0070709_100645742 | 231 |
| 147 | 3300005434 | Ga0070709_10356203 | Ga0070709_103562031 | 231 |
| 148 | 3300005440 | Ga0070705_100014585 | Ga0070705_1000145852 | 231 |
| 149 | 3300005441 | Ga0070700_100028894 | Ga0070700_1000288943 | 231 |
| 150 | 3300005441 | Ga0070700_100105481 | Ga0070700_1001054812 | 231 |
| 151 | 3300005444 | Ga0070694_100137251 | Ga0070694_1001372512 | 231 |
| 152 | 3300005455 | Ga0070663_100100178 | Ga0070663_1001001782 | 231 |
| 153 | 3300005456 | Ga0070678_100001068 | Ga0070678_1000010683 | 231 |
| 154 | 3300005456 | Ga0070678_100074216 | Ga0070678_1000742162 | 231 |
| 155 | 3300005457 | Ga0070662_100000568 | Ga0070662_10000056810 | 231 |
| 156 | 3300005457 | Ga0070662_100026453 | Ga0070662_1000264534 | 231 |
| 157 | 3300005459 | Ga0068867_100008617 | Ga0068867_1000086174 | 231 |
| 158 | 3300005539 | Ga0068853_100007620 | Ga0068853_1000076206 | 231 |
| 159 | 3300005539 | Ga0068853_100037771 | Ga0068853_1000377713 | 231 |
| 160 | 3300005539 | Ga0068853_100577885 | Ga0068853_1005778852 | 231 |
| 161 | 3300005543 | Ga0070672_100002490 | Ga0070672_10000249011 | 231 |
| 162 | 3300005543 | Ga0070672_100020253 | Ga0070672_1000202533 | 231 |
| 163 | 3300005543 | Ga0070672_100030145 | Ga0070672_1000301452 | 231 |
| 164 | 3300005543 | Ga0070672_100040170 | Ga0070672_1000401703 | 231 |
| 165 | 3300005543 | Ga0070672_100057707 | Ga0070672_1000577072 | 231 |
| 166 | 3300005548 | Ga0070665_100015080 | Ga0070665_1000150802 | 231 |
| 167 | 3300005548 | Ga0070665_100148849 | Ga0070665_1001488492 | 231 |
| 168 | 3300005549 | Ga0070704_100046097 | Ga0070704_1000460972 | 231 |
| 169 | 3300005549 | Ga0070704_100155304 | Ga0070704_1001553042 | 231 |
| 170 | 3300005563 | Ga0068855_100000634 | Ga0068855_1000006348 | 231 |
| 171 | 3300005564 | Ga0070664_100000284 | Ga0070664_10000028431 | 231 |
| 172 | 3300005564 | Ga0070664_100021720 | Ga0070664_1000217202 | 231 |
| 173 | 3300005577 | Ga0068857_100375847 | Ga0068857_1003758472 | 231 |
| 174 | 3300005577 | Ga0068857_100631053 | Ga0068857_1006310532 | 231 |
| 175 | 3300005578 | Ga0068854_100049038 | Ga0068854_1000490383 | 231 |
| 176 | 3300005614 | Ga0068856_100002570 | Ga0068856_10000257011 | 231 |
| 177 | 3300005616 | Ga0068852_100138341 | Ga0068852_1001383412 | 231 |
| 178 | 3300005617 | Ga0068859_100015900 | Ga0068859_1000159006 | 231 |
| 179 | 3300005617 | Ga0068859_100051729 | Ga0068859_1000517294 | 231 |
| 180 | 3300005617 | Ga0068859_100449046 | Ga0068859_1004490462 | 231 |
| 181 | 3300005618 | Ga0068864_100007878 | Ga0068864_1000078785 | 231 |
| 182 | 3300005618 | Ga0068864_100129114 | Ga0068864_1001291143 | 231 |
| 183 | 3300005618 | Ga0068864_100185590 | Ga0068864_1001855902 | 231 |
| 184 | 3300005618 | Ga0068864_100378721 | Ga0068864_1003787212 | 231 |
| 185 | 3300005618 | Ga0068864_100634801 | Ga0068864_1006348011 | 231 |
| 186 | 3300005718 | Ga0068866_10033452 | Ga0068866_100334522 | 231 |
| 187 | 3300005719 | Ga0068861_100027161 | Ga0068861_1000271612 | 231 |
| 188 | 3300005719 | Ga0068861_100055829 | Ga0068861_1000558292 | 231 |
| 189 | 3300005719 | Ga0068861_100200240 | Ga0068861_1002002402 | 231 |
| 190 | 3300005841 | Ga0068863_100020743 | Ga0068863_1000207435 | 231 |
| 191 | 3300005841 | Ga0068863_100096665 | Ga0068863_1000966652 | 231 |
| 192 | 3300005841 | Ga0068863_100318451 | Ga0068863_1003184512 | 231 |
| 193 | 3300005841 | Ga0068863_100531903 | Ga0068863_1005319032 | 231 |
| 194 | 3300005842 | Ga0068858_100001792 | Ga0068858_1000017922 | 231 |
| 195 | 3300005842 | Ga0068858_100085205 | Ga0068858_1000852053 | 231 |
| 196 | 3300005842 | Ga0068858_100089656 | Ga0068858_1000896563 | 231 |
| 197 | 3300005842 | Ga0068858_100458323 | Ga0068858_1004583232 | 231 |
| 198 | 3300005842 | Ga0068858_100806786 | Ga0068858_1008067862 | 231 |
| 199 | 3300005843 | Ga0068860_100006790 | Ga0068860_1000067903 | 231 |
| 200 | 3300005843 | Ga0068860_100022341 | Ga0068860_1000223412 | 231 |
| 201 | 3300005843 | Ga0068860_100121064 | Ga0068860_1001210643 | 231 |
| 202 | 3300005843 | Ga0068860_100534128 | Ga0068860_1005341282 | 231 |
| 203 | 3300005844 | Ga0068862_100086607 | Ga0068862_1000866072 | 231 |
| 204 | 3300005844 | Ga0068862_100493706 | Ga0068862_1004937061 | 231 |
| 205 | 3300005844 | Ga0068862_100830913 | Ga0068862_1008309131 | 231 |
| 206 | 3300006237 | Ga0097621_100004956 | Ga0097621_1000049567 | 231 |
| 207 | 3300006237 | Ga0097621_100030965 | Ga0097621_1000309653 | 231 |
| 208 | 3300006237 | Ga0097621_100103720 | Ga0097621_1001037202 | 231 |
| 209 | 3300006237 | Ga0097621_100460720 | Ga0097621_1004607202 | 231 |
| 210 | 3300006237 | Ga0097621_100532770 | Ga0097621_1005327702 | 231 |
| 211 | 3300006358 | Ga0068871_100126600 | Ga0068871_1001266002 | 231 |
| 212 | 3300006844 | Ga0075428_100493819 | Ga0075428_1004938192 | 231 |
| 213 | 3300006881 | Ga0068865_100019556 | Ga0068865_1000195564 | 231 |
| 214 | 3300006881 | Ga0068865_100046157 | Ga0068865_1000461572 | 231 |
| 215 | 3300006931 | Ga0097620_100015901 | Ga0097620_1000159016 | 231 |
| 216 | 3300006931 | Ga0097620_100051730 | Ga0097620_1000517302 | 231 |
| 217 | 3300006931 | Ga0097620_100449069 | Ga0097620_1004490692 | 231 |
| 218 | 3300009093 | Ga0105240_10153438 | Ga0105240_101534382 | 231 |
| 219 | 3300009094 | Ga0111539_10157686 | Ga0111539_101576864 | 231 |
| 220 | 3300009098 | Ga0105245_10838128 | Ga0105245_108381282 | 231 |
| 221 | 3300009148 | Ga0105243_10162362 | Ga0105243_101623622 | 231 |
| 222 | 3300009174 | Ga0105241_10382204 | Ga0105241_103822042 | 231 |
| 223 | 3300009177 | Ga0105248_10043944 | Ga0105248_100439442 | 231 |
| 224 | 3300009177 | Ga0105248_10061166 | Ga0105248_100611662 | 231 |
| 225 | 3300009177 | Ga0105248_10099672 | Ga0105248_100996723 | 231 |
| 226 | 3300009177 | Ga0105248_10363865 | Ga0105248_103638652 | 231 |
| 227 | 3300009545 | Ga0105237_10164076 | Ga0105237_101640762 | 231 |
| 228 | 3300009545 | Ga0105237_10227009 | Ga0105237_102270092 | 231 |
| 229 | 3300009551 | Ga0105238_11059096 | Ga0105238_110590961 | 231 |
| 230 | 3300009553 | Ga0105249_10359825 | Ga0105249_103598251 | 231 |
| 231 | 3300009553 | Ga0105249_10420356 | Ga0105249_104203562 | 231 |
| 232 | 3300010375 | Ga0105239_11444675 | Ga0105239_114446751 | 231 |
| 233 | 3300013100 | Ga0157373_10000725 | Ga0157373_1000072530 | 231 |
| 234 | 3300013102 | Ga0157371_10000174 | Ga0157371_1000017429 | 231 |
| 235 | 3300013105 | Ga0157369_10037961 | Ga0157369_100379612 | 231 |
| 236 | 3300013105 | Ga0157369_10093235 | Ga0157369_100932352 | 231 |
| 237 | 3300013296 | Ga0157374_10002680 | Ga0157374_100026805 | 231 |
| 238 | 3300013296 | Ga0157374_10131636 | Ga0157374_101316362 | 231 |
| 239 | 3300013296 | Ga0157374_11118606 | Ga0157374_111186061 | 231 |
| 240 | 3300013297 | Ga0157378_10024063 | Ga0157378_100240633 | 231 |
| 241 | 3300013306 | Ga0163162_10000874 | Ga0163162_1000087414 | 231 |
| 242 | 3300013306 | Ga0163162_10288577 | Ga0163162_102885772 | 231 |
| 243 | 3300013306 | Ga0163162_10365839 | Ga0163162_103658392 | 231 |
| 244 | 3300013306 | Ga0163162_10710382 | Ga0163162_107103822 | 231 |
| 245 | 3300013307 | Ga0157372_10003340 | Ga0157372_100033404 | 231 |
| 246 | 3300013307 | Ga0157372_10104047 | Ga0157372_101040472 | 231 |
| 247 | 3300013308 | Ga0157375_10022155 | Ga0157375_100221553 | 231 |
| 248 | 3300013308 | Ga0157375_10106995 | Ga0157375_101069953 | 231 |
| 249 | 3300013308 | Ga0157375_10242118 | Ga0157375_102421182 | 231 |
| 250 | 3300014325 | Ga0163163_10108928 | Ga0163163_101089282 | 231 |
| 251 | 3300014325 | Ga0163163_10151081 | Ga0163163_101510812 | 231 |
| 252 | 3300014325 | Ga0163163_10870092 | Ga0163163_108700922 | 231 |
| 253 | 3300014326 | Ga0157380_10148510 | Ga0157380_101485103 | 231 |
| 254 | 3300014326 | Ga0157380_10812247 | Ga0157380_108122471 | 231 |
| 255 | 3300014968 | Ga0157379_10027155 | Ga0157379_100271552 | 231 |
| 256 | 3300014968 | Ga0157379_10401633 | Ga0157379_104016332 | 231 |
| 257 | 3300014969 | Ga0157376_10029815 | Ga0157376_100298153 | 231 |
| 258 | 3300014969 | Ga0157376_10302929 | Ga0157376_103029292 | 231 |
| 259 | 3300014969 | Ga0157376_10524853 | Ga0157376_105248532 | 231 |
| 260 | 3300017792 | Ga0163161_10008757 | Ga0163161_100087577 | 231 |
| 261 | 3300017792 | Ga0163161_10011177 | Ga0163161_100111773 | 231 |
| 262 | 3300017792 | Ga0163161_10072241 | Ga0163161_100722413 | 231 |
| 263 | 3300021361 | Ga0213872_10018955 | Ga0213872_100189555 | 231 |
| 264 | 3300021361 | Ga0213872_10042168 | Ga0213872_100421681 | 231 |
| 265 | 3300025899 | Ga0207642_10002800 | Ga0207642_100028002 | 231 |
| 266 | 3300025903 | Ga0207680_10379191 | Ga0207680_103791912 | 231 |
| 267 | 3300025906 | Ga0207699_10029358 | Ga0207699_100293582 | 231 |
| 268 | 3300025907 | Ga0207645_10002076 | Ga0207645_100020762 | 231 |
| 269 | 3300025907 | Ga0207645_10027073 | Ga0207645_100270732 | 231 |
| 270 | 3300025907 | Ga0207645_10193592 | Ga0207645_101935922 | 231 |
| 271 | 3300025907 | Ga0207645_10196522 | Ga0207645_101965222 | 231 |
| 272 | 3300025908 | Ga0207643_10132103 | Ga0207643_101321032 | 231 |
| 273 | 3300025908 | Ga0207643_10152372 | Ga0207643_101523722 | 231 |
| 274 | 3300025913 | Ga0207695_10033923 | Ga0207695_100339236 | 231 |
| 275 | 3300025914 | Ga0207671_10051611 | Ga0207671_100516112 | 231 |
| 276 | 3300025914 | Ga0207671_10141102 | Ga0207671_101411022 | 231 |
| 277 | 3300025917 | Ga0207660_10182858 | Ga0207660_101828582 | 231 |
| 278 | 3300025918 | Ga0207662_10091692 | Ga0207662_100916923 | 231 |
| 279 | 3300025919 | Ga0207657_10000234 | Ga0207657_1000023425 | 231 |
| 280 | 3300025923 | Ga0207681_10437998 | Ga0207681_104379982 | 231 |
| 281 | 3300025925 | Ga0207650_10061109 | Ga0207650_100611092 | 231 |
| 282 | 3300025925 | Ga0207650_10157113 | Ga0207650_101571132 | 231 |
| 283 | 3300025925 | Ga0207650_10447813 | Ga0207650_104478131 | 231 |
| 284 | 3300025926 | Ga0207659_10001621 | Ga0207659_100016214 | 231 |
| 285 | 3300025926 | Ga0207659_10012764 | Ga0207659_100127645 | 231 |
| 286 | 3300025926 | Ga0207659_10024879 | Ga0207659_100248792 | 231 |
| 287 | 3300025926 | Ga0207659_10189075 | Ga0207659_101890751 | 231 |
| 288 | 3300025931 | Ga0207644_10061954 | Ga0207644_100619542 | 231 |
| 289 | 3300025932 | Ga0207690_10001827 | Ga0207690_1000182710 | 231 |
| 290 | 3300025932 | Ga0207690_10096425 | Ga0207690_100964252 | 231 |
| 291 | 3300025933 | Ga0207706_10000097 | Ga0207706_1000009717 | 231 |
| 292 | 3300025933 | Ga0207706_10031431 | Ga0207706_100314313 | 231 |
| 293 | 3300025937 | Ga0207669_10357955 | Ga0207669_103579552 | 231 |
| 294 | 3300025938 | Ga0207704_10040950 | Ga0207704_100409502 | 231 |
| 295 | 3300025939 | Ga0207665_10112750 | Ga0207665_101127502 | 231 |
| 296 | 3300025940 | Ga0207691_10001443 | Ga0207691_1000144320 | 231 |
| 297 | 3300025940 | Ga0207691_10002036 | Ga0207691_100020363 | 231 |
| 298 | 3300025940 | Ga0207691_10070698 | Ga0207691_100706982 | 231 |
| 299 | 3300025941 | Ga0207711_10039000 | Ga0207711_100390004 | 231 |
| 300 | 3300025941 | Ga0207711_10307975 | Ga0207711_103079752 | 231 |
| 301 | 3300025942 | Ga0207689_10004023 | Ga0207689_1000402311 | 231 |
| 302 | 3300025942 | Ga0207689_10006812 | Ga0207689_100068125 | 231 |
| 303 | 3300025942 | Ga0207689_10116175 | Ga0207689_101161752 | 231 |
| 304 | 3300025945 | Ga0207679_10005476 | Ga0207679_100054762 | 231 |
| 305 | 3300025945 | Ga0207679_10011985 | Ga0207679_100119852 | 231 |
| 306 | 3300025949 | Ga0207667_10007232 | Ga0207667_100072325 | 231 |
| 307 | 3300025960 | Ga0207651_10031284 | Ga0207651_100312843 | 231 |
| 308 | 3300025960 | Ga0207651_10476235 | Ga0207651_104762352 | 231 |
| 309 | 3300025972 | Ga0207668_10081407 | Ga0207668_100814072 | 231 |
| 310 | 3300025972 | Ga0207668_10115132 | Ga0207668_101151322 | 231 |
| 311 | 3300025986 | Ga0207658_10006716 | Ga0207658_100067162 | 231 |
| 312 | 3300025986 | Ga0207658_10061373 | Ga0207658_100613732 | 231 |
| 313 | 3300025986 | Ga0207658_10065233 | Ga0207658_100652332 | 231 |
| 314 | 3300025986 | Ga0207658_10067716 | Ga0207658_100677162 | 231 |
| 315 | 3300025986 | Ga0207658_10104476 | Ga0207658_101044762 | 231 |
| 316 | 3300025986 | Ga0207658_10135676 | Ga0207658_101356762 | 231 |
| 317 | 3300025986 | Ga0207658_10291351 | Ga0207658_102913512 | 231 |
| 318 | 3300025986 | Ga0207658_10752160 | Ga0207658_107521602 | 231 |
| 319 | 3300026035 | Ga0207703_10007993 | Ga0207703_100079932 | 231 |
| 320 | 3300026035 | Ga0207703_10031311 | Ga0207703_100313115 | 231 |
| 321 | 3300026035 | Ga0207703_10034431 | Ga0207703_100344312 | 231 |
| 322 | 3300026035 | Ga0207703_10380140 | Ga0207703_103801402 | 231 |
| 323 | 3300026067 | Ga0207678_10008512 | Ga0207678_100085122 | 231 |
| 324 | 3300026067 | Ga0207678_10153657 | Ga0207678_101536573 | 231 |
| 325 | 3300026075 | Ga0207708_10226753 | Ga0207708_102267532 | 231 |
| 326 | 3300026078 | Ga0207702_10006007 | Ga0207702_100060073 | 231 |
| 327 | 3300026088 | Ga0207641_10125237 | Ga0207641_101252373 | 231 |
| 328 | 3300026088 | Ga0207641_10177309 | Ga0207641_101773093 | 231 |
| 329 | 3300026088 | Ga0207641_10234578 | Ga0207641_102345782 | 231 |
| 330 | 3300026088 | Ga0207641_10345818 | Ga0207641_103458182 | 231 |
| 331 | 3300026089 | Ga0207648_10000715 | Ga0207648_1000071529 | 231 |
| 332 | 3300026089 | Ga0207648_10027630 | Ga0207648_100276304 | 231 |
| 333 | 3300026089 | Ga0207648_10046341 | Ga0207648_100463412 | 231 |
| 334 | 3300026095 | Ga0207676_10050276 | Ga0207676_100502763 | 231 |
| 335 | 3300026095 | Ga0207676_10085586 | Ga0207676_100855862 | 231 |
| 336 | 3300026095 | Ga0207676_10142397 | Ga0207676_101423972 | 231 |
| 337 | 3300026095 | Ga0207676_10185756 | Ga0207676_101857562 | 231 |
| 338 | 3300026116 | Ga0207674_10015936 | Ga0207674_100159367 | 231 |
| 339 | 3300026116 | Ga0207674_10808803 | Ga0207674_108088031 | 231 |
| 340 | 3300026118 | Ga0207675_100011665 | Ga0207675_1000116654 | 231 |
| 341 | 3300026118 | Ga0207675_100063074 | Ga0207675_1000630742 | 231 |
| 342 | 3300026121 | Ga0207683_10000219 | Ga0207683_1000021919 | 231 |
| 343 | 3300026121 | Ga0207683_10014592 | Ga0207683_100145927 | 231 |
| 344 | 3300026121 | Ga0207683_10160144 | Ga0207683_101601443 | 231 |
| 345 | 3300026121 | Ga0207683_10392641 | Ga0207683_103926412 | 231 |
| 346 | 3300026121 | Ga0207683_10859069 | Ga0207683_108590691 | 231 |
| 347 | 3300026142 | Ga0207698_10108196 | Ga0207698_101081962 | 231 |
| 348 | 3300027665 | Ga0209983_1007518 | Ga0209983_10075182 | 231 |
| 349 | 3300027876 | Ga0209974_10010689 | Ga0209974_100106893 | 231 |
| 350 | 3300027876 | Ga0209974_10027741 | Ga0209974_100277411 | 231 |
| 351 | 3300028379 | Ga0268266_10690482 | Ga0268266_106904821 | 231 |
| 352 | 3300028380 | Ga0268265_10043796 | Ga0268265_100437962 | 231 |
| 353 | 3300028380 | Ga0268265_10150039 | Ga0268265_101500392 | 231 |
| 354 | 3300028381 | Ga0268264_10005529 | Ga0268264_100055298 | 231 |
| 355 | 3300028381 | Ga0268264_10026951 | Ga0268264_100269515 | 231 |
| 356 | 3300028381 | Ga0268264_10174991 | Ga0268264_101749912 | 231 |
| 357 | 3300028381 | Ga0268264_10175273 | Ga0268264_101752732 | 231 |
| 358 | 3300031548 | Ga0307408_100027666 | Ga0307408_1000276662 | 231 |
| 359 | 3300031548 | Ga0307408_100034225 | Ga0307408_1000342252 | 231 |
| 360 | 3300031548 | Ga0307408_100035671 | Ga0307408_1000356714 | 231 |
| 361 | 3300031731 | Ga0307405_10035194 | Ga0307405_100351942 | 231 |
| 362 | 3300031824 | Ga0307413_10007125 | Ga0307413_100071255 | 231 |
| 363 | 3300031852 | Ga0307410_10129940 | Ga0307410_101299402 | 231 |
| 364 | 3300031852 | Ga0307410_10147647 | Ga0307410_101476472 | 231 |
| 365 | 3300031852 | Ga0307410_10376234 | Ga0307410_103762341 | 231 |
| 366 | 3300031901 | Ga0307406_10006344 | Ga0307406_100063446 | 231 |
| 367 | 3300031911 | Ga0307412_10030179 | Ga0307412_100301791 | 231 |
| 368 | 3300031995 | Ga0307409_100009797 | Ga0307409_1000097975 | 231 |
| 369 | 3300032002 | Ga0307416_100049300 | Ga0307416_1000493002 | 231 |
| 370 | 3300032004 | Ga0307414_10069020 | Ga0307414_100690202 | 231 |
| 371 | 3300032005 | Ga0307411_10001127 | Ga0307411_100011275 | 231 |
| 372 | 3300032126 | Ga0307415_100050588 | Ga0307415_1000505882 | 231 |
| 373 | 3300035089 | Ga0373944_0009231 | Ga0373944_0009231_1592_2299 | 231 |
| 374 | 3300035092 | Ga0373952_0000139 | Ga0373952_0000139_6612_7403 | 231 |
| 375 | 3300035111 | Ga0373923_0098598 | Ga0373923_0098598_422_1129 | 231 |
| 376 | 3300035691 | Ga0373931_0045579 | Ga0373931_0045579_1186_1893 | 231 |
| 377 | 3300035695 | Ga0373927_0377892 | Ga0373927_0377892_46_879 | 231 |
| 378 | 3300036401 | Ga0373937_0696335 | Ga0373937_0696335_245_952 | 231 |
| 379 | 3300037418 | Ga0395900_0159573 | Ga0395900_0159573_627_1331 | 231 |
| 380 | 3300039447 | Ga0436361_0240373 | Ga0436361_0240373_2117_2830 | 231 |
| 381 | 3300039447 | Ga0436361_0410838 | Ga0436361_0410838_709_1422 | 231 |
| 382 | 3300042876 | Ga0451577_0141935 | Ga0451577_0141935_1144_1851 | 231 |
| 383 | 3300045051 | Ga0451576_0280596 | Ga0451576_0280596_366_1073 | 231 |
| 384 | 3300045976 | Ga0466967_0593959 | Ga0466967_0593959_328_1035 | 231 |
| 385 | 3300048905 | Ga0496102_0006489 | Ga0496102_0006489_6493_7200 | 231 |
| 386 | 3300048905 | Ga0496102_0021108 | Ga0496102_0021108_3293_4033 | 231 |
| 387 | 3300048906 | Ga0496103_0019865 | Ga0496103_0019865_2722_3429 | 231 |
| 388 | 3300048907 | Ga0496104_0564221 | Ga0496104_0564221_290_997 | 231 |
| 389 | 3300048909 | Ga0496106_0003851 | Ga0496106_0003851_9538_10245 | 231 |
| 390 | 3300048911 | Ga0496108_0086157 | Ga0496108_0086157_1159_1866 | 231 |
| 391 | 3300048912 | Ga0496109_0158476 | Ga0496109_0158476_1283_1990 | 231 |
| 392 | 3300048917 | Ga0496114_0187136 | Ga0496114_0187136_432_1139 | 231 |
| 393 | 3300049569 | Ga0501032_0001096 | Ga0501032_0001096_8246_8950 | 231 |
| 394 | 3300049571 | Ga0501034_0117331 | Ga0501034_0117331_1439_2143 | 231 |
| 395 | 3300049573 | Ga0501037_0194247 | Ga0501037_0194247_337_1041 | 231 |
| 396 | 3300049574 | Ga0501038_0005073 | Ga0501038_0005073_4198_4905 | 231 |
| 397 | 3300049823 | Ga0501044_0372736 | Ga0501044_0372736_278_979 | 231 |
| 398 | 3300050511 | nmdc:mga08y16_543842_c1 | nmdc:mga08y16_543842_c1_241_954 | 231 |
| 399 | iso_pu_bacteria | 2643221654 | 2644304778 | 231 |
| 400 | 3300005333 | Ga0070677_10102207 | Ga0070677_101022072 | 232 |
| 401 | 3300005340 | Ga0070689_100006107 | Ga0070689_1000061079 | 232 |
| 402 | 3300005340 | Ga0070689_100031394 | Ga0070689_1000313944 | 232 |
| 403 | 3300005340 | Ga0070689_100107539 | Ga0070689_1001075394 | 232 |
| 404 | 3300005364 | Ga0070673_100102030 | Ga0070673_1001020303 | 232 |
| 405 | 3300005366 | Ga0070659_100488884 | Ga0070659_1004888842 | 232 |
| 406 | 3300005434 | Ga0070709_10094017 | Ga0070709_100940172 | 232 |
| 407 | 3300005543 | Ga0070672_100018765 | Ga0070672_1000187656 | 232 |
| 408 | 3300005547 | Ga0070693_100002437 | Ga0070693_1000024372 | 232 |
| 409 | 3300005547 | Ga0070693_100031171 | Ga0070693_1000311713 | 232 |
| 410 | 3300005563 | Ga0068855_100025708 | Ga0068855_1000257085 | 232 |
| 411 | 3300005577 | Ga0068857_100077453 | Ga0068857_1000774534 | 232 |
| 412 | 3300005615 | Ga0070702_100125329 | Ga0070702_1001253292 | 232 |
| 413 | 3300005617 | Ga0068859_100276118 | Ga0068859_1002761182 | 232 |
| 414 | 3300005617 | Ga0068859_100445009 | Ga0068859_1004450092 | 232 |
| 415 | 3300005618 | Ga0068864_100234601 | Ga0068864_1002346012 | 232 |
| 416 | 3300005618 | Ga0068864_100260593 | Ga0068864_1002605932 | 232 |
| 417 | 3300005842 | Ga0068858_100037909 | Ga0068858_1000379094 | 232 |
| 418 | 3300005842 | Ga0068858_100377723 | Ga0068858_1003777231 | 232 |
| 419 | 3300006051 | Ga0075364_10004928 | Ga0075364_100049284 | 232 |
| 420 | 3300006058 | Ga0075432_10012877 | Ga0075432_100128774 | 232 |
| 421 | 3300006186 | Ga0075369_10000707 | Ga0075369_1000070710 | 232 |
| 422 | 3300006195 | Ga0075366_10009565 | Ga0075366_100095653 | 232 |
| 423 | 3300006237 | Ga0097621_100074566 | Ga0097621_1000745663 | 232 |
| 424 | 3300006237 | Ga0097621_100243257 | Ga0097621_1002432572 | 232 |
| 425 | 3300006237 | Ga0097621_100312364 | Ga0097621_1003123642 | 232 |
| 426 | 3300006358 | Ga0068871_100142299 | Ga0068871_1001422992 | 232 |
| 427 | 3300006358 | Ga0068871_100229181 | Ga0068871_1002291813 | 232 |
| 428 | 3300006852 | Ga0075433_10255583 | Ga0075433_102555832 | 232 |
| 429 | 3300006931 | Ga0097620_100276108 | Ga0097620_1002761082 | 232 |
| 430 | 3300006931 | Ga0097620_100444995 | Ga0097620_1004449952 | 232 |
| 431 | 3300009093 | Ga0105240_10014966 | Ga0105240_100149668 | 232 |
| 432 | 3300009093 | Ga0105240_10080044 | Ga0105240_100800445 | 232 |
| 433 | 3300009093 | Ga0105240_10119737 | Ga0105240_101197372 | 232 |
| 434 | 3300009094 | Ga0111539_10003518 | Ga0111539_1000351812 | 232 |
| 435 | 3300009098 | Ga0105245_10068838 | Ga0105245_100688384 | 232 |
| 436 | 3300009098 | Ga0105245_10256834 | Ga0105245_102568343 | 232 |
| 437 | 3300009148 | Ga0105243_10162309 | Ga0105243_101623092 | 232 |
| 438 | 3300009148 | Ga0105243_10343154 | Ga0105243_103431542 | 232 |
| 439 | 3300009176 | Ga0105242_10001143 | Ga0105242_1000114321 | 232 |
| 440 | 3300009176 | Ga0105242_10038520 | Ga0105242_100385204 | 232 |
| 441 | 3300009176 | Ga0105242_10235123 | Ga0105242_102351232 | 232 |
| 442 | 3300009177 | Ga0105248_10041073 | Ga0105248_100410736 | 232 |
| 443 | 3300009177 | Ga0105248_10252297 | Ga0105248_102522972 | 232 |
| 444 | 3300009177 | Ga0105248_10326271 | Ga0105248_103262712 | 232 |
| 445 | 3300009177 | Ga0105248_10585954 | Ga0105248_105859542 | 232 |
| 446 | 3300009551 | Ga0105238_10165929 | Ga0105238_101659292 | 232 |
| 447 | 3300013102 | Ga0157371_10421718 | Ga0157371_104217182 | 232 |
| 448 | 3300013296 | Ga0157374_10068870 | Ga0157374_100688704 | 232 |
| 449 | 3300013297 | Ga0157378_10054835 | Ga0157378_100548354 | 232 |
| 450 | 3300013297 | Ga0157378_10856427 | Ga0157378_108564272 | 232 |
| 451 | 3300013306 | Ga0163162_10098300 | Ga0163162_100983004 | 232 |
| 452 | 3300013306 | Ga0163162_10153042 | Ga0163162_101530422 | 232 |
| 453 | 3300013306 | Ga0163162_10242891 | Ga0163162_102428912 | 232 |
| 454 | 3300013308 | Ga0157375_10079029 | Ga0157375_100790294 | 232 |
| 455 | 3300014745 | Ga0157377_10040617 | Ga0157377_100406172 | 232 |
| 456 | 3300014968 | Ga0157379_10319534 | Ga0157379_103195342 | 232 |
| 457 | 3300014969 | Ga0157376_10117718 | Ga0157376_101177183 | 232 |
| 458 | 3300025885 | Ga0207653_10020201 | Ga0207653_100202013 | 232 |
| 459 | 3300025901 | Ga0207688_10035487 | Ga0207688_100354874 | 232 |
| 460 | 3300025906 | Ga0207699_10212619 | Ga0207699_102126192 | 232 |
| 461 | 3300025908 | Ga0207643_10017909 | Ga0207643_100179094 | 232 |
| 462 | 3300025908 | Ga0207643_10019664 | Ga0207643_100196645 | 232 |
| 463 | 3300025926 | Ga0207659_10100240 | Ga0207659_101002402 | 232 |
| 464 | 3300025927 | Ga0207687_10244340 | Ga0207687_102443402 | 232 |
| 465 | 3300025928 | Ga0207700_10050944 | Ga0207700_100509444 | 232 |
| 466 | 3300025932 | Ga0207690_10714454 | Ga0207690_107144541 | 232 |
| 467 | 3300025934 | Ga0207686_10021789 | Ga0207686_100217895 | 232 |
| 468 | 3300025934 | Ga0207686_10030246 | Ga0207686_100302462 | 232 |
| 469 | 3300025934 | Ga0207686_10091602 | Ga0207686_100916023 | 232 |
| 470 | 3300025935 | Ga0207709_10214830 | Ga0207709_102148302 | 232 |
| 471 | 3300025935 | Ga0207709_10231332 | Ga0207709_102313321 | 232 |
| 472 | 3300025936 | Ga0207670_10002904 | Ga0207670_1000290410 | 232 |
| 473 | 3300025936 | Ga0207670_10072433 | Ga0207670_100724333 | 232 |
| 474 | 3300025960 | Ga0207651_10107930 | Ga0207651_101079303 | 232 |
| 475 | 3300025961 | Ga0207712_10119717 | Ga0207712_101197174 | 232 |
| 476 | 3300026023 | Ga0207677_10121616 | Ga0207677_101216163 | 232 |
| 477 | 3300026089 | Ga0207648_10008800 | Ga0207648_100088009 | 232 |
| 478 | 3300026116 | Ga0207674_10052798 | Ga0207674_100527985 | 232 |
| 479 | 3300026118 | Ga0207675_100124208 | Ga0207675_1001242083 | 232 |
| 480 | 3300026121 | Ga0207683_10073123 | Ga0207683_100731234 | 232 |
| 481 | 3300027907 | Ga0207428_10009022 | Ga0207428_100090223 | 232 |
| 482 | 3300028379 | Ga0268266_10410114 | Ga0268266_104101142 | 232 |
| 483 | 3300031239 | Ga0265328_10000001 | Ga0265328_10000001240 | 232 |
| 484 | 3300031344 | Ga0265316_10050849 | Ga0265316_100508494 | 232 |
| 485 | 3300031548 | Ga0307408_100551194 | Ga0307408_1005511942 | 232 |
| 486 | 3300031665 | Ga0316575_10006948 | Ga0316575_100069483 | 232 |
| 487 | 3300031691 | Ga0316579_10000184 | Ga0316579_100001846 | 232 |
| 488 | 3300031728 | Ga0316578_10000742 | Ga0316578_100007425 | 232 |
| 489 | 3300031731 | Ga0307405_10195036 | Ga0307405_101950362 | 232 |
| 490 | 3300032002 | Ga0307416_100014141 | Ga0307416_1000141413 | 232 |
| 491 | 3300032002 | Ga0307416_100170681 | Ga0307416_1001706813 | 232 |
| 492 | 3300032133 | Ga0316583_10002422 | Ga0316583_100024227 | 232 |
| 493 | 3300034957 | Ga0373938_0077599 | Ga0373938_0077599_77_790 | 232 |
| 494 | 3300035119 | Ga0373956_0039698 | Ga0373956_0039698_987_1706 | 232 |
| 495 | 3300035172 | Ga0373955_0044117 | Ga0373955_0044117_1448_2167 | 232 |
| 496 | 3300036401 | Ga0373937_0042517 | Ga0373937_0042517_3237_3956 | 232 |
| 497 | 3300036647 | Ga0316582_0002406 | Ga0316582_0002406_5861_6574 | 232 |
| 498 | 3300037418 | Ga0395900_0037247 | Ga0395900_0037247_2224_2937 | 232 |
| 499 | 3300037471 | Ga0395905_0048192 | Ga0395905_0048192_287_1000 | 232 |
| 500 | 3300041509 | Ga0451843_0708525 | Ga0451843_0708525_1426_2139 | 232 |
| 501 | 3300042001 | Ga0439441_000060 | Ga0439441_000060_5893_6606 | 232 |
| 502 | 3300042156 | Ga0439446_0020440 | Ga0439446_0020440_959_1672 | 232 |
| 503 | 3300042876 | Ga0451577_0110938 | Ga0451577_0110938_404_1117 | 232 |
| 504 | 3300042876 | Ga0451577_0169456 | Ga0451577_0169456_678_1388 | 232 |
| 505 | 3300042876 | Ga0451577_0466325 | Ga0451577_0466325_28_741 | 232 |
| 506 | 3300044684 | Ga0466966_0089452 | Ga0466966_0089452_471_1184 | 232 |
| 507 | 3300044712 | Ga0453684_0000623 | Ga0453684_0000623_55571_56284 | 232 |
| 508 | 3300044712 | Ga0453684_0062601 | Ga0453684_0062601_1880_2593 | 232 |
| 509 | 3300044712 | Ga0453684_0570297 | Ga0453684_0570297_241_954 | 232 |
| 510 | 3300044842 | Ga0466957_0004733 | Ga0466957_0004733_6300_7013 | 232 |
| 511 | 3300045051 | Ga0451576_0454519 | Ga0451576_0454519_388_1113 | 232 |
| 512 | 3300045836 | Ga0466958_0035041 | Ga0466958_0035041_698_1411 | 232 |
| 513 | 3300046462 | Ga0495651_0239803 | Ga0495651_0239803_282_1001 | 232 |
| 514 | 3300046463 | Ga0495653_0115406 | Ga0495653_0115406_331_1050 | 232 |
| 515 | 3300046476 | Ga0495662_0109903 | Ga0495662_0109903_437_1156 | 232 |
| 516 | 3300046477 | Ga0495664_0341495 | Ga0495664_0341495_118_837 | 232 |
| 517 | 3300046529 | Ga0495652_0017734 | Ga0495652_0017734_3202_3921 | 232 |
| 518 | 3300046536 | Ga0495587_0046497 | Ga0495587_0046497_191_910 | 232 |
| 519 | 3300046543 | Ga0495645_0291511 | Ga0495645_0291511_38_757 | 232 |
| 520 | 3300046559 | Ga0495667_0009652 | Ga0495667_0009652_946_1665 | 232 |
| 521 | 3300046642 | Ga0495634_0131675 | Ga0495634_0131675_315_1034 | 232 |
| 522 | 3300046675 | Ga0495657_0052826 | Ga0495657_0052826_1934_2653 | 232 |
| 523 | 3300046678 | Ga0495599_0054613 | Ga0495599_0054613_1612_2331 | 232 |
| 524 | 3300046679 | Ga0495623_0026340 | Ga0495623_0026340_3000_3719 | 232 |
| 525 | 3300047317 | Ga0495604_0081249 | Ga0495604_0081249_456_1175 | 232 |
| 526 | 3300047322 | Ga0495680_0067770 | Ga0495680_0067770_855_1574 | 232 |
| 527 | 3300047444 | Ga0495675_0110969 | Ga0495675_0110969_87_806 | 232 |
| 528 | 3300049568 | Ga0501031_0265662 | Ga0501031_0265662_359_1072 | 232 |
| 529 | 3300049572 | Ga0501036_0058036 | Ga0501036_0058036_437_1150 | 232 |
| 530 | 3300049573 | Ga0501037_0125666 | Ga0501037_0125666_23_736 | 232 |
| 531 | 3300049574 | Ga0501038_0039146 | Ga0501038_0039146_280_993 | 232 |
| 532 | 3300049575 | Ga0501039_0013309 | Ga0501039_0013309_3829_4542 | 232 |
| 533 | 3300049575 | Ga0501039_0054123 | Ga0501039_0054123_1028_1741 | 232 |
| 534 | 3300049576 | Ga0501040_0014856 | Ga0501040_0014856_2349_3062 | 232 |
| 535 | 3300049577 | Ga0501041_0020796 | Ga0501041_0020796_2495_3208 | 232 |
| 536 | 3300049577 | Ga0501041_0109163 | Ga0501041_0109163_782_1495 | 232 |
| 537 | 3300049579 | Ga0501043_0184872 | Ga0501043_0184872_594_1307 | 232 |
| 538 | 3300049580 | Ga0501046_0432716 | Ga0501046_0432716_17_730 | 232 |
| 539 | 3300049582 | Ga0501048_0034588 | Ga0501048_0034588_2841_3554 | 232 |
| 540 | 3300049587 | Ga0501071_0044189 | Ga0501071_0044189_2129_2842 | 232 |
| 541 | 3300049587 | Ga0501071_0252297 | Ga0501071_0252297_189_902 | 232 |
| 542 | 3300049588 | Ga0501072_0001755 | Ga0501072_0001755_11742_12455 | 232 |
| 543 | 3300049588 | Ga0501072_0236394 | Ga0501072_0236394_145_858 | 232 |
| 544 | 3300049590 | Ga0501074_0127231 | Ga0501074_0127231_612_1325 | 232 |
| 545 | 3300049591 | Ga0501075_0077275 | Ga0501075_0077275_769_1482 | 232 |
| 546 | 3300049591 | Ga0501075_0079003 | Ga0501075_0079003_1195_1908 | 232 |
| 547 | 3300049592 | Ga0501076_0000185 | Ga0501076_0000185_29348_30061 | 232 |
| 548 | 3300049592 | Ga0501076_0349873 | Ga0501076_0349873_345_1058 | 232 |
| 549 | 3300049741 | Ga0501079_0053365 | Ga0501079_0053365_728_1441 | 232 |
| 550 | 3300049742 | Ga0501080_0096675 | Ga0501080_0096675_1389_2102 | 232 |
| 551 | 3300049743 | Ga0501081_0001180 | Ga0501081_0001180_14919_15632 | 232 |
| 552 | 3300049743 | Ga0501081_0187973 | Ga0501081_0187973_313_1026 | 232 |
| 553 | 3300049823 | Ga0501044_0419900 | Ga0501044_0419900_267_980 | 232 |
| 554 | 3300050491 | nmdc:mga00v17_120563_c1 | nmdc:mga00v17_120563_c1_62_892 | 232 |
| 555 | 3300050491 | nmdc:mga00v17_1746_c1 | nmdc:mga00v17_1746_c1_4477_5184 | 232 |
| 556 | 3300050493 | nmdc:mga0k408_9828_c1 | nmdc:mga0k408_9828_c1_2133_2840 | 232 |
| 557 | 3300050509 | nmdc:mga0qj67_16651_c1 | nmdc:mga0qj67_16651_c1_2187_2894 | 232 |
| 558 | 3300050509 | nmdc:mga0qj67_259814_c1 | nmdc:mga0qj67_259814_c1_164_865 | 232 |
| 559 | 3300050510 | nmdc:mga06r32_332786_c1 | nmdc:mga06r32_332786_c1_639_1340 | 232 |
| 560 | 3300050511 | nmdc:mga08y16_13025_c1 | nmdc:mga08y16_13025_c1_457_1284 | 232 |
| 561 | 3300053077 | Ga0495601_0143273 | Ga0495601_0143273_808_1527 | 232 |
| 562 | 3300053085 | Ga0495619_0038614 | Ga0495619_0038614_1719_2438 | 232 |
| 563 | 3300053096 | Ga0500641_0021741 | Ga0500641_0021741_1259_1972 | 232 |
| 564 | 3300054114 | Ga0501084_0104315 | Ga0501084_0104315_580_1293 | 232 |
| 565 | 3300060353 | Ga0501082_0071382 | Ga0501082_0071382_222_935 | 232 |
| 566 | 3300061734 | Ga0530510_0047085 | Ga0530510_0047085_1761_2474 | 232 |
| 567 | 3300005327 | Ga0070658_10095822 | Ga0070658_100958223 | 233 |
| 568 | 3300005327 | Ga0070658_10203122 | Ga0070658_102031223 | 233 |
| 569 | 3300005327 | Ga0070658_10480851 | Ga0070658_104808512 | 233 |
| 570 | 3300005345 | Ga0070692_10090688 | Ga0070692_100906883 | 233 |
| 571 | 3300005355 | Ga0070671_100151526 | Ga0070671_1001515263 | 233 |
| 572 | 3300005364 | Ga0070673_100385599 | Ga0070673_1003855991 | 233 |
| 573 | 3300005458 | Ga0070681_10308802 | Ga0070681_103088021 | 233 |
| 574 | 3300005466 | Ga0070685_10090259 | Ga0070685_100902592 | 233 |
| 575 | 3300005530 | Ga0070679_100136476 | Ga0070679_1001364762 | 233 |
| 576 | 3300005530 | Ga0070679_100630482 | Ga0070679_1006304821 | 233 |
| 577 | 3300005539 | Ga0068853_100121579 | Ga0068853_1001215793 | 233 |
| 578 | 3300005546 | Ga0070696_100483194 | Ga0070696_1004831942 | 233 |
| 579 | 3300005547 | Ga0070693_100243903 | Ga0070693_1002439032 | 233 |
| 580 | 3300005547 | Ga0070693_100418612 | Ga0070693_1004186122 | 233 |
| 581 | 3300005563 | Ga0068855_100013140 | Ga0068855_1000131406 | 233 |
| 582 | 3300005563 | Ga0068855_100043030 | Ga0068855_1000430303 | 233 |
| 583 | 3300005616 | Ga0068852_100002800 | Ga0068852_1000028004 | 233 |
| 584 | 3300005616 | Ga0068852_100009134 | Ga0068852_1000091348 | 233 |
| 585 | 3300005834 | Ga0068851_10010798 | Ga0068851_100107984 | 233 |
| 586 | 3300005834 | Ga0068851_10091206 | Ga0068851_100912062 | 233 |
| 587 | 3300005985 | Ga0081539_10026601 | Ga0081539_100266013 | 233 |
| 588 | 3300006358 | Ga0068871_100025542 | Ga0068871_1000255424 | 233 |
| 589 | 3300006871 | Ga0075434_100801482 | Ga0075434_1008014821 | 233 |
| 590 | 3300007076 | Ga0075435_100438411 | Ga0075435_1004384112 | 233 |
| 591 | 3300009093 | Ga0105240_10031185 | Ga0105240_100311851 | 233 |
| 592 | 3300009093 | Ga0105240_10097440 | Ga0105240_100974404 | 233 |
| 593 | 3300009093 | Ga0105240_10226210 | Ga0105240_102262102 | 233 |
| 594 | 3300009093 | Ga0105240_10227047 | Ga0105240_102270472 | 233 |
| 595 | 3300009098 | Ga0105245_10292856 | Ga0105245_102928562 | 233 |
| 596 | 3300009174 | Ga0105241_10489623 | Ga0105241_104896232 | 233 |
| 597 | 3300013104 | Ga0157370_10005552 | Ga0157370_1000555210 | 233 |
| 598 | 3300013104 | Ga0157370_10305119 | Ga0157370_103051192 | 233 |
| 599 | 3300013105 | Ga0157369_10117754 | Ga0157369_101177543 | 233 |
| 600 | 3300013296 | Ga0157374_10195957 | Ga0157374_101959572 | 233 |
| 601 | 3300013307 | Ga0157372_10199703 | Ga0157372_101997033 | 233 |
| 602 | 3300014326 | Ga0157380_10865171 | Ga0157380_108651711 | 233 |
| 603 | 3300025321 | Ga0207656_10002499 | Ga0207656_100024993 | 233 |
| 604 | 3300025909 | Ga0207705_10105736 | Ga0207705_101057362 | 233 |
| 605 | 3300025909 | Ga0207705_10294571 | Ga0207705_102945712 | 233 |
| 606 | 3300025911 | Ga0207654_10167275 | Ga0207654_101672752 | 233 |
| 607 | 3300025913 | Ga0207695_10017450 | Ga0207695_100174503 | 233 |
| 608 | 3300025913 | Ga0207695_10069360 | Ga0207695_100693604 | 233 |
| 609 | 3300025913 | Ga0207695_10085430 | Ga0207695_100854304 | 233 |
| 610 | 3300025921 | Ga0207652_10027918 | Ga0207652_100279183 | 233 |
| 611 | 3300025921 | Ga0207652_10053149 | Ga0207652_100531493 | 233 |
| 612 | 3300025924 | Ga0207694_10498968 | Ga0207694_104989681 | 233 |
| 613 | 3300025927 | Ga0207687_10252550 | Ga0207687_102525502 | 233 |
| 614 | 3300025944 | Ga0207661_10688938 | Ga0207661_106889382 | 233 |
| 615 | 3300025949 | Ga0207667_10025479 | Ga0207667_100254794 | 233 |
| 616 | 3300025949 | Ga0207667_10084058 | Ga0207667_100840584 | 233 |
| 617 | 3300026023 | Ga0207677_10018826 | Ga0207677_100188263 | 233 |
| 618 | 3300026041 | Ga0207639_10112452 | Ga0207639_101124522 | 233 |
| 619 | 3300026078 | Ga0207702_10343008 | Ga0207702_103430082 | 233 |
| 620 | 3300026142 | Ga0207698_10016778 | Ga0207698_100167782 | 233 |
| 621 | 3300026142 | Ga0207698_10084170 | Ga0207698_100841704 | 233 |
| 622 | 3300027876 | Ga0209974_10011124 | Ga0209974_100111243 | 233 |
| 623 | 3300032002 | Ga0307416_100030432 | Ga0307416_1000304323 | 233 |
| 624 | 3300032002 | Ga0307416_100478817 | Ga0307416_1004788172 | 233 |
| 625 | 3300037068 | Ga0373925_0145458 | Ga0373925_0145458_688_1404 | 233 |
| 626 | 3300039437 | Ga0436365_0250047 | Ga0436365_0250047_350_1069 | 233 |
| 627 | 3300039437 | Ga0436365_1085190 | Ga0436365_1085190_533_1249 | 233 |
| 628 | 3300042126 | Ga0450888_007440 | Ga0450888_007440_258_989 | 233 |
| 629 | 3300042876 | Ga0451577_0482143 | Ga0451577_0482143_306_1019 | 233 |
| 630 | 3300045051 | Ga0451576_0053704 | Ga0451576_0053704_2287_3003 | 233 |
| 631 | 3300045051 | Ga0451576_0061264 | Ga0451576_0061264_1753_2469 | 233 |
| 632 | 3300045051 | Ga0451576_0401191 | Ga0451576_0401191_281_1015 | 233 |
| 633 | 3300046539 | Ga0495621_0004663 | Ga0495621_0004663_3003_3719 | 233 |
| 634 | 3300048907 | Ga0496104_0015343 | Ga0496104_0015343_4081_4797 | 233 |
| 635 | 3300048912 | Ga0496109_0563803 | Ga0496109_0563803_342_1058 | 233 |
| 636 | 3300048913 | Ga0496110_0039612 | Ga0496110_0039612_2155_2871 | 233 |
| 637 | 3300049571 | Ga0501034_0439052 | Ga0501034_0439052_402_1115 | 233 |
| 638 | 3300049572 | Ga0501036_0482543 | Ga0501036_0482543_48_782 | 233 |
| 639 | 3300049572 | Ga0501036_0505937 | Ga0501036_0505937_157_915 | 233 |
| 640 | 3300049580 | Ga0501046_0052373 | Ga0501046_0052373_804_1517 | 233 |
| 641 | 3300049581 | Ga0501047_0001767 | Ga0501047_0001767_19387_20100 | 233 |
| 642 | 3300049581 | Ga0501047_0429895 | Ga0501047_0429895_183_896 | 233 |
| 643 | 3300049584 | Ga0501068_0074422 | Ga0501068_0074422_223_936 | 233 |
| 644 | 3300049585 | Ga0501069_0014023 | Ga0501069_0014023_29_742 | 233 |
| 645 | 3300049588 | Ga0501072_0549255 | Ga0501072_0549255_28_786 | 233 |
| 646 | 3300049589 | Ga0501073_0000384 | Ga0501073_0000384_24290_25003 | 233 |
| 647 | 3300049589 | Ga0501073_0319761 | Ga0501073_0319761_92_805 | 233 |
| 648 | 3300049590 | Ga0501074_0000123 | Ga0501074_0000123_12853_13566 | 233 |
| 649 | 3300049592 | Ga0501076_0505825 | Ga0501076_0505825_191_949 | 233 |
| 650 | 3300049741 | Ga0501079_0004001 | Ga0501079_0004001_7771_8484 | 233 |
| 651 | 3300049742 | Ga0501080_0008926 | Ga0501080_0008926_1568_2281 | 233 |
| 652 | 3300049742 | Ga0501080_0025348 | Ga0501080_0025348_267_980 | 233 |
| 653 | 3300049744 | Ga0501083_0000252 | Ga0501083_0000252_24033_24746 | 233 |
| 654 | 3300050512 | nmdc:mga0n895_203532_c1 | nmdc:mga0n895_203532_c1_751_1467 | 233 |
| 655 | 3300050512 | nmdc:mga0n895_922322_c1 | nmdc:mga0n895_922322_c1_74_790 | 233 |
| 656 | 3300054114 | Ga0501084_0369880 | Ga0501084_0369880_454_1167 | 233 |
| 657 | 3300003322 | rootL2_10193919 | rootL2_101939192 | 234 |
| 658 | 3300005338 | Ga0068868_100052336 | Ga0068868_1000523362 | 234 |
| 659 | 3300005367 | Ga0070667_100005528 | Ga0070667_1000055287 | 234 |
| 660 | 3300005445 | Ga0070708_100122759 | Ga0070708_1001227591 | 234 |
| 661 | 3300005456 | Ga0070678_100249834 | Ga0070678_1002498341 | 234 |
| 662 | 3300005467 | Ga0070706_100002403 | Ga0070706_1000024034 | 234 |
| 663 | 3300005548 | Ga0070665_100075505 | Ga0070665_1000755052 | 234 |
| 664 | 3300005617 | Ga0068859_100073533 | Ga0068859_1000735332 | 234 |
| 665 | 3300005617 | Ga0068859_100152412 | Ga0068859_1001524121 | 234 |
| 666 | 3300005618 | Ga0068864_100362969 | Ga0068864_1003629691 | 234 |
| 667 | 3300005841 | Ga0068863_100172673 | Ga0068863_1001726732 | 234 |
| 668 | 3300005843 | Ga0068860_100348405 | Ga0068860_1003484052 | 234 |
| 669 | 3300006042 | Ga0075368_10096022 | Ga0075368_100960222 | 234 |
| 670 | 3300006186 | Ga0075369_10051633 | Ga0075369_100516333 | 234 |
| 671 | 3300006195 | Ga0075366_10097921 | Ga0075366_100979212 | 234 |
| 672 | 3300006237 | Ga0097621_100183660 | Ga0097621_1001836602 | 234 |
| 673 | 3300006353 | Ga0075370_10009479 | Ga0075370_100094795 | 234 |
| 674 | 3300006358 | Ga0068871_100263412 | Ga0068871_1002634122 | 234 |
| 675 | 3300006358 | Ga0068871_100410010 | Ga0068871_1004100102 | 234 |
| 676 | 3300006931 | Ga0097620_100073530 | Ga0097620_1000735302 | 234 |
| 677 | 3300006931 | Ga0097620_100152410 | Ga0097620_1001524101 | 234 |
| 678 | 3300009098 | Ga0105245_10392217 | Ga0105245_103922172 | 234 |
| 679 | 3300013308 | Ga0157375_10188235 | Ga0157375_101882352 | 234 |
| 680 | 3300014968 | Ga0157379_10012835 | Ga0157379_100128357 | 234 |
| 681 | 3300014968 | Ga0157379_10111286 | Ga0157379_101112863 | 234 |
| 682 | 3300014968 | Ga0157379_10213847 | Ga0157379_102138471 | 234 |
| 683 | 3300025927 | Ga0207687_10615377 | Ga0207687_106153771 | 234 |
| 684 | 3300025986 | Ga0207658_10000919 | Ga0207658_100009198 | 234 |
| 685 | 3300026088 | Ga0207641_10153229 | Ga0207641_101532292 | 234 |
| 686 | 3300028794 | Ga0307515_10031745 | Ga0307515_100317452 | 234 |
| 687 | 3300031456 | Ga0307513_10003123 | Ga0307513_100031232 | 234 |
| 688 | 3300031507 | Ga0307509_10082106 | Ga0307509_100821063 | 234 |
| 689 | 3300031507 | Ga0307509_10085108 | Ga0307509_100851082 | 234 |
| 690 | 3300031616 | Ga0307508_10000163 | Ga0307508_1000016352 | 234 |
| 691 | 3300033180 | Ga0307510_10021393 | Ga0307510_100213935 | 234 |
| 692 | 3300033180 | Ga0307510_10157452 | Ga0307510_101574522 | 234 |
| 693 | 3300033180 | Ga0307510_10178262 | Ga0307510_101782622 | 234 |
| 694 | 3300042876 | Ga0451577_0007328 | Ga0451577_0007328_223_933 | 234 |
| 695 | 3300044712 | Ga0453684_0143838 | Ga0453684_0143838_472_1209 | 234 |
| 696 | 3300044712 | Ga0453684_0966980 | Ga0453684_0966980_69_809 | 234 |
| 697 | 3300046454 | Ga0495592_0000222 | Ga0495592_0000222_31710_32414 | 234 |
| 698 | 3300046471 | Ga0495650_0078252 | Ga0495650_0078252_447_1241 | 234 |
| 699 | 3300046512 | Ga0495610_0101165 | Ga0495610_0101165_50_754 | 234 |
| 700 | 3300046692 | Ga0495671_0044143 | Ga0495671_0044143_1148_1858 | 234 |
| 701 | 3300048905 | Ga0496102_0014353 | Ga0496102_0014353_3903_4616 | 234 |
| 702 | 3300050493 | nmdc:mga0k408_178115_c1 | nmdc:mga0k408_178115_c1_440_1153 | 234 |
| 703 | 3300050493 | nmdc:mga0k408_85851_c1 | nmdc:mga0k408_85851_c1_423_1130 | 234 |
| 704 | 3300050496 | nmdc:mga07m45_86384_c1 | nmdc:mga07m45_86384_c1_642_1355 | 234 |
| 705 | 3300053118 | Ga0500594_0000988 | Ga0500594_0000988_1577_2281 | 234 |
| 706 | 3300053123 | Ga0500614_019266 | Ga0500614_019266_341_1045 | 234 |
| 707 | 3300053131 | Ga0500652_041329 | Ga0500652_041329_679_1386 | 234 |
| 708 | 3300053133 | Ga0500655_004929 | Ga0500655_004929_252_956 | 234 |
| 709 | 3300053136 | Ga0500559_0000011 | Ga0500559_0000011_38599_39303 | 234 |
| 710 | 3300053138 | Ga0500564_099218 | Ga0500564_099218_343_1047 | 234 |
| 711 | 3300053155 | Ga0500620_100742 | Ga0500620_100742_202_906 | 234 |
| 712 | 3300053156 | Ga0500622_0002322 | Ga0500622_0002322_12991_13695 | 234 |
| 713 | 3300053177 | Ga0500636_0245373 | Ga0500636_0245373_55_762 | 234 |
| 714 | 3300053739 | Ga0500587_002239 | Ga0500587_002239_1221_1925 | 234 |
| 715 | iso_pu_bacteria | 2919704043 | 2919706170 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3m3p-assembly1.cif.gz_A | crystal structure of glutamine amido transferase from methylobacillus flagellatus | 0.9266 | 1 | 233 |
| 3m3p-assembly1.cif.gz_A | crystal structure of glutamine amido transferase from methylobacillus flagellatus | 0.9189 | 1 | 233 |
| 3l7n-assembly1.cif.gz_A | crystal structure of smu.1228c | 0.9156 | 3 | 230 |
| 1o1y-assembly1.cif.gz_A | crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution | 0.8903 | 3 | 231 |
| 1o1y-assembly1.cif.gz_A | crystal structure of a glutamine amidotransferase (tm1158) from thermotoga maritima at 1.70 a resolution | 0.8647 | 3 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3l83A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9261 | 3 | 233 | 3.40.50.880 |
| 3l7nA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9156 | 3 | 230 | 3.40.50.880 |
| 3l83A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9106 | 3 | 233 | 3.40.50.880 |
| af_Q4DQH7_1_252_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8888 | 1 | 204 | 3.40.50.880 |
| 1o1yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8813 | 3 | 230 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I0HSH0-F1-model_v4 | Glutamine amidotransferase class-I | 0.9994 | 1 | 233 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A4Q6FGP1-F1-model_v4 | deleted | 0.9944 | 2 | 95 |
|
| AF-I0HSH0-F1-model_v4 | Glutamine amidotransferase class-I | 0.9909 | 1 | 233 |
GO:0005829
GO:0006541 GO:0016740 |
| AF-A0A2N2UA71-F1-model_v4 | deleted | 0.9856 | 2 | 233 |
|
| AF-A0A7W0JT62-F1-model_v4 | Type 1 glutamine amidotransferase | 0.983 | 1 | 102 |
GO:0005829
GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar