F476853
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 712 | 359 | 1424 | 360 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0004257|Ga0495580_0004257_5523_6725 |
| Length | 400 |
| Sequence | MSRASLPQSHRRKRSNAAHHRVAKILSVPRWCLDDPEEVLVRVFNFAAGPATLPLQVLEQARDELTDWQACGMSVMEVSHRSGAFVAAARAAESRLRELLRVPPNYKVLFLQGGATGQFAAIPLNLASADARADYLNTGAWSKKAIAEARRFLAHVNVAADESATKYTTVPAAGSLRLDPAAAYLHYTANETIGGVEFPYVPDSGAVPLVADMSSSILSRPMPVEKFGLIYGGAQKNIGPAGLVVVIVREELLGRARPGTPSVWDYRAMAAEDSMLNTPPTFALYLAGLVFKWLQEQGGLPVIAARNEAKARALYEAIDGSGFYRNPVDKGCRSWMNVPFTLADPALDPLFLSAARAAGLVNLEGHRSVGGMRASLYNAMPPEGVAALVAFMREFERRHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 102 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 163 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 172 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 173 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 174 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 175 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 176 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 192 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 193 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 197 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 202 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 203 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 204 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 207 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 285 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 286 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 330 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 346 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 347 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 348 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 349 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 352 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 353 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 354 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 355 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 356 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 357 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 358 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 359 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.74 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.84 |
| Nodule | 0.42 |
| Rhizoplane | 3.79 |
| Rhizosphere | 89.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495580_0004257 | 3300046472 | Bacteria | 12040 |
| 2 | JGI24735J21928_10000266 | 3300002067 | Bacteria | 18276 |
| 3 | rootL2_10129855 | 3300003322 | Bacteria | 1509 |
| 4 | rootL2_10159372 | 3300003322 | Bacteria | 3307 |
| 5 | rootL2_10248547 | 3300003322 | Bacteria | 2187 |
| 6 | rootH1_10123237 | 3300003323 | Bacteria | 5114 |
| 7 | Ga0065712_10069600 | 3300005290 | Bacteria | 7002 |
| 8 | Ga0070658_10079844 | 3300005327 | Bacteria | 2687 |
| 9 | Ga0070676_10046023 | 3300005328 | Bacteria | 2543 |
| 10 | Ga0070676_10057120 | 3300005328 | Bacteria | 2309 |
| 11 | Ga0070676_10138263 | 3300005328 | Bacteria | 1548 |
| 12 | Ga0070683_100114781 | 3300005329 | Bacteria | 2542 |
| 13 | Ga0070690_100000848 | 3300005330 | Bacteria | 15510 |
| 14 | Ga0070690_100009935 | 3300005330 | Bacteria | 5523 |
| 15 | Ga0070690_100038140 | 3300005330 | Bacteria | 3030 |
| 16 | Ga0070670_100027595 | 3300005331 | Bacteria | 4884 |
| 17 | Ga0070670_100244684 | 3300005331 | Bacteria | 1562 |
| 18 | Ga0068869_100012483 | 3300005334 | Bacteria | 5617 |
| 19 | Ga0068869_100030598 | 3300005334 | Bacteria | 3780 |
| 20 | Ga0070666_10000003 | 3300005335 | Bacteria | 463666 |
| 21 | Ga0070666_10010881 | 3300005335 | Bacteria | 5700 |
| 22 | Ga0070666_10022849 | 3300005335 | Bacteria | 4065 |
| 23 | Ga0070666_10057652 | 3300005335 | Bacteria | 2625 |
| 24 | Ga0070666_10132764 | 3300005335 | Bacteria | 1731 |
| 25 | Ga0070680_100080675 | 3300005336 | Bacteria | 2683 |
| 26 | Ga0070682_100005019 | 3300005337 | Bacteria | 7355 |
| 27 | Ga0070682_100029235 | 3300005337 | Bacteria | 3317 |
| 28 | Ga0068868_100087361 | 3300005338 | Bacteria | 2507 |
| 29 | Ga0068868_100440880 | 3300005338 | Bacteria | 1131 |
| 30 | Ga0070660_100142379 | 3300005339 | Bacteria | 1924 |
| 31 | Ga0070689_100000509 | 3300005340 | Bacteria | 22964 |
| 32 | Ga0070687_100005790 | 3300005343 | Bacteria | 5021 |
| 33 | Ga0070661_100004656 | 3300005344 | Bacteria | 9448 |
| 34 | Ga0070661_100029043 | 3300005344 | Bacteria | 3990 |
| 35 | Ga0070661_100094116 | 3300005344 | Bacteria | 2220 |
| 36 | Ga0070669_100087836 | 3300005353 | Bacteria | 2325 |
| 37 | Ga0070669_100140934 | 3300005353 | Bacteria | 1859 |
| 38 | Ga0070669_100221865 | 3300005353 | Bacteria | 1495 |
| 39 | Ga0070675_100000139 | 3300005354 | Bacteria | 43853 |
| 40 | Ga0070675_100001593 | 3300005354 | Bacteria | 16753 |
| 41 | Ga0070675_100027333 | 3300005354 | Bacteria | 4583 |
| 42 | Ga0070675_100034288 | 3300005354 | Bacteria | 4118 |
| 43 | Ga0070675_100191308 | 3300005354 | Bacteria | 1773 |
| 44 | Ga0070671_100039510 | 3300005355 | Bacteria | 3917 |
| 45 | Ga0070673_100137301 | 3300005364 | Bacteria | 2059 |
| 46 | Ga0070659_100168580 | 3300005366 | Bacteria | 1792 |
| 47 | Ga0070667_100014812 | 3300005367 | Bacteria | 6442 |
| 48 | Ga0070667_100016792 | 3300005367 | Bacteria | 6056 |
| 49 | Ga0070667_100057804 | 3300005367 | Bacteria | 3279 |
| 50 | Ga0070714_100016325 | 3300005435 | Bacteria | 5992 |
| 51 | Ga0070713_100005046 | 3300005436 | Bacteria | 8976 |
| 52 | Ga0070701_10003283 | 3300005438 | Bacteria | 6371 |
| 53 | Ga0070711_100002829 | 3300005439 | Bacteria | 9967 |
| 54 | Ga0070711_100057627 | 3300005439 | Bacteria | 2691 |
| 55 | Ga0070705_100188032 | 3300005440 | Bacteria | 1405 |
| 56 | Ga0070700_100013817 | 3300005441 | Bacteria | 4543 |
| 57 | Ga0070700_100040893 | 3300005441 | Bacteria | 2840 |
| 58 | Ga0070708_100001467 | 3300005445 | Bacteria | 17995 |
| 59 | Ga0070678_100007056 | 3300005456 | Bacteria | 6640 |
| 60 | Ga0070678_100010070 | 3300005456 | Bacteria | 5754 |
| 61 | Ga0070678_100043335 | 3300005456 | Bacteria | 3204 |
| 62 | Ga0070678_100047034 | 3300005456 | Bacteria | 3098 |
| 63 | Ga0070678_100113076 | 3300005456 | Bacteria | 2127 |
| 64 | Ga0070662_100009759 | 3300005457 | Bacteria | 6285 |
| 65 | Ga0070662_100031349 | 3300005457 | Bacteria | 3730 |
| 66 | Ga0070662_100073743 | 3300005457 | Bacteria | 2522 |
| 67 | Ga0070681_10010257 | 3300005458 | Bacteria | 9245 |
| 68 | Ga0070681_10032569 | 3300005458 | Bacteria | 5232 |
| 69 | Ga0070681_10058997 | 3300005458 | Bacteria | 3817 |
| 70 | Ga0068867_100074585 | 3300005459 | Bacteria | 2543 |
| 71 | Ga0070685_10015076 | 3300005466 | Bacteria | 4103 |
| 72 | Ga0070706_100117637 | 3300005467 | Bacteria | 2476 |
| 73 | Ga0070707_100059423 | 3300005468 | Bacteria | 3668 |
| 74 | Ga0070707_100141774 | 3300005468 | Bacteria | 2339 |
| 75 | Ga0070679_100030388 | 3300005530 | Bacteria | 5334 |
| 76 | Ga0070679_100045058 | 3300005530 | Bacteria | 4395 |
| 77 | Ga0070679_100071762 | 3300005530 | Bacteria | 3454 |
| 78 | Ga0070679_100096553 | 3300005530 | Bacteria | 2943 |
| 79 | Ga0070679_100463431 | 3300005530 | Bacteria | 1212 |
| 80 | Ga0070684_100014149 | 3300005535 | Bacteria | 6453 |
| 81 | Ga0070684_100016613 | 3300005535 | Bacteria | 6019 |
| 82 | Ga0070684_100043697 | 3300005535 | Bacteria | 3871 |
| 83 | Ga0070684_100151984 | 3300005535 | Bacteria | 2097 |
| 84 | Ga0070672_100038359 | 3300005543 | Bacteria | 3660 |
| 85 | Ga0070672_100106049 | 3300005543 | Bacteria | 2285 |
| 86 | Ga0070686_100001361 | 3300005544 | Bacteria | 13833 |
| 87 | Ga0070695_100054714 | 3300005545 | Bacteria | 2569 |
| 88 | Ga0070695_100203548 | 3300005545 | Bacteria | 1416 |
| 89 | Ga0070665_100003952 | 3300005548 | Bacteria | 15632 |
| 90 | Ga0070665_100011103 | 3300005548 | Bacteria | 9100 |
| 91 | Ga0070665_100015433 | 3300005548 | Bacteria | 7671 |
| 92 | Ga0070665_100026593 | 3300005548 | Bacteria | 5826 |
| 93 | Ga0070665_100033938 | 3300005548 | Bacteria | 5133 |
| 94 | Ga0070704_100239109 | 3300005549 | Bacteria | 1485 |
| 95 | Ga0068855_100014165 | 3300005563 | Bacteria | 9607 |
| 96 | Ga0068855_100128321 | 3300005563 | Bacteria | 2898 |
| 97 | Ga0068855_100131836 | 3300005563 | Bacteria | 2854 |
| 98 | Ga0070664_100000585 | 3300005564 | Bacteria | 27773 |
| 99 | Ga0070664_100006952 | 3300005564 | Bacteria | 9120 |
| 100 | Ga0070664_100215971 | 3300005564 | Bacteria | 1715 |
| 101 | Ga0070664_100283404 | 3300005564 | Bacteria | 1494 |
| 102 | Ga0068857_100104059 | 3300005577 | Bacteria | 2549 |
| 103 | Ga0068857_100186515 | 3300005577 | Bacteria | 1888 |
| 104 | Ga0068856_100015327 | 3300005614 | Bacteria | 7407 |
| 105 | Ga0070702_100001168 | 3300005615 | Bacteria | 10569 |
| 106 | Ga0070702_100017086 | 3300005615 | Bacteria | 3735 |
| 107 | Ga0070702_100087223 | 3300005615 | Bacteria | 1884 |
| 108 | Ga0068852_100020679 | 3300005616 | Bacteria | 5236 |
| 109 | Ga0068859_100000516 | 3300005617 | Bacteria | 38281 |
| 110 | Ga0068859_100006281 | 3300005617 | Bacteria | 12057 |
| 111 | Ga0068859_100010529 | 3300005617 | Bacteria | 9307 |
| 112 | Ga0068859_100180195 | 3300005617 | Bacteria | 2195 |
| 113 | Ga0068864_100001046 | 3300005618 | Bacteria | 23229 |
| 114 | Ga0068864_100002556 | 3300005618 | Bacteria | 15030 |
| 115 | Ga0068864_100013383 | 3300005618 | Bacteria | 6799 |
| 116 | Ga0068866_10004732 | 3300005718 | Bacteria | 5584 |
| 117 | Ga0068861_100015785 | 3300005719 | Bacteria | 5331 |
| 118 | Ga0068861_100018595 | 3300005719 | Bacteria | 4951 |
| 119 | Ga0068861_100052102 | 3300005719 | Bacteria | 3109 |
| 120 | Ga0068870_10019427 | 3300005840 | Bacteria | 3297 |
| 121 | Ga0068870_10027886 | 3300005840 | Bacteria | 2829 |
| 122 | Ga0068863_100019332 | 3300005841 | Bacteria | 6514 |
| 123 | Ga0068863_100021414 | 3300005841 | Bacteria | 6170 |
| 124 | Ga0068863_100029477 | 3300005841 | Bacteria | 5238 |
| 125 | Ga0068863_100030863 | 3300005841 | Bacteria | 5118 |
| 126 | Ga0068863_100107519 | 3300005841 | Bacteria | 2655 |
| 127 | Ga0068858_100001604 | 3300005842 | Bacteria | 23097 |
| 128 | Ga0068858_100015946 | 3300005842 | Bacteria | 7058 |
| 129 | Ga0068858_100109882 | 3300005842 | Bacteria | 2574 |
| 130 | Ga0068860_100012232 | 3300005843 | Bacteria | 8457 |
| 131 | Ga0068860_100022411 | 3300005843 | Bacteria | 6109 |
| 132 | Ga0068860_100040982 | 3300005843 | Bacteria | 4424 |
| 133 | Ga0068860_100102820 | 3300005843 | Bacteria | 2727 |
| 134 | Ga0068862_100001537 | 3300005844 | Bacteria | 21100 |
| 135 | Ga0068862_100112008 | 3300005844 | Bacteria | 2396 |
| 136 | Ga0068862_100330390 | 3300005844 | Bacteria | 1410 |
| 137 | Ga0081455_10076519 | 3300005937 | Bacteria | 2757 |
| 138 | Ga0081455_10120254 | 3300005937 | Bacteria | 2070 |
| 139 | Ga0070717_10005471 | 3300006028 | Bacteria | 9271 |
| 140 | Ga0070716_100007136 | 3300006173 | Bacteria | 5489 |
| 141 | Ga0070716_100013609 | 3300006173 | Bacteria | 4150 |
| 142 | Ga0070712_100008251 | 3300006175 | Bacteria | 6545 |
| 143 | Ga0097621_100009661 | 3300006237 | Bacteria | 7014 |
| 144 | Ga0097621_100010826 | 3300006237 | Bacteria | 6691 |
| 145 | Ga0097621_100042328 | 3300006237 | Bacteria | 3668 |
| 146 | Ga0097621_100146121 | 3300006237 | Bacteria | 2024 |
| 147 | Ga0068871_100005809 | 3300006358 | Bacteria | 8669 |
| 148 | Ga0068871_100008391 | 3300006358 | Bacteria | 7429 |
| 149 | Ga0068871_100067624 | 3300006358 | Bacteria | 2932 |
| 150 | Ga0068871_100141515 | 3300006358 | Bacteria | 2046 |
| 151 | Ga0068871_100292440 | 3300006358 | Bacteria | 1428 |
| 152 | Ga0075428_100008721 | 3300006844 | Bacteria | 11250 |
| 153 | Ga0075428_100042010 | 3300006844 | Bacteria | 5028 |
| 154 | Ga0075428_100064310 | 3300006844 | Bacteria | 4017 |
| 155 | Ga0075430_100004227 | 3300006846 | Bacteria | 12122 |
| 156 | Ga0075430_100010670 | 3300006846 | Bacteria | 7785 |
| 157 | Ga0075430_100013189 | 3300006846 | Bacteria | 7041 |
| 158 | Ga0075431_100000938 | 3300006847 | Bacteria | 25747 |
| 159 | Ga0075431_100003513 | 3300006847 | Bacteria | 15182 |
| 160 | Ga0075431_100110840 | 3300006847 | Bacteria | 2832 |
| 161 | Ga0075434_100278847 | 3300006871 | Bacteria | 1691 |
| 162 | Ga0075429_100006127 | 3300006880 | Bacteria | 10395 |
| 163 | Ga0075429_100033851 | 3300006880 | Bacteria | 4439 |
| 164 | Ga0075429_100069100 | 3300006880 | Bacteria | 3075 |
| 165 | Ga0075429_100080930 | 3300006880 | Bacteria | 2832 |
| 166 | Ga0068865_100001769 | 3300006881 | Bacteria | 12679 |
| 167 | Ga0075436_100025431 | 3300006914 | Bacteria | 4075 |
| 168 | Ga0097620_100000516 | 3300006931 | Bacteria | 38281 |
| 169 | Ga0097620_100006281 | 3300006931 | Bacteria | 12057 |
| 170 | Ga0097620_100010529 | 3300006931 | Bacteria | 9307 |
| 171 | Ga0097620_100180190 | 3300006931 | Bacteria | 2195 |
| 172 | Ga0075435_100180824 | 3300007076 | Bacteria | 1782 |
| 173 | Ga0099794_10009412 | 3300007265 | Bacteria | 4107 |
| 174 | Ga0099795_10000009 | 3300007788 | Bacteria | 84256 |
| 175 | Ga0099795_10021348 | 3300007788 | Bacteria | 2122 |
| 176 | Ga0111539_10000754 | 3300009094 | Bacteria | 42119 |
| 177 | Ga0111539_10004469 | 3300009094 | Bacteria | 18283 |
| 178 | Ga0111539_10083228 | 3300009094 | Bacteria | 3763 |
| 179 | Ga0111539_10131098 | 3300009094 | Bacteria | 2935 |
| 180 | Ga0105247_10000162 | 3300009101 | Bacteria | 65804 |
| 181 | Ga0105247_10024069 | 3300009101 | Bacteria | 3667 |
| 182 | Ga0114129_10002722 | 3300009147 | Bacteria | 24631 |
| 183 | Ga0114129_10004060 | 3300009147 | Bacteria | 20667 |
| 184 | Ga0105248_10006659 | 3300009177 | Bacteria | 12675 |
| 185 | Ga0105248_10015627 | 3300009177 | Bacteria | 8366 |
| 186 | Ga0105248_10124091 | 3300009177 | Bacteria | 2913 |
| 187 | Ga0105248_10154646 | 3300009177 | Bacteria | 2588 |
| 188 | Ga0105248_10203330 | 3300009177 | Bacteria | 2232 |
| 189 | Ga0105248_10309854 | 3300009177 | Bacteria | 1778 |
| 190 | Ga0105248_10415998 | 3300009177 | Bacteria | 1514 |
| 191 | Ga0105237_10041330 | 3300009545 | Bacteria | 4650 |
| 192 | Ga0105237_10214497 | 3300009545 | Bacteria | 1925 |
| 193 | Ga0105238_10000186 | 3300009551 | Bacteria | 68293 |
| 194 | Ga0105249_10008111 | 3300009553 | Bacteria | 9158 |
| 195 | Ga0105249_10011434 | 3300009553 | Bacteria | 7796 |
| 196 | Ga0105249_10018723 | 3300009553 | Bacteria | 6167 |
| 197 | Ga0105249_10054552 | 3300009553 | Bacteria | 3655 |
| 198 | Ga0105249_10163245 | 3300009553 | Bacteria | 2154 |
| 199 | Ga0105249_10195454 | 3300009553 | Bacteria | 1977 |
| 200 | Ga0099796_10000005 | 3300010159 | Bacteria | 74057 |
| 201 | Ga0099796_10035391 | 3300010159 | Bacteria | 1656 |
| 202 | Ga0157373_10008960 | 3300013100 | Bacteria | 7402 |
| 203 | Ga0157371_10038238 | 3300013102 | Bacteria | 3434 |
| 204 | Ga0157369_10486645 | 3300013105 | Bacteria | 1277 |
| 205 | Ga0157374_10003005 | 3300013296 | Bacteria | 14114 |
| 206 | Ga0157374_10008154 | 3300013296 | Bacteria | 8953 |
| 207 | Ga0157378_10084447 | 3300013297 | Bacteria | 2875 |
| 208 | Ga0157378_10324092 | 3300013297 | Bacteria | 1497 |
| 209 | Ga0163162_10000030 | 3300013306 | Bacteria | 163717 |
| 210 | Ga0163162_10000209 | 3300013306 | Bacteria | 54322 |
| 211 | Ga0163162_10011280 | 3300013306 | Bacteria | 8713 |
| 212 | Ga0163162_10094815 | 3300013306 | Bacteria | 3071 |
| 213 | Ga0163162_10390065 | 3300013306 | Bacteria | 1525 |
| 214 | Ga0157372_10024873 | 3300013307 | Bacteria | 6507 |
| 215 | Ga0157375_10034088 | 3300013308 | Bacteria | 4846 |
| 216 | Ga0157375_10047103 | 3300013308 | Bacteria | 4208 |
| 217 | Ga0157375_10090831 | 3300013308 | Bacteria | 3114 |
| 218 | Ga0163163_10010139 | 3300014325 | Bacteria | 8453 |
| 219 | Ga0163163_10015972 | 3300014325 | Bacteria | 6958 |
| 220 | Ga0163163_10019417 | 3300014325 | Bacteria | 6385 |
| 221 | Ga0163163_10212785 | 3300014325 | Bacteria | 1982 |
| 222 | Ga0157380_10001792 | 3300014326 | Bacteria | 14171 |
| 223 | Ga0157380_10108505 | 3300014326 | Bacteria | 2327 |
| 224 | Ga0157377_10007254 | 3300014745 | Bacteria | 5343 |
| 225 | Ga0157379_10004317 | 3300014968 | Bacteria | 12160 |
| 226 | Ga0157379_10010816 | 3300014968 | Bacteria | 7957 |
| 227 | Ga0157379_10018910 | 3300014968 | Bacteria | 6079 |
| 228 | Ga0157379_10256642 | 3300014968 | Bacteria | 1588 |
| 229 | Ga0157376_10006288 | 3300014969 | Bacteria | 8380 |
| 230 | Ga0157376_10028517 | 3300014969 | Bacteria | 4438 |
| 231 | Ga0213872_10001252 | 3300021361 | Bacteria | 17110 |
| 232 | Ga0213874_10029524 | 3300021377 | Bacteria | 1574 |
| 233 | Ga0207427_100046 | 3300025231 | Bacteria | 240976 |
| 234 | Ga0209233_1030298 | 3300025261 | Bacteria | 1276 |
| 235 | Ga0207642_10078038 | 3300025899 | Bacteria | 1599 |
| 236 | Ga0207710_10000707 | 3300025900 | Bacteria | 18686 |
| 237 | Ga0207688_10031059 | 3300025901 | Bacteria | 2947 |
| 238 | Ga0207680_10036951 | 3300025903 | Bacteria | 2816 |
| 239 | Ga0207680_10048147 | 3300025903 | Bacteria | 2530 |
| 240 | Ga0207645_10065087 | 3300025907 | Bacteria | 2329 |
| 241 | Ga0207645_10067590 | 3300025907 | Bacteria | 2284 |
| 242 | Ga0207643_10020779 | 3300025908 | Bacteria | 3604 |
| 243 | Ga0207643_10031512 | 3300025908 | Bacteria | 2956 |
| 244 | Ga0207684_10077319 | 3300025910 | Bacteria | 2830 |
| 245 | Ga0207684_10108362 | 3300025910 | Bacteria | 2377 |
| 246 | Ga0207654_10179816 | 3300025911 | Bacteria | 1379 |
| 247 | Ga0207707_10005971 | 3300025912 | Bacteria | 10654 |
| 248 | Ga0207707_10275950 | 3300025912 | Bacteria | 1456 |
| 249 | Ga0207707_10280175 | 3300025912 | Bacteria | 1444 |
| 250 | Ga0207695_10009682 | 3300025913 | Bacteria | 11870 |
| 251 | Ga0207693_10000144 | 3300025915 | Bacteria | 65408 |
| 252 | Ga0207663_10182398 | 3300025916 | Bacteria | 1500 |
| 253 | Ga0207660_10030350 | 3300025917 | Bacteria | 3715 |
| 254 | Ga0207660_10074436 | 3300025917 | Bacteria | 2479 |
| 255 | Ga0207662_10007327 | 3300025918 | Bacteria | 6001 |
| 256 | Ga0207657_10061362 | 3300025919 | Bacteria | 3224 |
| 257 | Ga0207649_10013525 | 3300025920 | Bacteria | 4556 |
| 258 | Ga0207649_10016806 | 3300025920 | Bacteria | 4137 |
| 259 | Ga0207649_10118799 | 3300025920 | Bacteria | 1779 |
| 260 | Ga0207652_10024576 | 3300025921 | Bacteria | 4999 |
| 261 | Ga0207652_10031398 | 3300025921 | Bacteria | 4462 |
| 262 | Ga0207652_10041222 | 3300025921 | Bacteria | 3923 |
| 263 | Ga0207646_10051931 | 3300025922 | Bacteria | 3668 |
| 264 | Ga0207646_10111591 | 3300025922 | Bacteria | 2454 |
| 265 | Ga0207681_10031564 | 3300025923 | Bacteria | 3461 |
| 266 | Ga0207681_10061669 | 3300025923 | Bacteria | 2579 |
| 267 | Ga0207694_10000559 | 3300025924 | Bacteria | 33677 |
| 268 | Ga0207659_10016801 | 3300025926 | Bacteria | 4771 |
| 269 | Ga0207659_10041704 | 3300025926 | Bacteria | 3215 |
| 270 | Ga0207659_10068348 | 3300025926 | Bacteria | 2584 |
| 271 | Ga0207687_10017298 | 3300025927 | Bacteria | 4744 |
| 272 | Ga0207687_10222742 | 3300025927 | Bacteria | 1486 |
| 273 | Ga0207700_10008963 | 3300025928 | Bacteria | 6227 |
| 274 | Ga0207700_10025793 | 3300025928 | Bacteria | 4088 |
| 275 | Ga0207644_10004411 | 3300025931 | Bacteria | 9129 |
| 276 | Ga0207644_10009861 | 3300025931 | Bacteria | 6282 |
| 277 | Ga0207644_10018159 | 3300025931 | Bacteria | 4756 |
| 278 | Ga0207644_10100845 | 3300025931 | Bacteria | 2168 |
| 279 | Ga0207690_10013171 | 3300025932 | Bacteria | 4965 |
| 280 | Ga0207706_10066453 | 3300025933 | Bacteria | 3173 |
| 281 | Ga0207670_10001481 | 3300025936 | Bacteria | 12331 |
| 282 | Ga0207665_10030452 | 3300025939 | Bacteria | 3566 |
| 283 | Ga0207665_10075779 | 3300025939 | Bacteria | 2305 |
| 284 | Ga0207691_10009445 | 3300025940 | Bacteria | 9365 |
| 285 | Ga0207691_10027929 | 3300025940 | Bacteria | 5286 |
| 286 | Ga0207691_10030778 | 3300025940 | Bacteria | 5013 |
| 287 | Ga0207691_10115292 | 3300025940 | Bacteria | 2386 |
| 288 | Ga0207691_10124166 | 3300025940 | Bacteria | 2285 |
| 289 | Ga0207691_10135759 | 3300025940 | Bacteria | 2169 |
| 290 | Ga0207691_10150581 | 3300025940 | Bacteria | 2046 |
| 291 | Ga0207711_10111893 | 3300025941 | Bacteria | 2429 |
| 292 | Ga0207711_10258021 | 3300025941 | Bacteria | 1601 |
| 293 | Ga0207711_10292261 | 3300025941 | Bacteria | 1502 |
| 294 | Ga0207689_10006430 | 3300025942 | Bacteria | 10388 |
| 295 | Ga0207689_10039825 | 3300025942 | Bacteria | 3890 |
| 296 | Ga0207661_10063113 | 3300025944 | Bacteria | 2999 |
| 297 | Ga0207661_10138206 | 3300025944 | Bacteria | 2094 |
| 298 | Ga0207679_10000656 | 3300025945 | Bacteria | 23166 |
| 299 | Ga0207679_10026750 | 3300025945 | Bacteria | 3981 |
| 300 | Ga0207667_10074127 | 3300025949 | Bacteria | 3536 |
| 301 | Ga0207651_10024727 | 3300025960 | Bacteria | 3720 |
| 302 | Ga0207651_10054500 | 3300025960 | Bacteria | 2740 |
| 303 | Ga0207668_10001362 | 3300025972 | Bacteria | 14434 |
| 304 | Ga0207668_10079346 | 3300025972 | Bacteria | 2374 |
| 305 | Ga0207668_10235136 | 3300025972 | Bacteria | 1479 |
| 306 | Ga0207668_10267108 | 3300025972 | Bacteria | 1397 |
| 307 | Ga0207658_10017712 | 3300025986 | Bacteria | 4910 |
| 308 | Ga0207658_10029653 | 3300025986 | Bacteria | 3867 |
| 309 | Ga0207658_10064158 | 3300025986 | Bacteria | 2754 |
| 310 | Ga0207703_10000546 | 3300026035 | Bacteria | 38625 |
| 311 | Ga0207703_10004632 | 3300026035 | Bacteria | 11238 |
| 312 | Ga0207703_10021376 | 3300026035 | Bacteria | 5066 |
| 313 | Ga0207703_10268590 | 3300026035 | Bacteria | 1544 |
| 314 | Ga0207678_10132972 | 3300026067 | Bacteria | 2122 |
| 315 | Ga0207708_10007528 | 3300026075 | Bacteria | 8052 |
| 316 | Ga0207702_10069830 | 3300026078 | Bacteria | 3021 |
| 317 | Ga0207641_10007700 | 3300026088 | Bacteria | 8955 |
| 318 | Ga0207641_10023323 | 3300026088 | Bacteria | 5099 |
| 319 | Ga0207641_10132158 | 3300026088 | Bacteria | 2242 |
| 320 | Ga0207641_10160586 | 3300026088 | Bacteria | 2043 |
| 321 | Ga0207641_10248499 | 3300026088 | Bacteria | 1660 |
| 322 | Ga0207648_10009986 | 3300026089 | Bacteria | 9032 |
| 323 | Ga0207648_10026881 | 3300026089 | Bacteria | 5110 |
| 324 | Ga0207676_10000864 | 3300026095 | Bacteria | 23487 |
| 325 | Ga0207676_10001384 | 3300026095 | Bacteria | 18052 |
| 326 | Ga0207676_10176067 | 3300026095 | Bacteria | 1868 |
| 327 | Ga0207674_10011342 | 3300026116 | Bacteria | 10015 |
| 328 | Ga0207674_10106888 | 3300026116 | Bacteria | 2775 |
| 329 | Ga0207674_10151355 | 3300026116 | Bacteria | 2277 |
| 330 | Ga0207675_100004089 | 3300026118 | Bacteria | 14121 |
| 331 | Ga0207675_100009531 | 3300026118 | Bacteria | 9080 |
| 332 | Ga0207683_10016234 | 3300026121 | Bacteria | 6336 |
| 333 | Ga0207683_10025557 | 3300026121 | Bacteria | 5095 |
| 334 | Ga0207683_10071385 | 3300026121 | Bacteria | 3069 |
| 335 | Ga0207683_10087371 | 3300026121 | Bacteria | 2773 |
| 336 | Ga0207683_10147076 | 3300026121 | Bacteria | 2125 |
| 337 | Ga0207698_10047853 | 3300026142 | Bacteria | 3243 |
| 338 | Ga0209179_1000052 | 3300027512 | Bacteria | 22200 |
| 339 | Ga0209966_1002482 | 3300027695 | Bacteria | 3076 |
| 340 | Ga0209974_10000870 | 3300027876 | Bacteria | 10438 |
| 341 | Ga0207428_10004195 | 3300027907 | Bacteria | 13805 |
| 342 | Ga0207428_10008986 | 3300027907 | Bacteria | 9001 |
| 343 | Ga0207428_10051616 | 3300027907 | Bacteria | 3287 |
| 344 | Ga0268266_10000043 | 3300028379 | Bacteria | 316604 |
| 345 | Ga0268266_10044291 | 3300028379 | Bacteria | 3804 |
| 346 | Ga0268265_10002952 | 3300028380 | Bacteria | 12461 |
| 347 | Ga0268264_10021851 | 3300028381 | Bacteria | 5222 |
| 348 | Ga0268264_10046144 | 3300028381 | Bacteria | 3619 |
| 349 | Ga0268264_10238939 | 3300028381 | Bacteria | 1682 |
| 350 | Ga0265334_10001821 | 3300028573 | Bacteria | 10152 |
| 351 | Ga0265318_10001878 | 3300028577 | Bacteria | 11799 |
| 352 | Ga0265338_10153805 | 3300028800 | Bacteria | 1784 |
| 353 | Ga0265338_10156928 | 3300028800 | Bacteria | 1761 |
| 354 | Ga0265338_10245175 | 3300028800 | Bacteria | 1325 |
| 355 | Ga0265760_10001504 | 3300031090 | Bacteria | 6870 |
| 356 | Ga0265330_10004512 | 3300031235 | Bacteria | 7059 |
| 357 | Ga0265330_10038550 | 3300031235 | Bacteria | 2125 |
| 358 | Ga0265332_10004622 | 3300031238 | Bacteria | 6440 |
| 359 | Ga0265332_10014065 | 3300031238 | Bacteria | 3540 |
| 360 | Ga0265328_10012826 | 3300031239 | Bacteria | 3331 |
| 361 | Ga0265320_10003581 | 3300031240 | Bacteria | 10386 |
| 362 | Ga0265329_10003460 | 3300031242 | Bacteria | 6867 |
| 363 | Ga0265340_10039675 | 3300031247 | Bacteria | 2321 |
| 364 | Ga0265331_10002032 | 3300031250 | Bacteria | 14032 |
| 365 | Ga0265327_10010305 | 3300031251 | Bacteria | 6591 |
| 366 | Ga0307513_10010867 | 3300031456 | Bacteria | 11371 |
| 367 | Ga0307513_10011072 | 3300031456 | Bacteria | 11246 |
| 368 | Ga0307513_10026046 | 3300031456 | Bacteria | 6753 |
| 369 | Ga0307513_10030077 | 3300031456 | Bacteria | 6175 |
| 370 | Ga0307509_10001782 | 3300031507 | Bacteria | 35739 |
| 371 | Ga0307509_10289607 | 3300031507 | Bacteria | 1393 |
| 372 | Ga0307408_100000511 | 3300031548 | Bacteria | 33537 |
| 373 | Ga0307408_100169267 | 3300031548 | Bacteria | 1743 |
| 374 | Ga0307408_100173500 | 3300031548 | Bacteria | 1723 |
| 375 | Ga0316575_10005276 | 3300031665 | Bacteria | 4601 |
| 376 | Ga0265314_10005027 | 3300031711 | Bacteria | 12047 |
| 377 | Ga0316576_10038287 | 3300031727 | Bacteria | 3438 |
| 378 | Ga0307413_10123106 | 3300031824 | Bacteria | 1760 |
| 379 | Ga0307410_10228569 | 3300031852 | Bacteria | 1435 |
| 380 | Ga0307406_10212875 | 3300031901 | Bacteria | 1431 |
| 381 | Ga0307407_10000861 | 3300031903 | Bacteria | 10179 |
| 382 | Ga0307412_10196598 | 3300031911 | Bacteria | 1528 |
| 383 | Ga0307409_100006680 | 3300031995 | Bacteria | 6815 |
| 384 | Ga0307409_100007504 | 3300031995 | Bacteria | 6533 |
| 385 | Ga0307409_100189599 | 3300031995 | Bacteria | 1829 |
| 386 | Ga0307416_100072983 | 3300032002 | Bacteria | 2859 |
| 387 | Ga0307416_100098106 | 3300032002 | Bacteria | 2540 |
| 388 | Ga0307414_10162023 | 3300032004 | Bacteria | 1778 |
| 389 | Ga0307411_10007609 | 3300032005 | Bacteria | 5539 |
| 390 | Ga0307411_10086000 | 3300032005 | Bacteria | 2180 |
| 391 | Ga0307411_10135426 | 3300032005 | Bacteria | 1807 |
| 392 | Ga0316574_0038377 | 3300035398 | Bacteria | 2940 |
| 393 | Ga0316574_0186885 | 3300035398 | Bacteria | 1333 |
| 394 | Ga0373935_0212850 | 3300035692 | Bacteria | 1340 |
| 395 | Ga0373933_0000488 | 3300035724 | Bacteria | 24751 |
| 396 | Ga0373933_0098308 | 3300035724 | Bacteria | 1813 |
| 397 | Ga0373947_0114603 | 3300035725 | Bacteria | 1707 |
| 398 | Ga0373937_0000468 | 3300036401 | Bacteria | 37355 |
| 399 | Ga0373937_0002951 | 3300036401 | Bacteria | 14233 |
| 400 | Ga0373937_0008737 | 3300036401 | Bacteria | 8794 |
| 401 | Ga0316582_0117486 | 3300036647 | Bacteria | 1777 |
| 402 | Ga0316584_0194111 | 3300036712 | Bacteria | 1500 |
| 403 | Ga0395900_0121443 | 3300037418 | Bacteria | 2680 |
| 404 | Ga0395900_0159978 | 3300037418 | Bacteria | 2297 |
| 405 | Ga0436364_1490639 | 3300037853 | Bacteria | 2245 |
| 406 | Ga0395901_0031195 | 3300038443 | Bacteria | 5495 |
| 407 | Ga0395901_0142689 | 3300038443 | Bacteria | 2517 |
| 408 | Ga0400485_20853 | 3300038735 | Bacteria | 7601 |
| 409 | Ga0400483_079008 | 3300039062 | Bacteria | 2772 |
| 410 | Ga0400483_158383 | 3300039062 | Bacteria | 4194 |
| 411 | Ga0436365_0351645 | 3300039437 | Bacteria | 2250 |
| 412 | Ga0436365_0484474 | 3300039437 | Bacteria | 10353 |
| 413 | Ga0436361_0141670 | 3300039447 | Bacteria | 12511 |
| 414 | Ga0436363_0008955 | 3300039450 | Bacteria | 3192 |
| 415 | Ga0436363_1449045 | 3300039450 | Bacteria | 19321 |
| 416 | Ga0439463_034743 | 3300042016 | Bacteria | 1275 |
| 417 | Ga0450923_005677 | 3300042125 | Bacteria | 2030 |
| 418 | Ga0439435_0004369 | 3300042436 | Bacteria | 3038 |
| 419 | Ga0450916_002402 | 3300042530 | Bacteria | 1987 |
| 420 | Ga0451577_0009030 | 3300042876 | Bacteria | 9625 |
| 421 | Ga0451577_0123583 | 3300042876 | Bacteria | 2318 |
| 422 | Ga0466969_0000641 | 3300044656 | Bacteria | 18885 |
| 423 | Ga0466982_0000008 | 3300044672 | Bacteria | 240089 |
| 424 | Ga0466966_0001146 | 3300044684 | Bacteria | 17030 |
| 425 | Ga0466961_0002065 | 3300044693 | Bacteria | 12508 |
| 426 | Ga0466964_0000651 | 3300044706 | Bacteria | 11066 |
| 427 | Ga0466971_0000248 | 3300044719 | Bacteria | 20646 |
| 428 | Ga0466968_0006719 | 3300044735 | Bacteria | 4347 |
| 429 | Ga0466970_0000992 | 3300044765 | Bacteria | 13656 |
| 430 | Ga0466957_0001315 | 3300044842 | Bacteria | 12982 |
| 431 | Ga0466960_0110202 | 3300044901 | Bacteria | 1429 |
| 432 | Ga0466959_0000450 | 3300045049 | Bacteria | 23931 |
| 433 | Ga0495592_0137368 | 3300046454 | Bacteria | 1703 |
| 434 | Ga0495603_0001733 | 3300046455 | Bacteria | 12850 |
| 435 | Ga0495590_0014704 | 3300046457 | Bacteria | 2854 |
| 436 | Ga0495591_000575 | 3300046458 | Bacteria | 27984 |
| 437 | Ga0495629_0004592 | 3300046459 | Bacteria | 10334 |
| 438 | Ga0495629_0007566 | 3300046459 | Bacteria | 8004 |
| 439 | Ga0495638_0000009 | 3300046460 | Bacteria | 525345 |
| 440 | Ga0495638_0000019 | 3300046460 | Bacteria | 384671 |
| 441 | Ga0495638_0026533 | 3300046460 | Bacteria | 3754 |
| 442 | Ga0495641_0004767 | 3300046461 | Bacteria | 9445 |
| 443 | Ga0495651_0004026 | 3300046462 | Bacteria | 11234 |
| 444 | Ga0495651_0041499 | 3300046462 | Bacteria | 3574 |
| 445 | Ga0495651_0075664 | 3300046462 | Bacteria | 2552 |
| 446 | Ga0495650_0023496 | 3300046471 | Bacteria | 2934 |
| 447 | Ga0495580_0000001 | 3300046472 | Bacteria | 180598 |
| 448 | Ga0495580_0038710 | 3300046472 | Bacteria | 3414 |
| 449 | Ga0495580_0065981 | 3300046472 | Bacteria | 2534 |
| 450 | Ga0495580_0098080 | 3300046472 | Bacteria | 2038 |
| 451 | Ga0495582_0070282 | 3300046473 | Bacteria | 1936 |
| 452 | Ga0495605_0016541 | 3300046474 | Bacteria | 3991 |
| 453 | Ga0495664_0000164 | 3300046477 | Bacteria | 32697 |
| 454 | Ga0495664_0032098 | 3300046477 | Bacteria | 3080 |
| 455 | Ga0495664_0160999 | 3300046477 | Bacteria | 1361 |
| 456 | Ga0495594_0075216 | 3300046499 | Bacteria | 1882 |
| 457 | Ga0495594_0102326 | 3300046499 | Bacteria | 1611 |
| 458 | Ga0495596_0028068 | 3300046500 | Bacteria | 2260 |
| 459 | Ga0495583_0000789 | 3300046506 | Bacteria | 39441 |
| 460 | Ga0495606_0021160 | 3300046507 | Bacteria | 4768 |
| 461 | Ga0495606_0034610 | 3300046507 | Bacteria | 3466 |
| 462 | Ga0495608_0056897 | 3300046511 | Bacteria | 2581 |
| 463 | Ga0495608_0063710 | 3300046511 | Bacteria | 2418 |
| 464 | Ga0495608_0190206 | 3300046511 | Bacteria | 1296 |
| 465 | Ga0495616_0006800 | 3300046513 | Bacteria | 6892 |
| 466 | Ga0495616_0067916 | 3300046513 | Bacteria | 1732 |
| 467 | Ga0495618_0003150 | 3300046514 | Bacteria | 10359 |
| 468 | Ga0495618_0046853 | 3300046514 | Bacteria | 2729 |
| 469 | Ga0495618_0129568 | 3300046514 | Bacteria | 1614 |
| 470 | Ga0495628_0000262 | 3300046516 | Bacteria | 46877 |
| 471 | Ga0495628_0045325 | 3300046516 | Bacteria | 3497 |
| 472 | Ga0495628_0053645 | 3300046516 | Bacteria | 3181 |
| 473 | Ga0495628_0210389 | 3300046516 | Bacteria | 1463 |
| 474 | Ga0495628_0288211 | 3300046516 | Bacteria | 1218 |
| 475 | Ga0495630_0012400 | 3300046517 | Bacteria | 6189 |
| 476 | Ga0495630_0017162 | 3300046517 | Bacteria | 5300 |
| 477 | Ga0495630_0041217 | 3300046517 | Bacteria | 3448 |
| 478 | Ga0495648_0002441 | 3300046524 | Bacteria | 17177 |
| 479 | Ga0495648_0022885 | 3300046524 | Bacteria | 4290 |
| 480 | Ga0495648_0029414 | 3300046524 | Bacteria | 3647 |
| 481 | Ga0495666_0002792 | 3300046526 | Bacteria | 8731 |
| 482 | Ga0495666_0002993 | 3300046526 | Bacteria | 8480 |
| 483 | Ga0495666_0040785 | 3300046526 | Bacteria | 2250 |
| 484 | Ga0495652_0009937 | 3300046529 | Bacteria | 8627 |
| 485 | Ga0495665_0002661 | 3300046531 | Bacteria | 9635 |
| 486 | Ga0495640_0007335 | 3300046533 | Bacteria | 8678 |
| 487 | Ga0495640_0013736 | 3300046533 | Bacteria | 6153 |
| 488 | Ga0495640_0080936 | 3300046533 | Bacteria | 2159 |
| 489 | Ga0495586_0000531 | 3300046535 | Bacteria | 22200 |
| 490 | Ga0495587_0000061 | 3300046536 | Bacteria | 92667 |
| 491 | Ga0495587_0018149 | 3300046536 | Bacteria | 4363 |
| 492 | Ga0495587_0046374 | 3300046536 | Bacteria | 2580 |
| 493 | Ga0495598_0002515 | 3300046537 | Bacteria | 3790 |
| 494 | Ga0495621_0004199 | 3300046539 | Bacteria | 4024 |
| 495 | Ga0495645_0005913 | 3300046543 | Bacteria | 8452 |
| 496 | Ga0495645_0039515 | 3300046543 | Bacteria | 3441 |
| 497 | Ga0495645_0138980 | 3300046543 | Bacteria | 1696 |
| 498 | Ga0495622_0000111 | 3300046557 | Bacteria | 71097 |
| 499 | Ga0495667_0084255 | 3300046559 | Bacteria | 2064 |
| 500 | Ga0495667_0095961 | 3300046559 | Bacteria | 1919 |
| 501 | Ga0495656_0132704 | 3300046615 | Bacteria | 1187 |
| 502 | Ga0495634_0005907 | 3300046642 | Bacteria | 9349 |
| 503 | Ga0495634_0013358 | 3300046642 | Bacteria | 5934 |
| 504 | Ga0495611_0088210 | 3300046648 | Bacteria | 1432 |
| 505 | Ga0495625_0212135 | 3300046660 | Bacteria | 1272 |
| 506 | Ga0495635_0001720 | 3300046663 | Bacteria | 14731 |
| 507 | Ga0495635_0007054 | 3300046663 | Bacteria | 7852 |
| 508 | Ga0495661_0000792 | 3300046665 | Bacteria | 30007 |
| 509 | Ga0495661_0034993 | 3300046665 | Bacteria | 3156 |
| 510 | Ga0495657_0087203 | 3300046675 | Bacteria | 2009 |
| 511 | Ga0495599_0036013 | 3300046678 | Bacteria | 3106 |
| 512 | Ga0495599_0036579 | 3300046678 | Bacteria | 3084 |
| 513 | Ga0495599_0039891 | 3300046678 | Bacteria | 2950 |
| 514 | Ga0495599_0124257 | 3300046678 | Bacteria | 1604 |
| 515 | Ga0495623_0013862 | 3300046679 | Bacteria | 5227 |
| 516 | Ga0495623_0017621 | 3300046679 | Bacteria | 4612 |
| 517 | Ga0495623_0087503 | 3300046679 | Bacteria | 1919 |
| 518 | Ga0495646_0026823 | 3300046680 | Bacteria | 3615 |
| 519 | Ga0495658_0003311 | 3300046683 | Bacteria | 8001 |
| 520 | Ga0495658_0102904 | 3300046683 | Bacteria | 1707 |
| 521 | Ga0495613_0004454 | 3300046689 | Bacteria | 10497 |
| 522 | Ga0495613_0005409 | 3300046689 | Bacteria | 9593 |
| 523 | Ga0495613_0089376 | 3300046689 | Bacteria | 2232 |
| 524 | Ga0495613_0106251 | 3300046689 | Bacteria | 2026 |
| 525 | Ga0495624_0002796 | 3300046690 | Bacteria | 13081 |
| 526 | Ga0495671_0018759 | 3300046692 | Bacteria | 3667 |
| 527 | Ga0495649_0004038 | 3300046694 | Bacteria | 9665 |
| 528 | Ga0495649_0005395 | 3300046694 | Bacteria | 8139 |
| 529 | Ga0495589_0036444 | 3300046794 | Bacteria | 2465 |
| 530 | Ga0495600_0016311 | 3300046809 | Bacteria | 4712 |
| 531 | Ga0495581_0031327 | 3300047315 | Bacteria | 3082 |
| 532 | Ga0495581_0033226 | 3300047315 | Bacteria | 2987 |
| 533 | Ga0495604_0008440 | 3300047317 | Bacteria | 8136 |
| 534 | Ga0495604_0011493 | 3300047317 | Bacteria | 7031 |
| 535 | Ga0495604_0071002 | 3300047317 | Bacteria | 2635 |
| 536 | Ga0495674_0022704 | 3300047319 | Bacteria | 5784 |
| 537 | Ga0495674_0044943 | 3300047319 | Bacteria | 3924 |
| 538 | Ga0495674_0054798 | 3300047319 | Bacteria | 3499 |
| 539 | Ga0495674_0096533 | 3300047319 | Bacteria | 2519 |
| 540 | Ga0495672_0005551 | 3300047320 | Bacteria | 9979 |
| 541 | Ga0495676_0010162 | 3300047321 | Bacteria | 8547 |
| 542 | Ga0495676_0033442 | 3300047321 | Bacteria | 4330 |
| 543 | Ga0495680_0001809 | 3300047322 | Bacteria | 22585 |
| 544 | Ga0495680_0006202 | 3300047322 | Bacteria | 11142 |
| 545 | Ga0495680_0049254 | 3300047322 | Bacteria | 3300 |
| 546 | Ga0495680_0063040 | 3300047322 | Bacteria | 2848 |
| 547 | Ga0495683_0001051 | 3300047323 | Bacteria | 19225 |
| 548 | Ga0495683_0003350 | 3300047323 | Bacteria | 9372 |
| 549 | Ga0495675_0001861 | 3300047444 | Bacteria | 12561 |
| 550 | Ga0495675_0049285 | 3300047444 | Bacteria | 2678 |
| 551 | Ga0495675_0094363 | 3300047444 | Bacteria | 1876 |
| 552 | Ga0495679_011230 | 3300047446 | Bacteria | 3470 |
| 553 | Ga0495679_021580 | 3300047446 | Bacteria | 2219 |
| 554 | Ga0495673_0012859 | 3300047469 | Bacteria | 4415 |
| 555 | Ga0495684_0102432 | 3300047471 | Bacteria | 2164 |
| 556 | Ga0495593_0001562 | 3300047673 | Bacteria | 13504 |
| 557 | Ga0495593_0025776 | 3300047673 | Bacteria | 3253 |
| 558 | Ga0495602_0000053 | 3300048088 | Bacteria | 113109 |
| 559 | Ga0495602_0074019 | 3300048088 | Bacteria | 2897 |
| 560 | Ga0495614_0000057 | 3300048089 | Bacteria | 34749 |
| 561 | Ga0495614_0016739 | 3300048089 | Bacteria | 3189 |
| 562 | Ga0495626_0000532 | 3300048091 | Bacteria | 37897 |
| 563 | Ga0496100_0013096 | 3300048903 | Bacteria | 4774 |
| 564 | Ga0496101_0005358 | 3300048904 | Bacteria | 8175 |
| 565 | Ga0496102_0005056 | 3300048905 | Bacteria | 11165 |
| 566 | Ga0496102_0043481 | 3300048905 | Bacteria | 4074 |
| 567 | Ga0496102_0133326 | 3300048905 | Bacteria | 2326 |
| 568 | Ga0496104_0031783 | 3300048907 | Bacteria | 4911 |
| 569 | Ga0496104_0218283 | 3300048907 | Bacteria | 1819 |
| 570 | Ga0496104_0243472 | 3300048907 | Bacteria | 1711 |
| 571 | Ga0496105_0112275 | 3300048908 | Bacteria | 2249 |
| 572 | Ga0496105_0136530 | 3300048908 | Bacteria | 2020 |
| 573 | Ga0496106_0000026 | 3300048909 | Bacteria | 150927 |
| 574 | Ga0496106_0053352 | 3300048909 | Bacteria | 3053 |
| 575 | Ga0496106_0133235 | 3300048909 | Bacteria | 1950 |
| 576 | Ga0496107_0047750 | 3300048910 | Bacteria | 3083 |
| 577 | Ga0496107_0129639 | 3300048910 | Bacteria | 1862 |
| 578 | Ga0496108_0090486 | 3300048911 | Bacteria | 2601 |
| 579 | Ga0496108_0123685 | 3300048911 | Bacteria | 2220 |
| 580 | Ga0496109_0052994 | 3300048912 | Bacteria | 3699 |
| 581 | Ga0496109_0188625 | 3300048912 | Bacteria | 1937 |
| 582 | Ga0496110_0020733 | 3300048913 | Bacteria | 5550 |
| 583 | Ga0496111_0018841 | 3300048914 | Bacteria | 4785 |
| 584 | Ga0496112_0047670 | 3300048915 | Bacteria | 4204 |
| 585 | Ga0496112_0165033 | 3300048915 | Bacteria | 2181 |
| 586 | Ga0496113_0386412 | 3300048916 | Bacteria | 1123 |
| 587 | Ga0496114_0184882 | 3300048917 | Bacteria | 1821 |
| 588 | Ga0496115_0013593 | 3300048918 | Bacteria | 6159 |
| 589 | Ga0496115_0028641 | 3300048918 | Bacteria | 4367 |
| 590 | Ga0496116_0017445 | 3300048919 | Bacteria | 5570 |
| 591 | Ga0496117_0001069 | 3300048920 | Bacteria | 41544 |
| 592 | Ga0496118_0003050 | 3300048921 | Bacteria | 21565 |
| 593 | Ga0496118_0013994 | 3300048921 | Bacteria | 7536 |
| 594 | Ga0496118_0019928 | 3300048921 | Bacteria | 5970 |
| 595 | Ga0496118_0047114 | 3300048921 | Bacteria | 3346 |
| 596 | Ga0496121_0000791 | 3300048924 | Bacteria | 57823 |
| 597 | Ga0496121_0001380 | 3300048924 | Bacteria | 41120 |
| 598 | Ga0496121_0041380 | 3300048924 | Bacteria | 4027 |
| 599 | Ga0496124_0028070 | 3300048927 | Bacteria | 5038 |
| 600 | Ga0496125_0009370 | 3300048928 | Bacteria | 10083 |
| 601 | Ga0496126_0000242 | 3300048929 | Bacteria | 117707 |
| 602 | Ga0496126_0000798 | 3300048929 | Bacteria | 56449 |
| 603 | Ga0496126_0044674 | 3300048929 | Bacteria | 4078 |
| 604 | Ga0495678_057885 | 3300049459 | Bacteria | 1466 |
| 605 | Ga0495678_060709 | 3300049459 | Bacteria | 1421 |
| 606 | Ga0495682_0009167 | 3300049460 | Bacteria | 3873 |
| 607 | Ga0495682_0017422 | 3300049460 | Bacteria | 2711 |
| 608 | Ga0501031_0003012 | 3300049568 | Bacteria | 10778 |
| 609 | Ga0501032_0045587 | 3300049569 | Bacteria | 2965 |
| 610 | Ga0501032_0122025 | 3300049569 | Bacteria | 1722 |
| 611 | Ga0501033_0000770 | 3300049570 | Bacteria | 29451 |
| 612 | Ga0501034_0016377 | 3300049571 | Bacteria | 7609 |
| 613 | Ga0501034_0186382 | 3300049571 | Bacteria | 2038 |
| 614 | Ga0501036_0011136 | 3300049572 | Bacteria | 7440 |
| 615 | Ga0501036_0028908 | 3300049572 | Bacteria | 4684 |
| 616 | Ga0501036_0291211 | 3300049572 | Bacteria | 1366 |
| 617 | Ga0501037_0002991 | 3300049573 | Bacteria | 12277 |
| 618 | Ga0501037_0094453 | 3300049573 | Bacteria | 2162 |
| 619 | Ga0501037_0104244 | 3300049573 | Bacteria | 2045 |
| 620 | Ga0501038_0011113 | 3300049574 | Bacteria | 8222 |
| 621 | Ga0501038_0060892 | 3300049574 | Bacteria | 3229 |
| 622 | Ga0501038_0119409 | 3300049574 | Bacteria | 2176 |
| 623 | Ga0501039_0044766 | 3300049575 | Bacteria | 3419 |
| 624 | Ga0501039_0092941 | 3300049575 | Bacteria | 2351 |
| 625 | Ga0501039_0151688 | 3300049575 | Bacteria | 1821 |
| 626 | Ga0501040_0005878 | 3300049576 | Bacteria | 7943 |
| 627 | Ga0501040_0008195 | 3300049576 | Bacteria | 6793 |
| 628 | Ga0501040_0058241 | 3300049576 | Bacteria | 2653 |
| 629 | Ga0501041_0011412 | 3300049577 | Bacteria | 5251 |
| 630 | Ga0501042_0004636 | 3300049578 | Bacteria | 8773 |
| 631 | Ga0501042_0047222 | 3300049578 | Bacteria | 3070 |
| 632 | Ga0501043_0004167 | 3300049579 | Bacteria | 11815 |
| 633 | Ga0501043_0244795 | 3300049579 | Bacteria | 1382 |
| 634 | Ga0501046_0028495 | 3300049580 | Bacteria | 4546 |
| 635 | Ga0501046_0180742 | 3300049580 | Bacteria | 1577 |
| 636 | Ga0501047_0013149 | 3300049581 | Bacteria | 7839 |
| 637 | Ga0501047_0293215 | 3300049581 | Bacteria | 1470 |
| 638 | Ga0501048_0090271 | 3300049582 | Bacteria | 2161 |
| 639 | Ga0501067_0001150 | 3300049583 | Bacteria | 14350 |
| 640 | Ga0501067_0039547 | 3300049583 | Bacteria | 2619 |
| 641 | Ga0501068_0018290 | 3300049584 | Bacteria | 4060 |
| 642 | Ga0501068_0090790 | 3300049584 | Bacteria | 1885 |
| 643 | Ga0501068_0199487 | 3300049584 | Bacteria | 1269 |
| 644 | Ga0501070_0076177 | 3300049586 | Bacteria | 2777 |
| 645 | Ga0501071_0037530 | 3300049587 | Bacteria | 3460 |
| 646 | Ga0501071_0042205 | 3300049587 | Bacteria | 3267 |
| 647 | Ga0501071_0158831 | 3300049587 | Bacteria | 1689 |
| 648 | Ga0501073_0005778 | 3300049589 | Bacteria | 9247 |
| 649 | Ga0501073_0039494 | 3300049589 | Bacteria | 3342 |
| 650 | Ga0501074_0019863 | 3300049590 | Bacteria | 4880 |
| 651 | Ga0501074_0152806 | 3300049590 | Bacteria | 1650 |
| 652 | Ga0501074_0216121 | 3300049590 | Bacteria | 1365 |
| 653 | Ga0501075_0000841 | 3300049591 | Bacteria | 19343 |
| 654 | Ga0501075_0002728 | 3300049591 | Bacteria | 11819 |
| 655 | Ga0501076_0000166 | 3300049592 | Bacteria | 38261 |
| 656 | Ga0501076_0006224 | 3300049592 | Bacteria | 8641 |
| 657 | Ga0501076_0104450 | 3300049592 | Bacteria | 2286 |
| 658 | Ga0501076_0282816 | 3300049592 | Bacteria | 1359 |
| 659 | Ga0501207_000511 | 3300049654 | Bacteria | 4377 |
| 660 | Ga0501261_005958 | 3300049690 | Bacteria | 1545 |
| 661 | Ga0501079_0012922 | 3300049741 | Bacteria | 6373 |
| 662 | Ga0501079_0029434 | 3300049741 | Bacteria | 4216 |
| 663 | Ga0501079_0125298 | 3300049741 | Bacteria | 1998 |
| 664 | Ga0501080_0024975 | 3300049742 | Bacteria | 5543 |
| 665 | Ga0501080_0031712 | 3300049742 | Bacteria | 4925 |
| 666 | Ga0501080_0109492 | 3300049742 | Bacteria | 2561 |
| 667 | Ga0501080_0162257 | 3300049742 | Bacteria | 2064 |
| 668 | Ga0501081_0104493 | 3300049743 | Bacteria | 2005 |
| 669 | Ga0501035_0008948 | 3300049822 | Bacteria | 9316 |
| 670 | Ga0501035_0060438 | 3300049822 | Bacteria | 3373 |
| 671 | Ga0501044_0000396 | 3300049823 | Bacteria | 54058 |
| 672 | Ga0501044_0133588 | 3300049823 | Bacteria | 2474 |
| 673 | Ga0501045_0090883 | 3300049824 | Bacteria | 2256 |
| 674 | nmdc:mga05p37_16198_c1 | 3300050507 | Bacteria | 8975 |
| 675 | nmdc:mga05p37_16472_c1 | 3300050507 | Bacteria | 8905 |
| 676 | nmdc:mga09592_2620_c1 | 3300050508 | Bacteria | 14564 |
| 677 | nmdc:mga09592_5028_c1 | 3300050508 | Bacteria | 10725 |
| 678 | nmdc:mga09592_65910_c1 | 3300050508 | Bacteria | 3068 |
| 679 | nmdc:mga09592_92914_c1 | 3300050508 | Bacteria | 2579 |
| 680 | nmdc:mga0qj67_15475_c1 | 3300050509 | Bacteria | 5776 |
| 681 | nmdc:mga0qj67_193338_c1 | 3300050509 | Bacteria | 1653 |
| 682 | nmdc:mga0qj67_24238_c1 | 3300050509 | Bacteria | 4676 |
| 683 | nmdc:mga0qj67_48604_c1 | 3300050509 | Bacteria | 3351 |
| 684 | nmdc:mga06r32_1870_c1 | 3300050510 | Bacteria | 18760 |
| 685 | nmdc:mga06r32_31492_c1 | 3300050510 | Bacteria | 4982 |
| 686 | nmdc:mga06r32_565_c1 | 3300050510 | Bacteria | 32242 |
| 687 | nmdc:mga08y16_194376_c1 | 3300050511 | Bacteria | 2104 |
| 688 | nmdc:mga08y16_418371_c1 | 3300050511 | Bacteria | 1370 |
| 689 | nmdc:mga08y16_4678_c1 | 3300050511 | Bacteria | 14262 |
| 690 | nmdc:mga08y16_6258_c1 | 3300050511 | Bacteria | 12482 |
| 691 | nmdc:mga08y16_9872_c1 | 3300050511 | Bacteria | 10024 |
| 692 | nmdc:mga0rr50_167207_c1 | 3300050513 | Bacteria | 1789 |
| 693 | nmdc:mga0a205_267875_c1 | 3300050515 | Bacteria | 1585 |
| 694 | Ga0495612_0055481 | 3300053078 | Bacteria | 1634 |
| 695 | Ga0500647_0121747 | 3300053091 | Bacteria | 1235 |
| 696 | Ga0500588_0024178 | 3300053146 | Bacteria | 1674 |
| 697 | Ga0500622_0015771 | 3300053156 | Bacteria | 4044 |
| 698 | Ga0500630_043249 | 3300053159 | Bacteria | 2195 |
| 699 | Ga0501084_0034161 | 3300054114 | Bacteria | 4252 |
| 700 | Ga0501082_0004974 | 3300060353 | Bacteria | 11604 |
| 701 | Ga0501082_0052825 | 3300060353 | Bacteria | 3503 |
| 702 | Ga0501082_0486176 | 3300060353 | Bacteria | 1079 |
| 703 | Ga0530510_0000956 | 3300061734 | Bacteria | 19075 |
| 704 | Ga0530510_0136877 | 3300061734 | Bacteria | 1803 |
| 705 | 2510248851 | 2510065045 | Bacteria | 7761063 |
| 706 | 2600813321 | 2600255067 | Bacteria | 6795583 |
| 707 | 2719642725 | 2718217991 | Bacteria | 7829542 |
| 708 | 2723876596 | 2721755763 | Bacteria | 4464185 |
| 709 | 2857359359 | 2857357740 | Bacteria | 9937880 |
| 710 | 2913846382 | 2913844669 | Bacteria | 8381711 |
| 711 | 2952254826 | 2952252522 | Bacteria | 4171745 |
| 712 | 8055307711 | 8055301274 | Bacteria | 8587385 |
| 713 | Ga0495580_0004257 | |||
| 714 | JGI24735J21928_10000266 | |||
| 715 | rootL2_10129855 | |||
| 716 | rootL2_10159372 | |||
| 717 | rootL2_10248547 | |||
| 718 | rootH1_10123237 | |||
| 719 | Ga0065712_10069600 | |||
| 720 | Ga0070658_10079844 | |||
| 721 | Ga0070676_10046023 | |||
| 722 | Ga0070676_10057120 | |||
| 723 | Ga0070676_10138263 | |||
| 724 | Ga0070683_100114781 | |||
| 725 | Ga0070690_100000848 | |||
| 726 | Ga0070690_100009935 | |||
| 727 | Ga0070690_100038140 | |||
| 728 | Ga0070670_100027595 | |||
| 729 | Ga0070670_100244684 | |||
| 730 | Ga0068869_100012483 | |||
| 731 | Ga0068869_100030598 | |||
| 732 | Ga0070666_10000003 | |||
| 733 | Ga0070666_10010881 | |||
| 734 | Ga0070666_10022849 | |||
| 735 | Ga0070666_10057652 | |||
| 736 | Ga0070666_10132764 | |||
| 737 | Ga0070680_100080675 | |||
| 738 | Ga0070682_100005019 | |||
| 739 | Ga0070682_100029235 | |||
| 740 | Ga0068868_100087361 | |||
| 741 | Ga0068868_100440880 | |||
| 742 | Ga0070660_100142379 | |||
| 743 | Ga0070689_100000509 | |||
| 744 | Ga0070687_100005790 | |||
| 745 | Ga0070661_100004656 | |||
| 746 | Ga0070661_100029043 | |||
| 747 | Ga0070661_100094116 | |||
| 748 | Ga0070669_100087836 | |||
| 749 | Ga0070669_100140934 | |||
| 750 | Ga0070669_100221865 | |||
| 751 | Ga0070675_100000139 | |||
| 752 | Ga0070675_100001593 | |||
| 753 | Ga0070675_100027333 | |||
| 754 | Ga0070675_100034288 | |||
| 755 | Ga0070675_100191308 | |||
| 756 | Ga0070671_100039510 | |||
| 757 | Ga0070673_100137301 | |||
| 758 | Ga0070659_100168580 | |||
| 759 | Ga0070667_100014812 | |||
| 760 | Ga0070667_100016792 | |||
| 761 | Ga0070667_100057804 | |||
| 762 | Ga0070714_100016325 | |||
| 763 | Ga0070713_100005046 | |||
| 764 | Ga0070701_10003283 | |||
| 765 | Ga0070711_100002829 | |||
| 766 | Ga0070711_100057627 | |||
| 767 | Ga0070705_100188032 | |||
| 768 | Ga0070700_100013817 | |||
| 769 | Ga0070700_100040893 | |||
| 770 | Ga0070708_100001467 | |||
| 771 | Ga0070678_100007056 | |||
| 772 | Ga0070678_100010070 | |||
| 773 | Ga0070678_100043335 | |||
| 774 | Ga0070678_100047034 | |||
| 775 | Ga0070678_100113076 | |||
| 776 | Ga0070662_100009759 | |||
| 777 | Ga0070662_100031349 | |||
| 778 | Ga0070662_100073743 | |||
| 779 | Ga0070681_10010257 | |||
| 780 | Ga0070681_10032569 | |||
| 781 | Ga0070681_10058997 | |||
| 782 | Ga0068867_100074585 | |||
| 783 | Ga0070685_10015076 | |||
| 784 | Ga0070706_100117637 | |||
| 785 | Ga0070707_100059423 | |||
| 786 | Ga0070707_100141774 | |||
| 787 | Ga0070679_100030388 | |||
| 788 | Ga0070679_100045058 | |||
| 789 | Ga0070679_100071762 | |||
| 790 | Ga0070679_100096553 | |||
| 791 | Ga0070679_100463431 | |||
| 792 | Ga0070684_100014149 | |||
| 793 | Ga0070684_100016613 | |||
| 794 | Ga0070684_100043697 | |||
| 795 | Ga0070684_100151984 | |||
| 796 | Ga0070672_100038359 | |||
| 797 | Ga0070672_100106049 | |||
| 798 | Ga0070686_100001361 | |||
| 799 | Ga0070695_100054714 | |||
| 800 | Ga0070695_100203548 | |||
| 801 | Ga0070665_100003952 | |||
| 802 | Ga0070665_100011103 | |||
| 803 | Ga0070665_100015433 | |||
| 804 | Ga0070665_100026593 | |||
| 805 | Ga0070665_100033938 | |||
| 806 | Ga0070704_100239109 | |||
| 807 | Ga0068855_100014165 | |||
| 808 | Ga0068855_100128321 | |||
| 809 | Ga0068855_100131836 | |||
| 810 | Ga0070664_100000585 | |||
| 811 | Ga0070664_100006952 | |||
| 812 | Ga0070664_100215971 | |||
| 813 | Ga0070664_100283404 | |||
| 814 | Ga0068857_100104059 | |||
| 815 | Ga0068857_100186515 | |||
| 816 | Ga0068856_100015327 | |||
| 817 | Ga0070702_100001168 | |||
| 818 | Ga0070702_100017086 | |||
| 819 | Ga0070702_100087223 | |||
| 820 | Ga0068852_100020679 | |||
| 821 | Ga0068859_100000516 | |||
| 822 | Ga0068859_100006281 | |||
| 823 | Ga0068859_100010529 | |||
| 824 | Ga0068859_100180195 | |||
| 825 | Ga0068864_100001046 | |||
| 826 | Ga0068864_100002556 | |||
| 827 | Ga0068864_100013383 | |||
| 828 | Ga0068866_10004732 | |||
| 829 | Ga0068861_100015785 | |||
| 830 | Ga0068861_100018595 | |||
| 831 | Ga0068861_100052102 | |||
| 832 | Ga0068870_10019427 | |||
| 833 | Ga0068870_10027886 | |||
| 834 | Ga0068863_100019332 | |||
| 835 | Ga0068863_100021414 | |||
| 836 | Ga0068863_100029477 | |||
| 837 | Ga0068863_100030863 | |||
| 838 | Ga0068863_100107519 | |||
| 839 | Ga0068858_100001604 | |||
| 840 | Ga0068858_100015946 | |||
| 841 | Ga0068858_100109882 | |||
| 842 | Ga0068860_100012232 | |||
| 843 | Ga0068860_100022411 | |||
| 844 | Ga0068860_100040982 | |||
| 845 | Ga0068860_100102820 | |||
| 846 | Ga0068862_100001537 | |||
| 847 | Ga0068862_100112008 | |||
| 848 | Ga0068862_100330390 | |||
| 849 | Ga0081455_10076519 | |||
| 850 | Ga0081455_10120254 | |||
| 851 | Ga0070717_10005471 | |||
| 852 | Ga0070716_100007136 | |||
| 853 | Ga0070716_100013609 | |||
| 854 | Ga0070712_100008251 | |||
| 855 | Ga0097621_100009661 | |||
| 856 | Ga0097621_100010826 | |||
| 857 | Ga0097621_100042328 | |||
| 858 | Ga0097621_100146121 | |||
| 859 | Ga0068871_100005809 | |||
| 860 | Ga0068871_100008391 | |||
| 861 | Ga0068871_100067624 | |||
| 862 | Ga0068871_100141515 | |||
| 863 | Ga0068871_100292440 | |||
| 864 | Ga0075428_100008721 | |||
| 865 | Ga0075428_100042010 | |||
| 866 | Ga0075428_100064310 | |||
| 867 | Ga0075430_100004227 | |||
| 868 | Ga0075430_100010670 | |||
| 869 | Ga0075430_100013189 | |||
| 870 | Ga0075431_100000938 | |||
| 871 | Ga0075431_100003513 | |||
| 872 | Ga0075431_100110840 | |||
| 873 | Ga0075434_100278847 | |||
| 874 | Ga0075429_100006127 | |||
| 875 | Ga0075429_100033851 | |||
| 876 | Ga0075429_100069100 | |||
| 877 | Ga0075429_100080930 | |||
| 878 | Ga0068865_100001769 | |||
| 879 | Ga0075436_100025431 | |||
| 880 | Ga0097620_100000516 | |||
| 881 | Ga0097620_100006281 | |||
| 882 | Ga0097620_100010529 | |||
| 883 | Ga0097620_100180190 | |||
| 884 | Ga0075435_100180824 | |||
| 885 | Ga0099794_10009412 | |||
| 886 | Ga0099795_10000009 | |||
| 887 | Ga0099795_10021348 | |||
| 888 | Ga0111539_10000754 | |||
| 889 | Ga0111539_10004469 | |||
| 890 | Ga0111539_10083228 | |||
| 891 | Ga0111539_10131098 | |||
| 892 | Ga0105247_10000162 | |||
| 893 | Ga0105247_10024069 | |||
| 894 | Ga0114129_10002722 | |||
| 895 | Ga0114129_10004060 | |||
| 896 | Ga0105248_10006659 | |||
| 897 | Ga0105248_10015627 | |||
| 898 | Ga0105248_10124091 | |||
| 899 | Ga0105248_10154646 | |||
| 900 | Ga0105248_10203330 | |||
| 901 | Ga0105248_10309854 | |||
| 902 | Ga0105248_10415998 | |||
| 903 | Ga0105237_10041330 | |||
| 904 | Ga0105237_10214497 | |||
| 905 | Ga0105238_10000186 | |||
| 906 | Ga0105249_10008111 | |||
| 907 | Ga0105249_10011434 | |||
| 908 | Ga0105249_10018723 | |||
| 909 | Ga0105249_10054552 | |||
| 910 | Ga0105249_10163245 | |||
| 911 | Ga0105249_10195454 | |||
| 912 | Ga0099796_10000005 | |||
| 913 | Ga0099796_10035391 | |||
| 914 | Ga0157373_10008960 | |||
| 915 | Ga0157371_10038238 | |||
| 916 | Ga0157369_10486645 | |||
| 917 | Ga0157374_10003005 | |||
| 918 | Ga0157374_10008154 | |||
| 919 | Ga0157378_10084447 | |||
| 920 | Ga0157378_10324092 | |||
| 921 | Ga0163162_10000030 | |||
| 922 | Ga0163162_10000209 | |||
| 923 | Ga0163162_10011280 | |||
| 924 | Ga0163162_10094815 | |||
| 925 | Ga0163162_10390065 | |||
| 926 | Ga0157372_10024873 | |||
| 927 | Ga0157375_10034088 | |||
| 928 | Ga0157375_10047103 | |||
| 929 | Ga0157375_10090831 | |||
| 930 | Ga0163163_10010139 | |||
| 931 | Ga0163163_10015972 | |||
| 932 | Ga0163163_10019417 | |||
| 933 | Ga0163163_10212785 | |||
| 934 | Ga0157380_10001792 | |||
| 935 | Ga0157380_10108505 | |||
| 936 | Ga0157377_10007254 | |||
| 937 | Ga0157379_10004317 | |||
| 938 | Ga0157379_10010816 | |||
| 939 | Ga0157379_10018910 | |||
| 940 | Ga0157379_10256642 | |||
| 941 | Ga0157376_10006288 | |||
| 942 | Ga0157376_10028517 | |||
| 943 | Ga0213872_10001252 | |||
| 944 | Ga0213874_10029524 | |||
| 945 | Ga0207427_100046 | |||
| 946 | Ga0209233_1030298 | |||
| 947 | Ga0207642_10078038 | |||
| 948 | Ga0207710_10000707 | |||
| 949 | Ga0207688_10031059 | |||
| 950 | Ga0207680_10036951 | |||
| 951 | Ga0207680_10048147 | |||
| 952 | Ga0207645_10065087 | |||
| 953 | Ga0207645_10067590 | |||
| 954 | Ga0207643_10020779 | |||
| 955 | Ga0207643_10031512 | |||
| 956 | Ga0207684_10077319 | |||
| 957 | Ga0207684_10108362 | |||
| 958 | Ga0207654_10179816 | |||
| 959 | Ga0207707_10005971 | |||
| 960 | Ga0207707_10275950 | |||
| 961 | Ga0207707_10280175 | |||
| 962 | Ga0207695_10009682 | |||
| 963 | Ga0207693_10000144 | |||
| 964 | Ga0207663_10182398 | |||
| 965 | Ga0207660_10030350 | |||
| 966 | Ga0207660_10074436 | |||
| 967 | Ga0207662_10007327 | |||
| 968 | Ga0207657_10061362 | |||
| 969 | Ga0207649_10013525 | |||
| 970 | Ga0207649_10016806 | |||
| 971 | Ga0207649_10118799 | |||
| 972 | Ga0207652_10024576 | |||
| 973 | Ga0207652_10031398 | |||
| 974 | Ga0207652_10041222 | |||
| 975 | Ga0207646_10051931 | |||
| 976 | Ga0207646_10111591 | |||
| 977 | Ga0207681_10031564 | |||
| 978 | Ga0207681_10061669 | |||
| 979 | Ga0207694_10000559 | |||
| 980 | Ga0207659_10016801 | |||
| 981 | Ga0207659_10041704 | |||
| 982 | Ga0207659_10068348 | |||
| 983 | Ga0207687_10017298 | |||
| 984 | Ga0207687_10222742 | |||
| 985 | Ga0207700_10008963 | |||
| 986 | Ga0207700_10025793 | |||
| 987 | Ga0207644_10004411 | |||
| 988 | Ga0207644_10009861 | |||
| 989 | Ga0207644_10018159 | |||
| 990 | Ga0207644_10100845 | |||
| 991 | Ga0207690_10013171 | |||
| 992 | Ga0207706_10066453 | |||
| 993 | Ga0207670_10001481 | |||
| 994 | Ga0207665_10030452 | |||
| 995 | Ga0207665_10075779 | |||
| 996 | Ga0207691_10009445 | |||
| 997 | Ga0207691_10027929 | |||
| 998 | Ga0207691_10030778 | |||
| 999 | Ga0207691_10115292 | |||
| 1000 | Ga0207691_10124166 | |||
| 1001 | Ga0207691_10135759 | |||
| 1002 | Ga0207691_10150581 | |||
| 1003 | Ga0207711_10111893 | |||
| 1004 | Ga0207711_10258021 | |||
| 1005 | Ga0207711_10292261 | |||
| 1006 | Ga0207689_10006430 | |||
| 1007 | Ga0207689_10039825 | |||
| 1008 | Ga0207661_10063113 | |||
| 1009 | Ga0207661_10138206 | |||
| 1010 | Ga0207679_10000656 | |||
| 1011 | Ga0207679_10026750 | |||
| 1012 | Ga0207667_10074127 | |||
| 1013 | Ga0207651_10024727 | |||
| 1014 | Ga0207651_10054500 | |||
| 1015 | Ga0207668_10001362 | |||
| 1016 | Ga0207668_10079346 | |||
| 1017 | Ga0207668_10235136 | |||
| 1018 | Ga0207668_10267108 | |||
| 1019 | Ga0207658_10017712 | |||
| 1020 | Ga0207658_10029653 | |||
| 1021 | Ga0207658_10064158 | |||
| 1022 | Ga0207703_10000546 | |||
| 1023 | Ga0207703_10004632 | |||
| 1024 | Ga0207703_10021376 | |||
| 1025 | Ga0207703_10268590 | |||
| 1026 | Ga0207678_10132972 | |||
| 1027 | Ga0207708_10007528 | |||
| 1028 | Ga0207702_10069830 | |||
| 1029 | Ga0207641_10007700 | |||
| 1030 | Ga0207641_10023323 | |||
| 1031 | Ga0207641_10132158 | |||
| 1032 | Ga0207641_10160586 | |||
| 1033 | Ga0207641_10248499 | |||
| 1034 | Ga0207648_10009986 | |||
| 1035 | Ga0207648_10026881 | |||
| 1036 | Ga0207676_10000864 | |||
| 1037 | Ga0207676_10001384 | |||
| 1038 | Ga0207676_10176067 | |||
| 1039 | Ga0207674_10011342 | |||
| 1040 | Ga0207674_10106888 | |||
| 1041 | Ga0207674_10151355 | |||
| 1042 | Ga0207675_100004089 | |||
| 1043 | Ga0207675_100009531 | |||
| 1044 | Ga0207683_10016234 | |||
| 1045 | Ga0207683_10025557 | |||
| 1046 | Ga0207683_10071385 | |||
| 1047 | Ga0207683_10087371 | |||
| 1048 | Ga0207683_10147076 | |||
| 1049 | Ga0207698_10047853 | |||
| 1050 | Ga0209179_1000052 | |||
| 1051 | Ga0209966_1002482 | |||
| 1052 | Ga0209974_10000870 | |||
| 1053 | Ga0207428_10004195 | |||
| 1054 | Ga0207428_10008986 | |||
| 1055 | Ga0207428_10051616 | |||
| 1056 | Ga0268266_10000043 | |||
| 1057 | Ga0268266_10044291 | |||
| 1058 | Ga0268265_10002952 | |||
| 1059 | Ga0268264_10021851 | |||
| 1060 | Ga0268264_10046144 | |||
| 1061 | Ga0268264_10238939 | |||
| 1062 | Ga0265334_10001821 | |||
| 1063 | Ga0265318_10001878 | |||
| 1064 | Ga0265338_10153805 | |||
| 1065 | Ga0265338_10156928 | |||
| 1066 | Ga0265338_10245175 | |||
| 1067 | Ga0265760_10001504 | |||
| 1068 | Ga0265330_10004512 | |||
| 1069 | Ga0265330_10038550 | |||
| 1070 | Ga0265332_10004622 | |||
| 1071 | Ga0265332_10014065 | |||
| 1072 | Ga0265328_10012826 | |||
| 1073 | Ga0265320_10003581 | |||
| 1074 | Ga0265329_10003460 | |||
| 1075 | Ga0265340_10039675 | |||
| 1076 | Ga0265331_10002032 | |||
| 1077 | Ga0265327_10010305 | |||
| 1078 | Ga0307513_10010867 | |||
| 1079 | Ga0307513_10011072 | |||
| 1080 | Ga0307513_10026046 | |||
| 1081 | Ga0307513_10030077 | |||
| 1082 | Ga0307509_10001782 | |||
| 1083 | Ga0307509_10289607 | |||
| 1084 | Ga0307408_100000511 | |||
| 1085 | Ga0307408_100169267 | |||
| 1086 | Ga0307408_100173500 | |||
| 1087 | Ga0316575_10005276 | |||
| 1088 | Ga0265314_10005027 | |||
| 1089 | Ga0316576_10038287 | |||
| 1090 | Ga0307413_10123106 | |||
| 1091 | Ga0307410_10228569 | |||
| 1092 | Ga0307406_10212875 | |||
| 1093 | Ga0307407_10000861 | |||
| 1094 | Ga0307412_10196598 | |||
| 1095 | Ga0307409_100006680 | |||
| 1096 | Ga0307409_100007504 | |||
| 1097 | Ga0307409_100189599 | |||
| 1098 | Ga0307416_100072983 | |||
| 1099 | Ga0307416_100098106 | |||
| 1100 | Ga0307414_10162023 | |||
| 1101 | Ga0307411_10007609 | |||
| 1102 | Ga0307411_10086000 | |||
| 1103 | Ga0307411_10135426 | |||
| 1104 | Ga0316574_0038377 | |||
| 1105 | Ga0316574_0186885 | |||
| 1106 | Ga0373935_0212850 | |||
| 1107 | Ga0373933_0000488 | |||
| 1108 | Ga0373933_0098308 | |||
| 1109 | Ga0373947_0114603 | |||
| 1110 | Ga0373937_0000468 | |||
| 1111 | Ga0373937_0002951 | |||
| 1112 | Ga0373937_0008737 | |||
| 1113 | Ga0316582_0117486 | |||
| 1114 | Ga0316584_0194111 | |||
| 1115 | Ga0395900_0121443 | |||
| 1116 | Ga0395900_0159978 | |||
| 1117 | Ga0436364_1490639 | |||
| 1118 | Ga0395901_0031195 | |||
| 1119 | Ga0395901_0142689 | |||
| 1120 | Ga0400485_20853 | |||
| 1121 | Ga0400483_079008 | |||
| 1122 | Ga0400483_158383 | |||
| 1123 | Ga0436365_0351645 | |||
| 1124 | Ga0436365_0484474 | |||
| 1125 | Ga0436361_0141670 | |||
| 1126 | Ga0436363_0008955 | |||
| 1127 | Ga0436363_1449045 | |||
| 1128 | Ga0439463_034743 | |||
| 1129 | Ga0450923_005677 | |||
| 1130 | Ga0439435_0004369 | |||
| 1131 | Ga0450916_002402 | |||
| 1132 | Ga0451577_0009030 | |||
| 1133 | Ga0451577_0123583 | |||
| 1134 | Ga0466969_0000641 | |||
| 1135 | Ga0466982_0000008 | |||
| 1136 | Ga0466966_0001146 | |||
| 1137 | Ga0466961_0002065 | |||
| 1138 | Ga0466964_0000651 | |||
| 1139 | Ga0466971_0000248 | |||
| 1140 | Ga0466968_0006719 | |||
| 1141 | Ga0466970_0000992 | |||
| 1142 | Ga0466957_0001315 | |||
| 1143 | Ga0466960_0110202 | |||
| 1144 | Ga0466959_0000450 | |||
| 1145 | Ga0495592_0137368 | |||
| 1146 | Ga0495603_0001733 | |||
| 1147 | Ga0495590_0014704 | |||
| 1148 | Ga0495591_000575 | |||
| 1149 | Ga0495629_0004592 | |||
| 1150 | Ga0495629_0007566 | |||
| 1151 | Ga0495638_0000009 | |||
| 1152 | Ga0495638_0000019 | |||
| 1153 | Ga0495638_0026533 | |||
| 1154 | Ga0495641_0004767 | |||
| 1155 | Ga0495651_0004026 | |||
| 1156 | Ga0495651_0041499 | |||
| 1157 | Ga0495651_0075664 | |||
| 1158 | Ga0495650_0023496 | |||
| 1159 | Ga0495580_0000001 | |||
| 1160 | Ga0495580_0038710 | |||
| 1161 | Ga0495580_0065981 | |||
| 1162 | Ga0495580_0098080 | |||
| 1163 | Ga0495582_0070282 | |||
| 1164 | Ga0495605_0016541 | |||
| 1165 | Ga0495664_0000164 | |||
| 1166 | Ga0495664_0032098 | |||
| 1167 | Ga0495664_0160999 | |||
| 1168 | Ga0495594_0075216 | |||
| 1169 | Ga0495594_0102326 | |||
| 1170 | Ga0495596_0028068 | |||
| 1171 | Ga0495583_0000789 | |||
| 1172 | Ga0495606_0021160 | |||
| 1173 | Ga0495606_0034610 | |||
| 1174 | Ga0495608_0056897 | |||
| 1175 | Ga0495608_0063710 | |||
| 1176 | Ga0495608_0190206 | |||
| 1177 | Ga0495616_0006800 | |||
| 1178 | Ga0495616_0067916 | |||
| 1179 | Ga0495618_0003150 | |||
| 1180 | Ga0495618_0046853 | |||
| 1181 | Ga0495618_0129568 | |||
| 1182 | Ga0495628_0000262 | |||
| 1183 | Ga0495628_0045325 | |||
| 1184 | Ga0495628_0053645 | |||
| 1185 | Ga0495628_0210389 | |||
| 1186 | Ga0495628_0288211 | |||
| 1187 | Ga0495630_0012400 | |||
| 1188 | Ga0495630_0017162 | |||
| 1189 | Ga0495630_0041217 | |||
| 1190 | Ga0495648_0002441 | |||
| 1191 | Ga0495648_0022885 | |||
| 1192 | Ga0495648_0029414 | |||
| 1193 | Ga0495666_0002792 | |||
| 1194 | Ga0495666_0002993 | |||
| 1195 | Ga0495666_0040785 | |||
| 1196 | Ga0495652_0009937 | |||
| 1197 | Ga0495665_0002661 | |||
| 1198 | Ga0495640_0007335 | |||
| 1199 | Ga0495640_0013736 | |||
| 1200 | Ga0495640_0080936 | |||
| 1201 | Ga0495586_0000531 | |||
| 1202 | Ga0495587_0000061 | |||
| 1203 | Ga0495587_0018149 | |||
| 1204 | Ga0495587_0046374 | |||
| 1205 | Ga0495598_0002515 | |||
| 1206 | Ga0495621_0004199 | |||
| 1207 | Ga0495645_0005913 | |||
| 1208 | Ga0495645_0039515 | |||
| 1209 | Ga0495645_0138980 | |||
| 1210 | Ga0495622_0000111 | |||
| 1211 | Ga0495667_0084255 | |||
| 1212 | Ga0495667_0095961 | |||
| 1213 | Ga0495656_0132704 | |||
| 1214 | Ga0495634_0005907 | |||
| 1215 | Ga0495634_0013358 | |||
| 1216 | Ga0495611_0088210 | |||
| 1217 | Ga0495625_0212135 | |||
| 1218 | Ga0495635_0001720 | |||
| 1219 | Ga0495635_0007054 | |||
| 1220 | Ga0495661_0000792 | |||
| 1221 | Ga0495661_0034993 | |||
| 1222 | Ga0495657_0087203 | |||
| 1223 | Ga0495599_0036013 | |||
| 1224 | Ga0495599_0036579 | |||
| 1225 | Ga0495599_0039891 | |||
| 1226 | Ga0495599_0124257 | |||
| 1227 | Ga0495623_0013862 | |||
| 1228 | Ga0495623_0017621 | |||
| 1229 | Ga0495623_0087503 | |||
| 1230 | Ga0495646_0026823 | |||
| 1231 | Ga0495658_0003311 | |||
| 1232 | Ga0495658_0102904 | |||
| 1233 | Ga0495613_0004454 | |||
| 1234 | Ga0495613_0005409 | |||
| 1235 | Ga0495613_0089376 | |||
| 1236 | Ga0495613_0106251 | |||
| 1237 | Ga0495624_0002796 | |||
| 1238 | Ga0495671_0018759 | |||
| 1239 | Ga0495649_0004038 | |||
| 1240 | Ga0495649_0005395 | |||
| 1241 | Ga0495589_0036444 | |||
| 1242 | Ga0495600_0016311 | |||
| 1243 | Ga0495581_0031327 | |||
| 1244 | Ga0495581_0033226 | |||
| 1245 | Ga0495604_0008440 | |||
| 1246 | Ga0495604_0011493 | |||
| 1247 | Ga0495604_0071002 | |||
| 1248 | Ga0495674_0022704 | |||
| 1249 | Ga0495674_0044943 | |||
| 1250 | Ga0495674_0054798 | |||
| 1251 | Ga0495674_0096533 | |||
| 1252 | Ga0495672_0005551 | |||
| 1253 | Ga0495676_0010162 | |||
| 1254 | Ga0495676_0033442 | |||
| 1255 | Ga0495680_0001809 | |||
| 1256 | Ga0495680_0006202 | |||
| 1257 | Ga0495680_0049254 | |||
| 1258 | Ga0495680_0063040 | |||
| 1259 | Ga0495683_0001051 | |||
| 1260 | Ga0495683_0003350 | |||
| 1261 | Ga0495675_0001861 | |||
| 1262 | Ga0495675_0049285 | |||
| 1263 | Ga0495675_0094363 | |||
| 1264 | Ga0495679_011230 | |||
| 1265 | Ga0495679_021580 | |||
| 1266 | Ga0495673_0012859 | |||
| 1267 | Ga0495684_0102432 | |||
| 1268 | Ga0495593_0001562 | |||
| 1269 | Ga0495593_0025776 | |||
| 1270 | Ga0495602_0000053 | |||
| 1271 | Ga0495602_0074019 | |||
| 1272 | Ga0495614_0000057 | |||
| 1273 | Ga0495614_0016739 | |||
| 1274 | Ga0495626_0000532 | |||
| 1275 | Ga0496100_0013096 | |||
| 1276 | Ga0496101_0005358 | |||
| 1277 | Ga0496102_0005056 | |||
| 1278 | Ga0496102_0043481 | |||
| 1279 | Ga0496102_0133326 | |||
| 1280 | Ga0496104_0031783 | |||
| 1281 | Ga0496104_0218283 | |||
| 1282 | Ga0496104_0243472 | |||
| 1283 | Ga0496105_0112275 | |||
| 1284 | Ga0496105_0136530 | |||
| 1285 | Ga0496106_0000026 | |||
| 1286 | Ga0496106_0053352 | |||
| 1287 | Ga0496106_0133235 | |||
| 1288 | Ga0496107_0047750 | |||
| 1289 | Ga0496107_0129639 | |||
| 1290 | Ga0496108_0090486 | |||
| 1291 | Ga0496108_0123685 | |||
| 1292 | Ga0496109_0052994 | |||
| 1293 | Ga0496109_0188625 | |||
| 1294 | Ga0496110_0020733 | |||
| 1295 | Ga0496111_0018841 | |||
| 1296 | Ga0496112_0047670 | |||
| 1297 | Ga0496112_0165033 | |||
| 1298 | Ga0496113_0386412 | |||
| 1299 | Ga0496114_0184882 | |||
| 1300 | Ga0496115_0013593 | |||
| 1301 | Ga0496115_0028641 | |||
| 1302 | Ga0496116_0017445 | |||
| 1303 | Ga0496117_0001069 | |||
| 1304 | Ga0496118_0003050 | |||
| 1305 | Ga0496118_0013994 | |||
| 1306 | Ga0496118_0019928 | |||
| 1307 | Ga0496118_0047114 | |||
| 1308 | Ga0496121_0000791 | |||
| 1309 | Ga0496121_0001380 | |||
| 1310 | Ga0496121_0041380 | |||
| 1311 | Ga0496124_0028070 | |||
| 1312 | Ga0496125_0009370 | |||
| 1313 | Ga0496126_0000242 | |||
| 1314 | Ga0496126_0000798 | |||
| 1315 | Ga0496126_0044674 | |||
| 1316 | Ga0495678_057885 | |||
| 1317 | Ga0495678_060709 | |||
| 1318 | Ga0495682_0009167 | |||
| 1319 | Ga0495682_0017422 | |||
| 1320 | Ga0501031_0003012 | |||
| 1321 | Ga0501032_0045587 | |||
| 1322 | Ga0501032_0122025 | |||
| 1323 | Ga0501033_0000770 | |||
| 1324 | Ga0501034_0016377 | |||
| 1325 | Ga0501034_0186382 | |||
| 1326 | Ga0501036_0011136 | |||
| 1327 | Ga0501036_0028908 | |||
| 1328 | Ga0501036_0291211 | |||
| 1329 | Ga0501037_0002991 | |||
| 1330 | Ga0501037_0094453 | |||
| 1331 | Ga0501037_0104244 | |||
| 1332 | Ga0501038_0011113 | |||
| 1333 | Ga0501038_0060892 | |||
| 1334 | Ga0501038_0119409 | |||
| 1335 | Ga0501039_0044766 | |||
| 1336 | Ga0501039_0092941 | |||
| 1337 | Ga0501039_0151688 | |||
| 1338 | Ga0501040_0005878 | |||
| 1339 | Ga0501040_0008195 | |||
| 1340 | Ga0501040_0058241 | |||
| 1341 | Ga0501041_0011412 | |||
| 1342 | Ga0501042_0004636 | |||
| 1343 | Ga0501042_0047222 | |||
| 1344 | Ga0501043_0004167 | |||
| 1345 | Ga0501043_0244795 | |||
| 1346 | Ga0501046_0028495 | |||
| 1347 | Ga0501046_0180742 | |||
| 1348 | Ga0501047_0013149 | |||
| 1349 | Ga0501047_0293215 | |||
| 1350 | Ga0501048_0090271 | |||
| 1351 | Ga0501067_0001150 | |||
| 1352 | Ga0501067_0039547 | |||
| 1353 | Ga0501068_0018290 | |||
| 1354 | Ga0501068_0090790 | |||
| 1355 | Ga0501068_0199487 | |||
| 1356 | Ga0501070_0076177 | |||
| 1357 | Ga0501071_0037530 | |||
| 1358 | Ga0501071_0042205 | |||
| 1359 | Ga0501071_0158831 | |||
| 1360 | Ga0501073_0005778 | |||
| 1361 | Ga0501073_0039494 | |||
| 1362 | Ga0501074_0019863 | |||
| 1363 | Ga0501074_0152806 | |||
| 1364 | Ga0501074_0216121 | |||
| 1365 | Ga0501075_0000841 | |||
| 1366 | Ga0501075_0002728 | |||
| 1367 | Ga0501076_0000166 | |||
| 1368 | Ga0501076_0006224 | |||
| 1369 | Ga0501076_0104450 | |||
| 1370 | Ga0501076_0282816 | |||
| 1371 | Ga0501207_000511 | |||
| 1372 | Ga0501261_005958 | |||
| 1373 | Ga0501079_0012922 | |||
| 1374 | Ga0501079_0029434 | |||
| 1375 | Ga0501079_0125298 | |||
| 1376 | Ga0501080_0024975 | |||
| 1377 | Ga0501080_0031712 | |||
| 1378 | Ga0501080_0109492 | |||
| 1379 | Ga0501080_0162257 | |||
| 1380 | Ga0501081_0104493 | |||
| 1381 | Ga0501035_0008948 | |||
| 1382 | Ga0501035_0060438 | |||
| 1383 | Ga0501044_0000396 | |||
| 1384 | Ga0501044_0133588 | |||
| 1385 | Ga0501045_0090883 | |||
| 1386 | nmdc:mga05p37_16198_c1 | |||
| 1387 | nmdc:mga05p37_16472_c1 | |||
| 1388 | nmdc:mga09592_2620_c1 | |||
| 1389 | nmdc:mga09592_5028_c1 | |||
| 1390 | nmdc:mga09592_65910_c1 | |||
| 1391 | nmdc:mga09592_92914_c1 | |||
| 1392 | nmdc:mga0qj67_15475_c1 | |||
| 1393 | nmdc:mga0qj67_193338_c1 | |||
| 1394 | nmdc:mga0qj67_24238_c1 | |||
| 1395 | nmdc:mga0qj67_48604_c1 | |||
| 1396 | nmdc:mga06r32_1870_c1 | |||
| 1397 | nmdc:mga06r32_31492_c1 | |||
| 1398 | nmdc:mga06r32_565_c1 | |||
| 1399 | nmdc:mga08y16_194376_c1 | |||
| 1400 | nmdc:mga08y16_418371_c1 | |||
| 1401 | nmdc:mga08y16_4678_c1 | |||
| 1402 | nmdc:mga08y16_6258_c1 | |||
| 1403 | nmdc:mga08y16_9872_c1 | |||
| 1404 | nmdc:mga0rr50_167207_c1 | |||
| 1405 | nmdc:mga0a205_267875_c1 | |||
| 1406 | Ga0495612_0055481 | |||
| 1407 | Ga0500647_0121747 | |||
| 1408 | Ga0500588_0024178 | |||
| 1409 | Ga0500622_0015771 | |||
| 1410 | Ga0500630_043249 | |||
| 1411 | Ga0501084_0034161 | |||
| 1412 | Ga0501082_0004974 | |||
| 1413 | Ga0501082_0052825 | |||
| 1414 | Ga0501082_0486176 | |||
| 1415 | Ga0530510_0000956 | |||
| 1416 | Ga0530510_0136877 | |||
| 1417 | 2510248851 | |||
| 1418 | 2600813321 | |||
| 1419 | 2719642725 | |||
| 1420 | 2723876596 | |||
| 1421 | 2857359359 | |||
| 1422 | 2913846382 | |||
| 1423 | 2952254826 | |||
| 1424 | 8055307711 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6czz-assembly2.cif.gz_C | crystal structure of arabidopsis thaliana phosphoserine aminotransferase isoform 1 (atpsat1) in complex with plp-phosphoserine geminal diamine intermediate | 0.9847 | 2 | 360 |
| 4xk1-assembly1.cif.gz_B | crystal structure of a phosphoserine/phosphohydroxythreonine aminotransferase (psat) from pseudomonas aeruginosa with cofactor pyridoxal phosphate and bound glutamate | 0.9844 | 5 | 350 |
| 2bi5-assembly1.cif.gz_B | radiation damage of the schiff base in phosphoserine aminotransferase (structure e) | 0.9815 | 2 | 358 |
| 6xdk-assembly2.cif.gz_C | crystal structure of phosphoserine aminotransferase (serc) from stenotrophomonas maltophilia k279a | 0.9808 | 3 | 360 |
| 2bi2-assembly1.cif.gz_A | radiation damage of the schiff base in phosphoserine aminotransferase (structure c) | 0.9796 | 1 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55CQ6_268_374_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9859 | 264 | 360 | 3.90.1150.10 |
| 3qm2B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9847 | 257 | 360 | 3.90.1150.10 |
| af_I1J8D7_67_308_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9819 | 16 | 254 | 3.40.640.10 |
| 2bi2B01 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9776 | 18 | 255 | 3.40.640.10 |
| 3m5uB02 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9763 | 264 | 360 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D1XR54-F1-model_v4 | Phosphoserine aminotransferase (Phosphohydroxythreonine aminotransferase) | 0.994 | 246 | 360 |
GO:0004648
GO:0005737 GO:0006564 GO:0030170 |
| AF-A0A522QFA9-F1-model_v4 | Phosphoserine aminotransferase (Phosphohydroxythreonine aminotransferase) | 0.9938 | 244 | 360 |
GO:0004648
GO:0005737 GO:0006564 GO:0008615 GO:0030170 |
| AF-A0A349SPC0-F1-model_v4 | Phosphoserine aminotransferase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) | 0.9932 | 143 | 360 |
GO:0004648
GO:0005737 GO:0006564 GO:0008615 GO:0030170 |
| AF-A0A520WZI6-F1-model_v4 | Phosphoserine aminotransferase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) | 0.9917 | 164 | 360 |
GO:0004648
GO:0005737 GO:0006564 GO:0008615 GO:0030170 |
| AF-A0A7Z6UN64-F1-model_v4 | Phosphoserine aminotransferase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) (PSAT) | 0.9916 | 2 | 360 |
GO:0004648
GO:0005737 GO:0006564 GO:0008615 GO:0030170 |