F476853

General Info

Members Datasets Scaffolds Average Seq Length
712 359 1424 360

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0004257|Ga0495580_0004257_5523_6725
Length 400
Sequence MSRASLPQSHRRKRSNAAHHRVAKILSVPRWCLDDPEEVLVRVFNFAAGPATLPLQVLEQARDELTDWQACGMSVMEVSHRSGAFVAAARAAESRLRELLRVPPNYKVLFLQGGATGQFAAIPLNLASADARADYLNTGAWSKKAIAEARRFLAHVNVAADESATKYTTVPAAGSLRLDPAAAYLHYTANETIGGVEFPYVPDSGAVPLVADMSSSILSRPMPVEKFGLIYGGAQKNIGPAGLVVVIVREELLGRARPGTPSVWDYRAMAAEDSMLNTPPTFALYLAGLVFKWLQEQGGLPVIAARNEAKARALYEAIDGSGFYRNPVDKGCRSWMNVPFTLADPALDPLFLSAARAAGLVNLEGHRSVGGMRASLYNAMPPEGVAALVAFMREFERRHG

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
197 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
202 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
203 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
204 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
207 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
227 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
246 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
247 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
248 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
249 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
250 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
253 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
256 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
276 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
305 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
322 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
326 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
330 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
345 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
346 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
347 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
348 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
349 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
352 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
353 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
354 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
355 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
356 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
357 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
358 2952252522 Salinicola sp. DM10 Isolate Unclassified
359 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 0.14
Isolates 1.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0.42
Rhizoplane 3.79
Rhizosphere 89.75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0004257 3300046472 Bacteria 12040
2 JGI24735J21928_10000266 3300002067 Bacteria 18276
3 rootL2_10129855 3300003322 Bacteria 1509
4 rootL2_10159372 3300003322 Bacteria 3307
5 rootL2_10248547 3300003322 Bacteria 2187
6 rootH1_10123237 3300003323 Bacteria 5114
7 Ga0065712_10069600 3300005290 Bacteria 7002
8 Ga0070658_10079844 3300005327 Bacteria 2687
9 Ga0070676_10046023 3300005328 Bacteria 2543
10 Ga0070676_10057120 3300005328 Bacteria 2309
11 Ga0070676_10138263 3300005328 Bacteria 1548
12 Ga0070683_100114781 3300005329 Bacteria 2542
13 Ga0070690_100000848 3300005330 Bacteria 15510
14 Ga0070690_100009935 3300005330 Bacteria 5523
15 Ga0070690_100038140 3300005330 Bacteria 3030
16 Ga0070670_100027595 3300005331 Bacteria 4884
17 Ga0070670_100244684 3300005331 Bacteria 1562
18 Ga0068869_100012483 3300005334 Bacteria 5617
19 Ga0068869_100030598 3300005334 Bacteria 3780
20 Ga0070666_10000003 3300005335 Bacteria 463666
21 Ga0070666_10010881 3300005335 Bacteria 5700
22 Ga0070666_10022849 3300005335 Bacteria 4065
23 Ga0070666_10057652 3300005335 Bacteria 2625
24 Ga0070666_10132764 3300005335 Bacteria 1731
25 Ga0070680_100080675 3300005336 Bacteria 2683
26 Ga0070682_100005019 3300005337 Bacteria 7355
27 Ga0070682_100029235 3300005337 Bacteria 3317
28 Ga0068868_100087361 3300005338 Bacteria 2507
29 Ga0068868_100440880 3300005338 Bacteria 1131
30 Ga0070660_100142379 3300005339 Bacteria 1924
31 Ga0070689_100000509 3300005340 Bacteria 22964
32 Ga0070687_100005790 3300005343 Bacteria 5021
33 Ga0070661_100004656 3300005344 Bacteria 9448
34 Ga0070661_100029043 3300005344 Bacteria 3990
35 Ga0070661_100094116 3300005344 Bacteria 2220
36 Ga0070669_100087836 3300005353 Bacteria 2325
37 Ga0070669_100140934 3300005353 Bacteria 1859
38 Ga0070669_100221865 3300005353 Bacteria 1495
39 Ga0070675_100000139 3300005354 Bacteria 43853
40 Ga0070675_100001593 3300005354 Bacteria 16753
41 Ga0070675_100027333 3300005354 Bacteria 4583
42 Ga0070675_100034288 3300005354 Bacteria 4118
43 Ga0070675_100191308 3300005354 Bacteria 1773
44 Ga0070671_100039510 3300005355 Bacteria 3917
45 Ga0070673_100137301 3300005364 Bacteria 2059
46 Ga0070659_100168580 3300005366 Bacteria 1792
47 Ga0070667_100014812 3300005367 Bacteria 6442
48 Ga0070667_100016792 3300005367 Bacteria 6056
49 Ga0070667_100057804 3300005367 Bacteria 3279
50 Ga0070714_100016325 3300005435 Bacteria 5992
51 Ga0070713_100005046 3300005436 Bacteria 8976
52 Ga0070701_10003283 3300005438 Bacteria 6371
53 Ga0070711_100002829 3300005439 Bacteria 9967
54 Ga0070711_100057627 3300005439 Bacteria 2691
55 Ga0070705_100188032 3300005440 Bacteria 1405
56 Ga0070700_100013817 3300005441 Bacteria 4543
57 Ga0070700_100040893 3300005441 Bacteria 2840
58 Ga0070708_100001467 3300005445 Bacteria 17995
59 Ga0070678_100007056 3300005456 Bacteria 6640
60 Ga0070678_100010070 3300005456 Bacteria 5754
61 Ga0070678_100043335 3300005456 Bacteria 3204
62 Ga0070678_100047034 3300005456 Bacteria 3098
63 Ga0070678_100113076 3300005456 Bacteria 2127
64 Ga0070662_100009759 3300005457 Bacteria 6285
65 Ga0070662_100031349 3300005457 Bacteria 3730
66 Ga0070662_100073743 3300005457 Bacteria 2522
67 Ga0070681_10010257 3300005458 Bacteria 9245
68 Ga0070681_10032569 3300005458 Bacteria 5232
69 Ga0070681_10058997 3300005458 Bacteria 3817
70 Ga0068867_100074585 3300005459 Bacteria 2543
71 Ga0070685_10015076 3300005466 Bacteria 4103
72 Ga0070706_100117637 3300005467 Bacteria 2476
73 Ga0070707_100059423 3300005468 Bacteria 3668
74 Ga0070707_100141774 3300005468 Bacteria 2339
75 Ga0070679_100030388 3300005530 Bacteria 5334
76 Ga0070679_100045058 3300005530 Bacteria 4395
77 Ga0070679_100071762 3300005530 Bacteria 3454
78 Ga0070679_100096553 3300005530 Bacteria 2943
79 Ga0070679_100463431 3300005530 Bacteria 1212
80 Ga0070684_100014149 3300005535 Bacteria 6453
81 Ga0070684_100016613 3300005535 Bacteria 6019
82 Ga0070684_100043697 3300005535 Bacteria 3871
83 Ga0070684_100151984 3300005535 Bacteria 2097
84 Ga0070672_100038359 3300005543 Bacteria 3660
85 Ga0070672_100106049 3300005543 Bacteria 2285
86 Ga0070686_100001361 3300005544 Bacteria 13833
87 Ga0070695_100054714 3300005545 Bacteria 2569
88 Ga0070695_100203548 3300005545 Bacteria 1416
89 Ga0070665_100003952 3300005548 Bacteria 15632
90 Ga0070665_100011103 3300005548 Bacteria 9100
91 Ga0070665_100015433 3300005548 Bacteria 7671
92 Ga0070665_100026593 3300005548 Bacteria 5826
93 Ga0070665_100033938 3300005548 Bacteria 5133
94 Ga0070704_100239109 3300005549 Bacteria 1485
95 Ga0068855_100014165 3300005563 Bacteria 9607
96 Ga0068855_100128321 3300005563 Bacteria 2898
97 Ga0068855_100131836 3300005563 Bacteria 2854
98 Ga0070664_100000585 3300005564 Bacteria 27773
99 Ga0070664_100006952 3300005564 Bacteria 9120
100 Ga0070664_100215971 3300005564 Bacteria 1715
101 Ga0070664_100283404 3300005564 Bacteria 1494
102 Ga0068857_100104059 3300005577 Bacteria 2549
103 Ga0068857_100186515 3300005577 Bacteria 1888
104 Ga0068856_100015327 3300005614 Bacteria 7407
105 Ga0070702_100001168 3300005615 Bacteria 10569
106 Ga0070702_100017086 3300005615 Bacteria 3735
107 Ga0070702_100087223 3300005615 Bacteria 1884
108 Ga0068852_100020679 3300005616 Bacteria 5236
109 Ga0068859_100000516 3300005617 Bacteria 38281
110 Ga0068859_100006281 3300005617 Bacteria 12057
111 Ga0068859_100010529 3300005617 Bacteria 9307
112 Ga0068859_100180195 3300005617 Bacteria 2195
113 Ga0068864_100001046 3300005618 Bacteria 23229
114 Ga0068864_100002556 3300005618 Bacteria 15030
115 Ga0068864_100013383 3300005618 Bacteria 6799
116 Ga0068866_10004732 3300005718 Bacteria 5584
117 Ga0068861_100015785 3300005719 Bacteria 5331
118 Ga0068861_100018595 3300005719 Bacteria 4951
119 Ga0068861_100052102 3300005719 Bacteria 3109
120 Ga0068870_10019427 3300005840 Bacteria 3297
121 Ga0068870_10027886 3300005840 Bacteria 2829
122 Ga0068863_100019332 3300005841 Bacteria 6514
123 Ga0068863_100021414 3300005841 Bacteria 6170
124 Ga0068863_100029477 3300005841 Bacteria 5238
125 Ga0068863_100030863 3300005841 Bacteria 5118
126 Ga0068863_100107519 3300005841 Bacteria 2655
127 Ga0068858_100001604 3300005842 Bacteria 23097
128 Ga0068858_100015946 3300005842 Bacteria 7058
129 Ga0068858_100109882 3300005842 Bacteria 2574
130 Ga0068860_100012232 3300005843 Bacteria 8457
131 Ga0068860_100022411 3300005843 Bacteria 6109
132 Ga0068860_100040982 3300005843 Bacteria 4424
133 Ga0068860_100102820 3300005843 Bacteria 2727
134 Ga0068862_100001537 3300005844 Bacteria 21100
135 Ga0068862_100112008 3300005844 Bacteria 2396
136 Ga0068862_100330390 3300005844 Bacteria 1410
137 Ga0081455_10076519 3300005937 Bacteria 2757
138 Ga0081455_10120254 3300005937 Bacteria 2070
139 Ga0070717_10005471 3300006028 Bacteria 9271
140 Ga0070716_100007136 3300006173 Bacteria 5489
141 Ga0070716_100013609 3300006173 Bacteria 4150
142 Ga0070712_100008251 3300006175 Bacteria 6545
143 Ga0097621_100009661 3300006237 Bacteria 7014
144 Ga0097621_100010826 3300006237 Bacteria 6691
145 Ga0097621_100042328 3300006237 Bacteria 3668
146 Ga0097621_100146121 3300006237 Bacteria 2024
147 Ga0068871_100005809 3300006358 Bacteria 8669
148 Ga0068871_100008391 3300006358 Bacteria 7429
149 Ga0068871_100067624 3300006358 Bacteria 2932
150 Ga0068871_100141515 3300006358 Bacteria 2046
151 Ga0068871_100292440 3300006358 Bacteria 1428
152 Ga0075428_100008721 3300006844 Bacteria 11250
153 Ga0075428_100042010 3300006844 Bacteria 5028
154 Ga0075428_100064310 3300006844 Bacteria 4017
155 Ga0075430_100004227 3300006846 Bacteria 12122
156 Ga0075430_100010670 3300006846 Bacteria 7785
157 Ga0075430_100013189 3300006846 Bacteria 7041
158 Ga0075431_100000938 3300006847 Bacteria 25747
159 Ga0075431_100003513 3300006847 Bacteria 15182
160 Ga0075431_100110840 3300006847 Bacteria 2832
161 Ga0075434_100278847 3300006871 Bacteria 1691
162 Ga0075429_100006127 3300006880 Bacteria 10395
163 Ga0075429_100033851 3300006880 Bacteria 4439
164 Ga0075429_100069100 3300006880 Bacteria 3075
165 Ga0075429_100080930 3300006880 Bacteria 2832
166 Ga0068865_100001769 3300006881 Bacteria 12679
167 Ga0075436_100025431 3300006914 Bacteria 4075
168 Ga0097620_100000516 3300006931 Bacteria 38281
169 Ga0097620_100006281 3300006931 Bacteria 12057
170 Ga0097620_100010529 3300006931 Bacteria 9307
171 Ga0097620_100180190 3300006931 Bacteria 2195
172 Ga0075435_100180824 3300007076 Bacteria 1782
173 Ga0099794_10009412 3300007265 Bacteria 4107
174 Ga0099795_10000009 3300007788 Bacteria 84256
175 Ga0099795_10021348 3300007788 Bacteria 2122
176 Ga0111539_10000754 3300009094 Bacteria 42119
177 Ga0111539_10004469 3300009094 Bacteria 18283
178 Ga0111539_10083228 3300009094 Bacteria 3763
179 Ga0111539_10131098 3300009094 Bacteria 2935
180 Ga0105247_10000162 3300009101 Bacteria 65804
181 Ga0105247_10024069 3300009101 Bacteria 3667
182 Ga0114129_10002722 3300009147 Bacteria 24631
183 Ga0114129_10004060 3300009147 Bacteria 20667
184 Ga0105248_10006659 3300009177 Bacteria 12675
185 Ga0105248_10015627 3300009177 Bacteria 8366
186 Ga0105248_10124091 3300009177 Bacteria 2913
187 Ga0105248_10154646 3300009177 Bacteria 2588
188 Ga0105248_10203330 3300009177 Bacteria 2232
189 Ga0105248_10309854 3300009177 Bacteria 1778
190 Ga0105248_10415998 3300009177 Bacteria 1514
191 Ga0105237_10041330 3300009545 Bacteria 4650
192 Ga0105237_10214497 3300009545 Bacteria 1925
193 Ga0105238_10000186 3300009551 Bacteria 68293
194 Ga0105249_10008111 3300009553 Bacteria 9158
195 Ga0105249_10011434 3300009553 Bacteria 7796
196 Ga0105249_10018723 3300009553 Bacteria 6167
197 Ga0105249_10054552 3300009553 Bacteria 3655
198 Ga0105249_10163245 3300009553 Bacteria 2154
199 Ga0105249_10195454 3300009553 Bacteria 1977
200 Ga0099796_10000005 3300010159 Bacteria 74057
201 Ga0099796_10035391 3300010159 Bacteria 1656
202 Ga0157373_10008960 3300013100 Bacteria 7402
203 Ga0157371_10038238 3300013102 Bacteria 3434
204 Ga0157369_10486645 3300013105 Bacteria 1277
205 Ga0157374_10003005 3300013296 Bacteria 14114
206 Ga0157374_10008154 3300013296 Bacteria 8953
207 Ga0157378_10084447 3300013297 Bacteria 2875
208 Ga0157378_10324092 3300013297 Bacteria 1497
209 Ga0163162_10000030 3300013306 Bacteria 163717
210 Ga0163162_10000209 3300013306 Bacteria 54322
211 Ga0163162_10011280 3300013306 Bacteria 8713
212 Ga0163162_10094815 3300013306 Bacteria 3071
213 Ga0163162_10390065 3300013306 Bacteria 1525
214 Ga0157372_10024873 3300013307 Bacteria 6507
215 Ga0157375_10034088 3300013308 Bacteria 4846
216 Ga0157375_10047103 3300013308 Bacteria 4208
217 Ga0157375_10090831 3300013308 Bacteria 3114
218 Ga0163163_10010139 3300014325 Bacteria 8453
219 Ga0163163_10015972 3300014325 Bacteria 6958
220 Ga0163163_10019417 3300014325 Bacteria 6385
221 Ga0163163_10212785 3300014325 Bacteria 1982
222 Ga0157380_10001792 3300014326 Bacteria 14171
223 Ga0157380_10108505 3300014326 Bacteria 2327
224 Ga0157377_10007254 3300014745 Bacteria 5343
225 Ga0157379_10004317 3300014968 Bacteria 12160
226 Ga0157379_10010816 3300014968 Bacteria 7957
227 Ga0157379_10018910 3300014968 Bacteria 6079
228 Ga0157379_10256642 3300014968 Bacteria 1588
229 Ga0157376_10006288 3300014969 Bacteria 8380
230 Ga0157376_10028517 3300014969 Bacteria 4438
231 Ga0213872_10001252 3300021361 Bacteria 17110
232 Ga0213874_10029524 3300021377 Bacteria 1574
233 Ga0207427_100046 3300025231 Bacteria 240976
234 Ga0209233_1030298 3300025261 Bacteria 1276
235 Ga0207642_10078038 3300025899 Bacteria 1599
236 Ga0207710_10000707 3300025900 Bacteria 18686
237 Ga0207688_10031059 3300025901 Bacteria 2947
238 Ga0207680_10036951 3300025903 Bacteria 2816
239 Ga0207680_10048147 3300025903 Bacteria 2530
240 Ga0207645_10065087 3300025907 Bacteria 2329
241 Ga0207645_10067590 3300025907 Bacteria 2284
242 Ga0207643_10020779 3300025908 Bacteria 3604
243 Ga0207643_10031512 3300025908 Bacteria 2956
244 Ga0207684_10077319 3300025910 Bacteria 2830
245 Ga0207684_10108362 3300025910 Bacteria 2377
246 Ga0207654_10179816 3300025911 Bacteria 1379
247 Ga0207707_10005971 3300025912 Bacteria 10654
248 Ga0207707_10275950 3300025912 Bacteria 1456
249 Ga0207707_10280175 3300025912 Bacteria 1444
250 Ga0207695_10009682 3300025913 Bacteria 11870
251 Ga0207693_10000144 3300025915 Bacteria 65408
252 Ga0207663_10182398 3300025916 Bacteria 1500
253 Ga0207660_10030350 3300025917 Bacteria 3715
254 Ga0207660_10074436 3300025917 Bacteria 2479
255 Ga0207662_10007327 3300025918 Bacteria 6001
256 Ga0207657_10061362 3300025919 Bacteria 3224
257 Ga0207649_10013525 3300025920 Bacteria 4556
258 Ga0207649_10016806 3300025920 Bacteria 4137
259 Ga0207649_10118799 3300025920 Bacteria 1779
260 Ga0207652_10024576 3300025921 Bacteria 4999
261 Ga0207652_10031398 3300025921 Bacteria 4462
262 Ga0207652_10041222 3300025921 Bacteria 3923
263 Ga0207646_10051931 3300025922 Bacteria 3668
264 Ga0207646_10111591 3300025922 Bacteria 2454
265 Ga0207681_10031564 3300025923 Bacteria 3461
266 Ga0207681_10061669 3300025923 Bacteria 2579
267 Ga0207694_10000559 3300025924 Bacteria 33677
268 Ga0207659_10016801 3300025926 Bacteria 4771
269 Ga0207659_10041704 3300025926 Bacteria 3215
270 Ga0207659_10068348 3300025926 Bacteria 2584
271 Ga0207687_10017298 3300025927 Bacteria 4744
272 Ga0207687_10222742 3300025927 Bacteria 1486
273 Ga0207700_10008963 3300025928 Bacteria 6227
274 Ga0207700_10025793 3300025928 Bacteria 4088
275 Ga0207644_10004411 3300025931 Bacteria 9129
276 Ga0207644_10009861 3300025931 Bacteria 6282
277 Ga0207644_10018159 3300025931 Bacteria 4756
278 Ga0207644_10100845 3300025931 Bacteria 2168
279 Ga0207690_10013171 3300025932 Bacteria 4965
280 Ga0207706_10066453 3300025933 Bacteria 3173
281 Ga0207670_10001481 3300025936 Bacteria 12331
282 Ga0207665_10030452 3300025939 Bacteria 3566
283 Ga0207665_10075779 3300025939 Bacteria 2305
284 Ga0207691_10009445 3300025940 Bacteria 9365
285 Ga0207691_10027929 3300025940 Bacteria 5286
286 Ga0207691_10030778 3300025940 Bacteria 5013
287 Ga0207691_10115292 3300025940 Bacteria 2386
288 Ga0207691_10124166 3300025940 Bacteria 2285
289 Ga0207691_10135759 3300025940 Bacteria 2169
290 Ga0207691_10150581 3300025940 Bacteria 2046
291 Ga0207711_10111893 3300025941 Bacteria 2429
292 Ga0207711_10258021 3300025941 Bacteria 1601
293 Ga0207711_10292261 3300025941 Bacteria 1502
294 Ga0207689_10006430 3300025942 Bacteria 10388
295 Ga0207689_10039825 3300025942 Bacteria 3890
296 Ga0207661_10063113 3300025944 Bacteria 2999
297 Ga0207661_10138206 3300025944 Bacteria 2094
298 Ga0207679_10000656 3300025945 Bacteria 23166
299 Ga0207679_10026750 3300025945 Bacteria 3981
300 Ga0207667_10074127 3300025949 Bacteria 3536
301 Ga0207651_10024727 3300025960 Bacteria 3720
302 Ga0207651_10054500 3300025960 Bacteria 2740
303 Ga0207668_10001362 3300025972 Bacteria 14434
304 Ga0207668_10079346 3300025972 Bacteria 2374
305 Ga0207668_10235136 3300025972 Bacteria 1479
306 Ga0207668_10267108 3300025972 Bacteria 1397
307 Ga0207658_10017712 3300025986 Bacteria 4910
308 Ga0207658_10029653 3300025986 Bacteria 3867
309 Ga0207658_10064158 3300025986 Bacteria 2754
310 Ga0207703_10000546 3300026035 Bacteria 38625
311 Ga0207703_10004632 3300026035 Bacteria 11238
312 Ga0207703_10021376 3300026035 Bacteria 5066
313 Ga0207703_10268590 3300026035 Bacteria 1544
314 Ga0207678_10132972 3300026067 Bacteria 2122
315 Ga0207708_10007528 3300026075 Bacteria 8052
316 Ga0207702_10069830 3300026078 Bacteria 3021
317 Ga0207641_10007700 3300026088 Bacteria 8955
318 Ga0207641_10023323 3300026088 Bacteria 5099
319 Ga0207641_10132158 3300026088 Bacteria 2242
320 Ga0207641_10160586 3300026088 Bacteria 2043
321 Ga0207641_10248499 3300026088 Bacteria 1660
322 Ga0207648_10009986 3300026089 Bacteria 9032
323 Ga0207648_10026881 3300026089 Bacteria 5110
324 Ga0207676_10000864 3300026095 Bacteria 23487
325 Ga0207676_10001384 3300026095 Bacteria 18052
326 Ga0207676_10176067 3300026095 Bacteria 1868
327 Ga0207674_10011342 3300026116 Bacteria 10015
328 Ga0207674_10106888 3300026116 Bacteria 2775
329 Ga0207674_10151355 3300026116 Bacteria 2277
330 Ga0207675_100004089 3300026118 Bacteria 14121
331 Ga0207675_100009531 3300026118 Bacteria 9080
332 Ga0207683_10016234 3300026121 Bacteria 6336
333 Ga0207683_10025557 3300026121 Bacteria 5095
334 Ga0207683_10071385 3300026121 Bacteria 3069
335 Ga0207683_10087371 3300026121 Bacteria 2773
336 Ga0207683_10147076 3300026121 Bacteria 2125
337 Ga0207698_10047853 3300026142 Bacteria 3243
338 Ga0209179_1000052 3300027512 Bacteria 22200
339 Ga0209966_1002482 3300027695 Bacteria 3076
340 Ga0209974_10000870 3300027876 Bacteria 10438
341 Ga0207428_10004195 3300027907 Bacteria 13805
342 Ga0207428_10008986 3300027907 Bacteria 9001
343 Ga0207428_10051616 3300027907 Bacteria 3287
344 Ga0268266_10000043 3300028379 Bacteria 316604
345 Ga0268266_10044291 3300028379 Bacteria 3804
346 Ga0268265_10002952 3300028380 Bacteria 12461
347 Ga0268264_10021851 3300028381 Bacteria 5222
348 Ga0268264_10046144 3300028381 Bacteria 3619
349 Ga0268264_10238939 3300028381 Bacteria 1682
350 Ga0265334_10001821 3300028573 Bacteria 10152
351 Ga0265318_10001878 3300028577 Bacteria 11799
352 Ga0265338_10153805 3300028800 Bacteria 1784
353 Ga0265338_10156928 3300028800 Bacteria 1761
354 Ga0265338_10245175 3300028800 Bacteria 1325
355 Ga0265760_10001504 3300031090 Bacteria 6870
356 Ga0265330_10004512 3300031235 Bacteria 7059
357 Ga0265330_10038550 3300031235 Bacteria 2125
358 Ga0265332_10004622 3300031238 Bacteria 6440
359 Ga0265332_10014065 3300031238 Bacteria 3540
360 Ga0265328_10012826 3300031239 Bacteria 3331
361 Ga0265320_10003581 3300031240 Bacteria 10386
362 Ga0265329_10003460 3300031242 Bacteria 6867
363 Ga0265340_10039675 3300031247 Bacteria 2321
364 Ga0265331_10002032 3300031250 Bacteria 14032
365 Ga0265327_10010305 3300031251 Bacteria 6591
366 Ga0307513_10010867 3300031456 Bacteria 11371
367 Ga0307513_10011072 3300031456 Bacteria 11246
368 Ga0307513_10026046 3300031456 Bacteria 6753
369 Ga0307513_10030077 3300031456 Bacteria 6175
370 Ga0307509_10001782 3300031507 Bacteria 35739
371 Ga0307509_10289607 3300031507 Bacteria 1393
372 Ga0307408_100000511 3300031548 Bacteria 33537
373 Ga0307408_100169267 3300031548 Bacteria 1743
374 Ga0307408_100173500 3300031548 Bacteria 1723
375 Ga0316575_10005276 3300031665 Bacteria 4601
376 Ga0265314_10005027 3300031711 Bacteria 12047
377 Ga0316576_10038287 3300031727 Bacteria 3438
378 Ga0307413_10123106 3300031824 Bacteria 1760
379 Ga0307410_10228569 3300031852 Bacteria 1435
380 Ga0307406_10212875 3300031901 Bacteria 1431
381 Ga0307407_10000861 3300031903 Bacteria 10179
382 Ga0307412_10196598 3300031911 Bacteria 1528
383 Ga0307409_100006680 3300031995 Bacteria 6815
384 Ga0307409_100007504 3300031995 Bacteria 6533
385 Ga0307409_100189599 3300031995 Bacteria 1829
386 Ga0307416_100072983 3300032002 Bacteria 2859
387 Ga0307416_100098106 3300032002 Bacteria 2540
388 Ga0307414_10162023 3300032004 Bacteria 1778
389 Ga0307411_10007609 3300032005 Bacteria 5539
390 Ga0307411_10086000 3300032005 Bacteria 2180
391 Ga0307411_10135426 3300032005 Bacteria 1807
392 Ga0316574_0038377 3300035398 Bacteria 2940
393 Ga0316574_0186885 3300035398 Bacteria 1333
394 Ga0373935_0212850 3300035692 Bacteria 1340
395 Ga0373933_0000488 3300035724 Bacteria 24751
396 Ga0373933_0098308 3300035724 Bacteria 1813
397 Ga0373947_0114603 3300035725 Bacteria 1707
398 Ga0373937_0000468 3300036401 Bacteria 37355
399 Ga0373937_0002951 3300036401 Bacteria 14233
400 Ga0373937_0008737 3300036401 Bacteria 8794
401 Ga0316582_0117486 3300036647 Bacteria 1777
402 Ga0316584_0194111 3300036712 Bacteria 1500
403 Ga0395900_0121443 3300037418 Bacteria 2680
404 Ga0395900_0159978 3300037418 Bacteria 2297
405 Ga0436364_1490639 3300037853 Bacteria 2245
406 Ga0395901_0031195 3300038443 Bacteria 5495
407 Ga0395901_0142689 3300038443 Bacteria 2517
408 Ga0400485_20853 3300038735 Bacteria 7601
409 Ga0400483_079008 3300039062 Bacteria 2772
410 Ga0400483_158383 3300039062 Bacteria 4194
411 Ga0436365_0351645 3300039437 Bacteria 2250
412 Ga0436365_0484474 3300039437 Bacteria 10353
413 Ga0436361_0141670 3300039447 Bacteria 12511
414 Ga0436363_0008955 3300039450 Bacteria 3192
415 Ga0436363_1449045 3300039450 Bacteria 19321
416 Ga0439463_034743 3300042016 Bacteria 1275
417 Ga0450923_005677 3300042125 Bacteria 2030
418 Ga0439435_0004369 3300042436 Bacteria 3038
419 Ga0450916_002402 3300042530 Bacteria 1987
420 Ga0451577_0009030 3300042876 Bacteria 9625
421 Ga0451577_0123583 3300042876 Bacteria 2318
422 Ga0466969_0000641 3300044656 Bacteria 18885
423 Ga0466982_0000008 3300044672 Bacteria 240089
424 Ga0466966_0001146 3300044684 Bacteria 17030
425 Ga0466961_0002065 3300044693 Bacteria 12508
426 Ga0466964_0000651 3300044706 Bacteria 11066
427 Ga0466971_0000248 3300044719 Bacteria 20646
428 Ga0466968_0006719 3300044735 Bacteria 4347
429 Ga0466970_0000992 3300044765 Bacteria 13656
430 Ga0466957_0001315 3300044842 Bacteria 12982
431 Ga0466960_0110202 3300044901 Bacteria 1429
432 Ga0466959_0000450 3300045049 Bacteria 23931
433 Ga0495592_0137368 3300046454 Bacteria 1703
434 Ga0495603_0001733 3300046455 Bacteria 12850
435 Ga0495590_0014704 3300046457 Bacteria 2854
436 Ga0495591_000575 3300046458 Bacteria 27984
437 Ga0495629_0004592 3300046459 Bacteria 10334
438 Ga0495629_0007566 3300046459 Bacteria 8004
439 Ga0495638_0000009 3300046460 Bacteria 525345
440 Ga0495638_0000019 3300046460 Bacteria 384671
441 Ga0495638_0026533 3300046460 Bacteria 3754
442 Ga0495641_0004767 3300046461 Bacteria 9445
443 Ga0495651_0004026 3300046462 Bacteria 11234
444 Ga0495651_0041499 3300046462 Bacteria 3574
445 Ga0495651_0075664 3300046462 Bacteria 2552
446 Ga0495650_0023496 3300046471 Bacteria 2934
447 Ga0495580_0000001 3300046472 Bacteria 180598
448 Ga0495580_0038710 3300046472 Bacteria 3414
449 Ga0495580_0065981 3300046472 Bacteria 2534
450 Ga0495580_0098080 3300046472 Bacteria 2038
451 Ga0495582_0070282 3300046473 Bacteria 1936
452 Ga0495605_0016541 3300046474 Bacteria 3991
453 Ga0495664_0000164 3300046477 Bacteria 32697
454 Ga0495664_0032098 3300046477 Bacteria 3080
455 Ga0495664_0160999 3300046477 Bacteria 1361
456 Ga0495594_0075216 3300046499 Bacteria 1882
457 Ga0495594_0102326 3300046499 Bacteria 1611
458 Ga0495596_0028068 3300046500 Bacteria 2260
459 Ga0495583_0000789 3300046506 Bacteria 39441
460 Ga0495606_0021160 3300046507 Bacteria 4768
461 Ga0495606_0034610 3300046507 Bacteria 3466
462 Ga0495608_0056897 3300046511 Bacteria 2581
463 Ga0495608_0063710 3300046511 Bacteria 2418
464 Ga0495608_0190206 3300046511 Bacteria 1296
465 Ga0495616_0006800 3300046513 Bacteria 6892
466 Ga0495616_0067916 3300046513 Bacteria 1732
467 Ga0495618_0003150 3300046514 Bacteria 10359
468 Ga0495618_0046853 3300046514 Bacteria 2729
469 Ga0495618_0129568 3300046514 Bacteria 1614
470 Ga0495628_0000262 3300046516 Bacteria 46877
471 Ga0495628_0045325 3300046516 Bacteria 3497
472 Ga0495628_0053645 3300046516 Bacteria 3181
473 Ga0495628_0210389 3300046516 Bacteria 1463
474 Ga0495628_0288211 3300046516 Bacteria 1218
475 Ga0495630_0012400 3300046517 Bacteria 6189
476 Ga0495630_0017162 3300046517 Bacteria 5300
477 Ga0495630_0041217 3300046517 Bacteria 3448
478 Ga0495648_0002441 3300046524 Bacteria 17177
479 Ga0495648_0022885 3300046524 Bacteria 4290
480 Ga0495648_0029414 3300046524 Bacteria 3647
481 Ga0495666_0002792 3300046526 Bacteria 8731
482 Ga0495666_0002993 3300046526 Bacteria 8480
483 Ga0495666_0040785 3300046526 Bacteria 2250
484 Ga0495652_0009937 3300046529 Bacteria 8627
485 Ga0495665_0002661 3300046531 Bacteria 9635
486 Ga0495640_0007335 3300046533 Bacteria 8678
487 Ga0495640_0013736 3300046533 Bacteria 6153
488 Ga0495640_0080936 3300046533 Bacteria 2159
489 Ga0495586_0000531 3300046535 Bacteria 22200
490 Ga0495587_0000061 3300046536 Bacteria 92667
491 Ga0495587_0018149 3300046536 Bacteria 4363
492 Ga0495587_0046374 3300046536 Bacteria 2580
493 Ga0495598_0002515 3300046537 Bacteria 3790
494 Ga0495621_0004199 3300046539 Bacteria 4024
495 Ga0495645_0005913 3300046543 Bacteria 8452
496 Ga0495645_0039515 3300046543 Bacteria 3441
497 Ga0495645_0138980 3300046543 Bacteria 1696
498 Ga0495622_0000111 3300046557 Bacteria 71097
499 Ga0495667_0084255 3300046559 Bacteria 2064
500 Ga0495667_0095961 3300046559 Bacteria 1919
501 Ga0495656_0132704 3300046615 Bacteria 1187
502 Ga0495634_0005907 3300046642 Bacteria 9349
503 Ga0495634_0013358 3300046642 Bacteria 5934
504 Ga0495611_0088210 3300046648 Bacteria 1432
505 Ga0495625_0212135 3300046660 Bacteria 1272
506 Ga0495635_0001720 3300046663 Bacteria 14731
507 Ga0495635_0007054 3300046663 Bacteria 7852
508 Ga0495661_0000792 3300046665 Bacteria 30007
509 Ga0495661_0034993 3300046665 Bacteria 3156
510 Ga0495657_0087203 3300046675 Bacteria 2009
511 Ga0495599_0036013 3300046678 Bacteria 3106
512 Ga0495599_0036579 3300046678 Bacteria 3084
513 Ga0495599_0039891 3300046678 Bacteria 2950
514 Ga0495599_0124257 3300046678 Bacteria 1604
515 Ga0495623_0013862 3300046679 Bacteria 5227
516 Ga0495623_0017621 3300046679 Bacteria 4612
517 Ga0495623_0087503 3300046679 Bacteria 1919
518 Ga0495646_0026823 3300046680 Bacteria 3615
519 Ga0495658_0003311 3300046683 Bacteria 8001
520 Ga0495658_0102904 3300046683 Bacteria 1707
521 Ga0495613_0004454 3300046689 Bacteria 10497
522 Ga0495613_0005409 3300046689 Bacteria 9593
523 Ga0495613_0089376 3300046689 Bacteria 2232
524 Ga0495613_0106251 3300046689 Bacteria 2026
525 Ga0495624_0002796 3300046690 Bacteria 13081
526 Ga0495671_0018759 3300046692 Bacteria 3667
527 Ga0495649_0004038 3300046694 Bacteria 9665
528 Ga0495649_0005395 3300046694 Bacteria 8139
529 Ga0495589_0036444 3300046794 Bacteria 2465
530 Ga0495600_0016311 3300046809 Bacteria 4712
531 Ga0495581_0031327 3300047315 Bacteria 3082
532 Ga0495581_0033226 3300047315 Bacteria 2987
533 Ga0495604_0008440 3300047317 Bacteria 8136
534 Ga0495604_0011493 3300047317 Bacteria 7031
535 Ga0495604_0071002 3300047317 Bacteria 2635
536 Ga0495674_0022704 3300047319 Bacteria 5784
537 Ga0495674_0044943 3300047319 Bacteria 3924
538 Ga0495674_0054798 3300047319 Bacteria 3499
539 Ga0495674_0096533 3300047319 Bacteria 2519
540 Ga0495672_0005551 3300047320 Bacteria 9979
541 Ga0495676_0010162 3300047321 Bacteria 8547
542 Ga0495676_0033442 3300047321 Bacteria 4330
543 Ga0495680_0001809 3300047322 Bacteria 22585
544 Ga0495680_0006202 3300047322 Bacteria 11142
545 Ga0495680_0049254 3300047322 Bacteria 3300
546 Ga0495680_0063040 3300047322 Bacteria 2848
547 Ga0495683_0001051 3300047323 Bacteria 19225
548 Ga0495683_0003350 3300047323 Bacteria 9372
549 Ga0495675_0001861 3300047444 Bacteria 12561
550 Ga0495675_0049285 3300047444 Bacteria 2678
551 Ga0495675_0094363 3300047444 Bacteria 1876
552 Ga0495679_011230 3300047446 Bacteria 3470
553 Ga0495679_021580 3300047446 Bacteria 2219
554 Ga0495673_0012859 3300047469 Bacteria 4415
555 Ga0495684_0102432 3300047471 Bacteria 2164
556 Ga0495593_0001562 3300047673 Bacteria 13504
557 Ga0495593_0025776 3300047673 Bacteria 3253
558 Ga0495602_0000053 3300048088 Bacteria 113109
559 Ga0495602_0074019 3300048088 Bacteria 2897
560 Ga0495614_0000057 3300048089 Bacteria 34749
561 Ga0495614_0016739 3300048089 Bacteria 3189
562 Ga0495626_0000532 3300048091 Bacteria 37897
563 Ga0496100_0013096 3300048903 Bacteria 4774
564 Ga0496101_0005358 3300048904 Bacteria 8175
565 Ga0496102_0005056 3300048905 Bacteria 11165
566 Ga0496102_0043481 3300048905 Bacteria 4074
567 Ga0496102_0133326 3300048905 Bacteria 2326
568 Ga0496104_0031783 3300048907 Bacteria 4911
569 Ga0496104_0218283 3300048907 Bacteria 1819
570 Ga0496104_0243472 3300048907 Bacteria 1711
571 Ga0496105_0112275 3300048908 Bacteria 2249
572 Ga0496105_0136530 3300048908 Bacteria 2020
573 Ga0496106_0000026 3300048909 Bacteria 150927
574 Ga0496106_0053352 3300048909 Bacteria 3053
575 Ga0496106_0133235 3300048909 Bacteria 1950
576 Ga0496107_0047750 3300048910 Bacteria 3083
577 Ga0496107_0129639 3300048910 Bacteria 1862
578 Ga0496108_0090486 3300048911 Bacteria 2601
579 Ga0496108_0123685 3300048911 Bacteria 2220
580 Ga0496109_0052994 3300048912 Bacteria 3699
581 Ga0496109_0188625 3300048912 Bacteria 1937
582 Ga0496110_0020733 3300048913 Bacteria 5550
583 Ga0496111_0018841 3300048914 Bacteria 4785
584 Ga0496112_0047670 3300048915 Bacteria 4204
585 Ga0496112_0165033 3300048915 Bacteria 2181
586 Ga0496113_0386412 3300048916 Bacteria 1123
587 Ga0496114_0184882 3300048917 Bacteria 1821
588 Ga0496115_0013593 3300048918 Bacteria 6159
589 Ga0496115_0028641 3300048918 Bacteria 4367
590 Ga0496116_0017445 3300048919 Bacteria 5570
591 Ga0496117_0001069 3300048920 Bacteria 41544
592 Ga0496118_0003050 3300048921 Bacteria 21565
593 Ga0496118_0013994 3300048921 Bacteria 7536
594 Ga0496118_0019928 3300048921 Bacteria 5970
595 Ga0496118_0047114 3300048921 Bacteria 3346
596 Ga0496121_0000791 3300048924 Bacteria 57823
597 Ga0496121_0001380 3300048924 Bacteria 41120
598 Ga0496121_0041380 3300048924 Bacteria 4027
599 Ga0496124_0028070 3300048927 Bacteria 5038
600 Ga0496125_0009370 3300048928 Bacteria 10083
601 Ga0496126_0000242 3300048929 Bacteria 117707
602 Ga0496126_0000798 3300048929 Bacteria 56449
603 Ga0496126_0044674 3300048929 Bacteria 4078
604 Ga0495678_057885 3300049459 Bacteria 1466
605 Ga0495678_060709 3300049459 Bacteria 1421
606 Ga0495682_0009167 3300049460 Bacteria 3873
607 Ga0495682_0017422 3300049460 Bacteria 2711
608 Ga0501031_0003012 3300049568 Bacteria 10778
609 Ga0501032_0045587 3300049569 Bacteria 2965
610 Ga0501032_0122025 3300049569 Bacteria 1722
611 Ga0501033_0000770 3300049570 Bacteria 29451
612 Ga0501034_0016377 3300049571 Bacteria 7609
613 Ga0501034_0186382 3300049571 Bacteria 2038
614 Ga0501036_0011136 3300049572 Bacteria 7440
615 Ga0501036_0028908 3300049572 Bacteria 4684
616 Ga0501036_0291211 3300049572 Bacteria 1366
617 Ga0501037_0002991 3300049573 Bacteria 12277
618 Ga0501037_0094453 3300049573 Bacteria 2162
619 Ga0501037_0104244 3300049573 Bacteria 2045
620 Ga0501038_0011113 3300049574 Bacteria 8222
621 Ga0501038_0060892 3300049574 Bacteria 3229
622 Ga0501038_0119409 3300049574 Bacteria 2176
623 Ga0501039_0044766 3300049575 Bacteria 3419
624 Ga0501039_0092941 3300049575 Bacteria 2351
625 Ga0501039_0151688 3300049575 Bacteria 1821
626 Ga0501040_0005878 3300049576 Bacteria 7943
627 Ga0501040_0008195 3300049576 Bacteria 6793
628 Ga0501040_0058241 3300049576 Bacteria 2653
629 Ga0501041_0011412 3300049577 Bacteria 5251
630 Ga0501042_0004636 3300049578 Bacteria 8773
631 Ga0501042_0047222 3300049578 Bacteria 3070
632 Ga0501043_0004167 3300049579 Bacteria 11815
633 Ga0501043_0244795 3300049579 Bacteria 1382
634 Ga0501046_0028495 3300049580 Bacteria 4546
635 Ga0501046_0180742 3300049580 Bacteria 1577
636 Ga0501047_0013149 3300049581 Bacteria 7839
637 Ga0501047_0293215 3300049581 Bacteria 1470
638 Ga0501048_0090271 3300049582 Bacteria 2161
639 Ga0501067_0001150 3300049583 Bacteria 14350
640 Ga0501067_0039547 3300049583 Bacteria 2619
641 Ga0501068_0018290 3300049584 Bacteria 4060
642 Ga0501068_0090790 3300049584 Bacteria 1885
643 Ga0501068_0199487 3300049584 Bacteria 1269
644 Ga0501070_0076177 3300049586 Bacteria 2777
645 Ga0501071_0037530 3300049587 Bacteria 3460
646 Ga0501071_0042205 3300049587 Bacteria 3267
647 Ga0501071_0158831 3300049587 Bacteria 1689
648 Ga0501073_0005778 3300049589 Bacteria 9247
649 Ga0501073_0039494 3300049589 Bacteria 3342
650 Ga0501074_0019863 3300049590 Bacteria 4880
651 Ga0501074_0152806 3300049590 Bacteria 1650
652 Ga0501074_0216121 3300049590 Bacteria 1365
653 Ga0501075_0000841 3300049591 Bacteria 19343
654 Ga0501075_0002728 3300049591 Bacteria 11819
655 Ga0501076_0000166 3300049592 Bacteria 38261
656 Ga0501076_0006224 3300049592 Bacteria 8641
657 Ga0501076_0104450 3300049592 Bacteria 2286
658 Ga0501076_0282816 3300049592 Bacteria 1359
659 Ga0501207_000511 3300049654 Bacteria 4377
660 Ga0501261_005958 3300049690 Bacteria 1545
661 Ga0501079_0012922 3300049741 Bacteria 6373
662 Ga0501079_0029434 3300049741 Bacteria 4216
663 Ga0501079_0125298 3300049741 Bacteria 1998
664 Ga0501080_0024975 3300049742 Bacteria 5543
665 Ga0501080_0031712 3300049742 Bacteria 4925
666 Ga0501080_0109492 3300049742 Bacteria 2561
667 Ga0501080_0162257 3300049742 Bacteria 2064
668 Ga0501081_0104493 3300049743 Bacteria 2005
669 Ga0501035_0008948 3300049822 Bacteria 9316
670 Ga0501035_0060438 3300049822 Bacteria 3373
671 Ga0501044_0000396 3300049823 Bacteria 54058
672 Ga0501044_0133588 3300049823 Bacteria 2474
673 Ga0501045_0090883 3300049824 Bacteria 2256
674 nmdc:mga05p37_16198_c1 3300050507 Bacteria 8975
675 nmdc:mga05p37_16472_c1 3300050507 Bacteria 8905
676 nmdc:mga09592_2620_c1 3300050508 Bacteria 14564
677 nmdc:mga09592_5028_c1 3300050508 Bacteria 10725
678 nmdc:mga09592_65910_c1 3300050508 Bacteria 3068
679 nmdc:mga09592_92914_c1 3300050508 Bacteria 2579
680 nmdc:mga0qj67_15475_c1 3300050509 Bacteria 5776
681 nmdc:mga0qj67_193338_c1 3300050509 Bacteria 1653
682 nmdc:mga0qj67_24238_c1 3300050509 Bacteria 4676
683 nmdc:mga0qj67_48604_c1 3300050509 Bacteria 3351
684 nmdc:mga06r32_1870_c1 3300050510 Bacteria 18760
685 nmdc:mga06r32_31492_c1 3300050510 Bacteria 4982
686 nmdc:mga06r32_565_c1 3300050510 Bacteria 32242
687 nmdc:mga08y16_194376_c1 3300050511 Bacteria 2104
688 nmdc:mga08y16_418371_c1 3300050511 Bacteria 1370
689 nmdc:mga08y16_4678_c1 3300050511 Bacteria 14262
690 nmdc:mga08y16_6258_c1 3300050511 Bacteria 12482
691 nmdc:mga08y16_9872_c1 3300050511 Bacteria 10024
692 nmdc:mga0rr50_167207_c1 3300050513 Bacteria 1789
693 nmdc:mga0a205_267875_c1 3300050515 Bacteria 1585
694 Ga0495612_0055481 3300053078 Bacteria 1634
695 Ga0500647_0121747 3300053091 Bacteria 1235
696 Ga0500588_0024178 3300053146 Bacteria 1674
697 Ga0500622_0015771 3300053156 Bacteria 4044
698 Ga0500630_043249 3300053159 Bacteria 2195
699 Ga0501084_0034161 3300054114 Bacteria 4252
700 Ga0501082_0004974 3300060353 Bacteria 11604
701 Ga0501082_0052825 3300060353 Bacteria 3503
702 Ga0501082_0486176 3300060353 Bacteria 1079
703 Ga0530510_0000956 3300061734 Bacteria 19075
704 Ga0530510_0136877 3300061734 Bacteria 1803
705 2510248851 2510065045 Bacteria 7761063
706 2600813321 2600255067 Bacteria 6795583
707 2719642725 2718217991 Bacteria 7829542
708 2723876596 2721755763 Bacteria 4464185
709 2857359359 2857357740 Bacteria 9937880
710 2913846382 2913844669 Bacteria 8381711
711 2952254826 2952252522 Bacteria 4171745
712 8055307711 8055301274 Bacteria 8587385
713 Ga0495580_0004257
714 JGI24735J21928_10000266
715 rootL2_10129855
716 rootL2_10159372
717 rootL2_10248547
718 rootH1_10123237
719 Ga0065712_10069600
720 Ga0070658_10079844
721 Ga0070676_10046023
722 Ga0070676_10057120
723 Ga0070676_10138263
724 Ga0070683_100114781
725 Ga0070690_100000848
726 Ga0070690_100009935
727 Ga0070690_100038140
728 Ga0070670_100027595
729 Ga0070670_100244684
730 Ga0068869_100012483
731 Ga0068869_100030598
732 Ga0070666_10000003
733 Ga0070666_10010881
734 Ga0070666_10022849
735 Ga0070666_10057652
736 Ga0070666_10132764
737 Ga0070680_100080675
738 Ga0070682_100005019
739 Ga0070682_100029235
740 Ga0068868_100087361
741 Ga0068868_100440880
742 Ga0070660_100142379
743 Ga0070689_100000509
744 Ga0070687_100005790
745 Ga0070661_100004656
746 Ga0070661_100029043
747 Ga0070661_100094116
748 Ga0070669_100087836
749 Ga0070669_100140934
750 Ga0070669_100221865
751 Ga0070675_100000139
752 Ga0070675_100001593
753 Ga0070675_100027333
754 Ga0070675_100034288
755 Ga0070675_100191308
756 Ga0070671_100039510
757 Ga0070673_100137301
758 Ga0070659_100168580
759 Ga0070667_100014812
760 Ga0070667_100016792
761 Ga0070667_100057804
762 Ga0070714_100016325
763 Ga0070713_100005046
764 Ga0070701_10003283
765 Ga0070711_100002829
766 Ga0070711_100057627
767 Ga0070705_100188032
768 Ga0070700_100013817
769 Ga0070700_100040893
770 Ga0070708_100001467
771 Ga0070678_100007056
772 Ga0070678_100010070
773 Ga0070678_100043335
774 Ga0070678_100047034
775 Ga0070678_100113076
776 Ga0070662_100009759
777 Ga0070662_100031349
778 Ga0070662_100073743
779 Ga0070681_10010257
780 Ga0070681_10032569
781 Ga0070681_10058997
782 Ga0068867_100074585
783 Ga0070685_10015076
784 Ga0070706_100117637
785 Ga0070707_100059423
786 Ga0070707_100141774
787 Ga0070679_100030388
788 Ga0070679_100045058
789 Ga0070679_100071762
790 Ga0070679_100096553
791 Ga0070679_100463431
792 Ga0070684_100014149
793 Ga0070684_100016613
794 Ga0070684_100043697
795 Ga0070684_100151984
796 Ga0070672_100038359
797 Ga0070672_100106049
798 Ga0070686_100001361
799 Ga0070695_100054714
800 Ga0070695_100203548
801 Ga0070665_100003952
802 Ga0070665_100011103
803 Ga0070665_100015433
804 Ga0070665_100026593
805 Ga0070665_100033938
806 Ga0070704_100239109
807 Ga0068855_100014165
808 Ga0068855_100128321
809 Ga0068855_100131836
810 Ga0070664_100000585
811 Ga0070664_100006952
812 Ga0070664_100215971
813 Ga0070664_100283404
814 Ga0068857_100104059
815 Ga0068857_100186515
816 Ga0068856_100015327
817 Ga0070702_100001168
818 Ga0070702_100017086
819 Ga0070702_100087223
820 Ga0068852_100020679
821 Ga0068859_100000516
822 Ga0068859_100006281
823 Ga0068859_100010529
824 Ga0068859_100180195
825 Ga0068864_100001046
826 Ga0068864_100002556
827 Ga0068864_100013383
828 Ga0068866_10004732
829 Ga0068861_100015785
830 Ga0068861_100018595
831 Ga0068861_100052102
832 Ga0068870_10019427
833 Ga0068870_10027886
834 Ga0068863_100019332
835 Ga0068863_100021414
836 Ga0068863_100029477
837 Ga0068863_100030863
838 Ga0068863_100107519
839 Ga0068858_100001604
840 Ga0068858_100015946
841 Ga0068858_100109882
842 Ga0068860_100012232
843 Ga0068860_100022411
844 Ga0068860_100040982
845 Ga0068860_100102820
846 Ga0068862_100001537
847 Ga0068862_100112008
848 Ga0068862_100330390
849 Ga0081455_10076519
850 Ga0081455_10120254
851 Ga0070717_10005471
852 Ga0070716_100007136
853 Ga0070716_100013609
854 Ga0070712_100008251
855 Ga0097621_100009661
856 Ga0097621_100010826
857 Ga0097621_100042328
858 Ga0097621_100146121
859 Ga0068871_100005809
860 Ga0068871_100008391
861 Ga0068871_100067624
862 Ga0068871_100141515
863 Ga0068871_100292440
864 Ga0075428_100008721
865 Ga0075428_100042010
866 Ga0075428_100064310
867 Ga0075430_100004227
868 Ga0075430_100010670
869 Ga0075430_100013189
870 Ga0075431_100000938
871 Ga0075431_100003513
872 Ga0075431_100110840
873 Ga0075434_100278847
874 Ga0075429_100006127
875 Ga0075429_100033851
876 Ga0075429_100069100
877 Ga0075429_100080930
878 Ga0068865_100001769
879 Ga0075436_100025431
880 Ga0097620_100000516
881 Ga0097620_100006281
882 Ga0097620_100010529
883 Ga0097620_100180190
884 Ga0075435_100180824
885 Ga0099794_10009412
886 Ga0099795_10000009
887 Ga0099795_10021348
888 Ga0111539_10000754
889 Ga0111539_10004469
890 Ga0111539_10083228
891 Ga0111539_10131098
892 Ga0105247_10000162
893 Ga0105247_10024069
894 Ga0114129_10002722
895 Ga0114129_10004060
896 Ga0105248_10006659
897 Ga0105248_10015627
898 Ga0105248_10124091
899 Ga0105248_10154646
900 Ga0105248_10203330
901 Ga0105248_10309854
902 Ga0105248_10415998
903 Ga0105237_10041330
904 Ga0105237_10214497
905 Ga0105238_10000186
906 Ga0105249_10008111
907 Ga0105249_10011434
908 Ga0105249_10018723
909 Ga0105249_10054552
910 Ga0105249_10163245
911 Ga0105249_10195454
912 Ga0099796_10000005
913 Ga0099796_10035391
914 Ga0157373_10008960
915 Ga0157371_10038238
916 Ga0157369_10486645
917 Ga0157374_10003005
918 Ga0157374_10008154
919 Ga0157378_10084447
920 Ga0157378_10324092
921 Ga0163162_10000030
922 Ga0163162_10000209
923 Ga0163162_10011280
924 Ga0163162_10094815
925 Ga0163162_10390065
926 Ga0157372_10024873
927 Ga0157375_10034088
928 Ga0157375_10047103
929 Ga0157375_10090831
930 Ga0163163_10010139
931 Ga0163163_10015972
932 Ga0163163_10019417
933 Ga0163163_10212785
934 Ga0157380_10001792
935 Ga0157380_10108505
936 Ga0157377_10007254
937 Ga0157379_10004317
938 Ga0157379_10010816
939 Ga0157379_10018910
940 Ga0157379_10256642
941 Ga0157376_10006288
942 Ga0157376_10028517
943 Ga0213872_10001252
944 Ga0213874_10029524
945 Ga0207427_100046
946 Ga0209233_1030298
947 Ga0207642_10078038
948 Ga0207710_10000707
949 Ga0207688_10031059
950 Ga0207680_10036951
951 Ga0207680_10048147
952 Ga0207645_10065087
953 Ga0207645_10067590
954 Ga0207643_10020779
955 Ga0207643_10031512
956 Ga0207684_10077319
957 Ga0207684_10108362
958 Ga0207654_10179816
959 Ga0207707_10005971
960 Ga0207707_10275950
961 Ga0207707_10280175
962 Ga0207695_10009682
963 Ga0207693_10000144
964 Ga0207663_10182398
965 Ga0207660_10030350
966 Ga0207660_10074436
967 Ga0207662_10007327
968 Ga0207657_10061362
969 Ga0207649_10013525
970 Ga0207649_10016806
971 Ga0207649_10118799
972 Ga0207652_10024576
973 Ga0207652_10031398
974 Ga0207652_10041222
975 Ga0207646_10051931
976 Ga0207646_10111591
977 Ga0207681_10031564
978 Ga0207681_10061669
979 Ga0207694_10000559
980 Ga0207659_10016801
981 Ga0207659_10041704
982 Ga0207659_10068348
983 Ga0207687_10017298
984 Ga0207687_10222742
985 Ga0207700_10008963
986 Ga0207700_10025793
987 Ga0207644_10004411
988 Ga0207644_10009861
989 Ga0207644_10018159
990 Ga0207644_10100845
991 Ga0207690_10013171
992 Ga0207706_10066453
993 Ga0207670_10001481
994 Ga0207665_10030452
995 Ga0207665_10075779
996 Ga0207691_10009445
997 Ga0207691_10027929
998 Ga0207691_10030778
999 Ga0207691_10115292
1000 Ga0207691_10124166
1001 Ga0207691_10135759
1002 Ga0207691_10150581
1003 Ga0207711_10111893
1004 Ga0207711_10258021
1005 Ga0207711_10292261
1006 Ga0207689_10006430
1007 Ga0207689_10039825
1008 Ga0207661_10063113
1009 Ga0207661_10138206
1010 Ga0207679_10000656
1011 Ga0207679_10026750
1012 Ga0207667_10074127
1013 Ga0207651_10024727
1014 Ga0207651_10054500
1015 Ga0207668_10001362
1016 Ga0207668_10079346
1017 Ga0207668_10235136
1018 Ga0207668_10267108
1019 Ga0207658_10017712
1020 Ga0207658_10029653
1021 Ga0207658_10064158
1022 Ga0207703_10000546
1023 Ga0207703_10004632
1024 Ga0207703_10021376
1025 Ga0207703_10268590
1026 Ga0207678_10132972
1027 Ga0207708_10007528
1028 Ga0207702_10069830
1029 Ga0207641_10007700
1030 Ga0207641_10023323
1031 Ga0207641_10132158
1032 Ga0207641_10160586
1033 Ga0207641_10248499
1034 Ga0207648_10009986
1035 Ga0207648_10026881
1036 Ga0207676_10000864
1037 Ga0207676_10001384
1038 Ga0207676_10176067
1039 Ga0207674_10011342
1040 Ga0207674_10106888
1041 Ga0207674_10151355
1042 Ga0207675_100004089
1043 Ga0207675_100009531
1044 Ga0207683_10016234
1045 Ga0207683_10025557
1046 Ga0207683_10071385
1047 Ga0207683_10087371
1048 Ga0207683_10147076
1049 Ga0207698_10047853
1050 Ga0209179_1000052
1051 Ga0209966_1002482
1052 Ga0209974_10000870
1053 Ga0207428_10004195
1054 Ga0207428_10008986
1055 Ga0207428_10051616
1056 Ga0268266_10000043
1057 Ga0268266_10044291
1058 Ga0268265_10002952
1059 Ga0268264_10021851
1060 Ga0268264_10046144
1061 Ga0268264_10238939
1062 Ga0265334_10001821
1063 Ga0265318_10001878
1064 Ga0265338_10153805
1065 Ga0265338_10156928
1066 Ga0265338_10245175
1067 Ga0265760_10001504
1068 Ga0265330_10004512
1069 Ga0265330_10038550
1070 Ga0265332_10004622
1071 Ga0265332_10014065
1072 Ga0265328_10012826
1073 Ga0265320_10003581
1074 Ga0265329_10003460
1075 Ga0265340_10039675
1076 Ga0265331_10002032
1077 Ga0265327_10010305
1078 Ga0307513_10010867
1079 Ga0307513_10011072
1080 Ga0307513_10026046
1081 Ga0307513_10030077
1082 Ga0307509_10001782
1083 Ga0307509_10289607
1084 Ga0307408_100000511
1085 Ga0307408_100169267
1086 Ga0307408_100173500
1087 Ga0316575_10005276
1088 Ga0265314_10005027
1089 Ga0316576_10038287
1090 Ga0307413_10123106
1091 Ga0307410_10228569
1092 Ga0307406_10212875
1093 Ga0307407_10000861
1094 Ga0307412_10196598
1095 Ga0307409_100006680
1096 Ga0307409_100007504
1097 Ga0307409_100189599
1098 Ga0307416_100072983
1099 Ga0307416_100098106
1100 Ga0307414_10162023
1101 Ga0307411_10007609
1102 Ga0307411_10086000
1103 Ga0307411_10135426
1104 Ga0316574_0038377
1105 Ga0316574_0186885
1106 Ga0373935_0212850
1107 Ga0373933_0000488
1108 Ga0373933_0098308
1109 Ga0373947_0114603
1110 Ga0373937_0000468
1111 Ga0373937_0002951
1112 Ga0373937_0008737
1113 Ga0316582_0117486
1114 Ga0316584_0194111
1115 Ga0395900_0121443
1116 Ga0395900_0159978
1117 Ga0436364_1490639
1118 Ga0395901_0031195
1119 Ga0395901_0142689
1120 Ga0400485_20853
1121 Ga0400483_079008
1122 Ga0400483_158383
1123 Ga0436365_0351645
1124 Ga0436365_0484474
1125 Ga0436361_0141670
1126 Ga0436363_0008955
1127 Ga0436363_1449045
1128 Ga0439463_034743
1129 Ga0450923_005677
1130 Ga0439435_0004369
1131 Ga0450916_002402
1132 Ga0451577_0009030
1133 Ga0451577_0123583
1134 Ga0466969_0000641
1135 Ga0466982_0000008
1136 Ga0466966_0001146
1137 Ga0466961_0002065
1138 Ga0466964_0000651
1139 Ga0466971_0000248
1140 Ga0466968_0006719
1141 Ga0466970_0000992
1142 Ga0466957_0001315
1143 Ga0466960_0110202
1144 Ga0466959_0000450
1145 Ga0495592_0137368
1146 Ga0495603_0001733
1147 Ga0495590_0014704
1148 Ga0495591_000575
1149 Ga0495629_0004592
1150 Ga0495629_0007566
1151 Ga0495638_0000009
1152 Ga0495638_0000019
1153 Ga0495638_0026533
1154 Ga0495641_0004767
1155 Ga0495651_0004026
1156 Ga0495651_0041499
1157 Ga0495651_0075664
1158 Ga0495650_0023496
1159 Ga0495580_0000001
1160 Ga0495580_0038710
1161 Ga0495580_0065981
1162 Ga0495580_0098080
1163 Ga0495582_0070282
1164 Ga0495605_0016541
1165 Ga0495664_0000164
1166 Ga0495664_0032098
1167 Ga0495664_0160999
1168 Ga0495594_0075216
1169 Ga0495594_0102326
1170 Ga0495596_0028068
1171 Ga0495583_0000789
1172 Ga0495606_0021160
1173 Ga0495606_0034610
1174 Ga0495608_0056897
1175 Ga0495608_0063710
1176 Ga0495608_0190206
1177 Ga0495616_0006800
1178 Ga0495616_0067916
1179 Ga0495618_0003150
1180 Ga0495618_0046853
1181 Ga0495618_0129568
1182 Ga0495628_0000262
1183 Ga0495628_0045325
1184 Ga0495628_0053645
1185 Ga0495628_0210389
1186 Ga0495628_0288211
1187 Ga0495630_0012400
1188 Ga0495630_0017162
1189 Ga0495630_0041217
1190 Ga0495648_0002441
1191 Ga0495648_0022885
1192 Ga0495648_0029414
1193 Ga0495666_0002792
1194 Ga0495666_0002993
1195 Ga0495666_0040785
1196 Ga0495652_0009937
1197 Ga0495665_0002661
1198 Ga0495640_0007335
1199 Ga0495640_0013736
1200 Ga0495640_0080936
1201 Ga0495586_0000531
1202 Ga0495587_0000061
1203 Ga0495587_0018149
1204 Ga0495587_0046374
1205 Ga0495598_0002515
1206 Ga0495621_0004199
1207 Ga0495645_0005913
1208 Ga0495645_0039515
1209 Ga0495645_0138980
1210 Ga0495622_0000111
1211 Ga0495667_0084255
1212 Ga0495667_0095961
1213 Ga0495656_0132704
1214 Ga0495634_0005907
1215 Ga0495634_0013358
1216 Ga0495611_0088210
1217 Ga0495625_0212135
1218 Ga0495635_0001720
1219 Ga0495635_0007054
1220 Ga0495661_0000792
1221 Ga0495661_0034993
1222 Ga0495657_0087203
1223 Ga0495599_0036013
1224 Ga0495599_0036579
1225 Ga0495599_0039891
1226 Ga0495599_0124257
1227 Ga0495623_0013862
1228 Ga0495623_0017621
1229 Ga0495623_0087503
1230 Ga0495646_0026823
1231 Ga0495658_0003311
1232 Ga0495658_0102904
1233 Ga0495613_0004454
1234 Ga0495613_0005409
1235 Ga0495613_0089376
1236 Ga0495613_0106251
1237 Ga0495624_0002796
1238 Ga0495671_0018759
1239 Ga0495649_0004038
1240 Ga0495649_0005395
1241 Ga0495589_0036444
1242 Ga0495600_0016311
1243 Ga0495581_0031327
1244 Ga0495581_0033226
1245 Ga0495604_0008440
1246 Ga0495604_0011493
1247 Ga0495604_0071002
1248 Ga0495674_0022704
1249 Ga0495674_0044943
1250 Ga0495674_0054798
1251 Ga0495674_0096533
1252 Ga0495672_0005551
1253 Ga0495676_0010162
1254 Ga0495676_0033442
1255 Ga0495680_0001809
1256 Ga0495680_0006202
1257 Ga0495680_0049254
1258 Ga0495680_0063040
1259 Ga0495683_0001051
1260 Ga0495683_0003350
1261 Ga0495675_0001861
1262 Ga0495675_0049285
1263 Ga0495675_0094363
1264 Ga0495679_011230
1265 Ga0495679_021580
1266 Ga0495673_0012859
1267 Ga0495684_0102432
1268 Ga0495593_0001562
1269 Ga0495593_0025776
1270 Ga0495602_0000053
1271 Ga0495602_0074019
1272 Ga0495614_0000057
1273 Ga0495614_0016739
1274 Ga0495626_0000532
1275 Ga0496100_0013096
1276 Ga0496101_0005358
1277 Ga0496102_0005056
1278 Ga0496102_0043481
1279 Ga0496102_0133326
1280 Ga0496104_0031783
1281 Ga0496104_0218283
1282 Ga0496104_0243472
1283 Ga0496105_0112275
1284 Ga0496105_0136530
1285 Ga0496106_0000026
1286 Ga0496106_0053352
1287 Ga0496106_0133235
1288 Ga0496107_0047750
1289 Ga0496107_0129639
1290 Ga0496108_0090486
1291 Ga0496108_0123685
1292 Ga0496109_0052994
1293 Ga0496109_0188625
1294 Ga0496110_0020733
1295 Ga0496111_0018841
1296 Ga0496112_0047670
1297 Ga0496112_0165033
1298 Ga0496113_0386412
1299 Ga0496114_0184882
1300 Ga0496115_0013593
1301 Ga0496115_0028641
1302 Ga0496116_0017445
1303 Ga0496117_0001069
1304 Ga0496118_0003050
1305 Ga0496118_0013994
1306 Ga0496118_0019928
1307 Ga0496118_0047114
1308 Ga0496121_0000791
1309 Ga0496121_0001380
1310 Ga0496121_0041380
1311 Ga0496124_0028070
1312 Ga0496125_0009370
1313 Ga0496126_0000242
1314 Ga0496126_0000798
1315 Ga0496126_0044674
1316 Ga0495678_057885
1317 Ga0495678_060709
1318 Ga0495682_0009167
1319 Ga0495682_0017422
1320 Ga0501031_0003012
1321 Ga0501032_0045587
1322 Ga0501032_0122025
1323 Ga0501033_0000770
1324 Ga0501034_0016377
1325 Ga0501034_0186382
1326 Ga0501036_0011136
1327 Ga0501036_0028908
1328 Ga0501036_0291211
1329 Ga0501037_0002991
1330 Ga0501037_0094453
1331 Ga0501037_0104244
1332 Ga0501038_0011113
1333 Ga0501038_0060892
1334 Ga0501038_0119409
1335 Ga0501039_0044766
1336 Ga0501039_0092941
1337 Ga0501039_0151688
1338 Ga0501040_0005878
1339 Ga0501040_0008195
1340 Ga0501040_0058241
1341 Ga0501041_0011412
1342 Ga0501042_0004636
1343 Ga0501042_0047222
1344 Ga0501043_0004167
1345 Ga0501043_0244795
1346 Ga0501046_0028495
1347 Ga0501046_0180742
1348 Ga0501047_0013149
1349 Ga0501047_0293215
1350 Ga0501048_0090271
1351 Ga0501067_0001150
1352 Ga0501067_0039547
1353 Ga0501068_0018290
1354 Ga0501068_0090790
1355 Ga0501068_0199487
1356 Ga0501070_0076177
1357 Ga0501071_0037530
1358 Ga0501071_0042205
1359 Ga0501071_0158831
1360 Ga0501073_0005778
1361 Ga0501073_0039494
1362 Ga0501074_0019863
1363 Ga0501074_0152806
1364 Ga0501074_0216121
1365 Ga0501075_0000841
1366 Ga0501075_0002728
1367 Ga0501076_0000166
1368 Ga0501076_0006224
1369 Ga0501076_0104450
1370 Ga0501076_0282816
1371 Ga0501207_000511
1372 Ga0501261_005958
1373 Ga0501079_0012922
1374 Ga0501079_0029434
1375 Ga0501079_0125298
1376 Ga0501080_0024975
1377 Ga0501080_0031712
1378 Ga0501080_0109492
1379 Ga0501080_0162257
1380 Ga0501081_0104493
1381 Ga0501035_0008948
1382 Ga0501035_0060438
1383 Ga0501044_0000396
1384 Ga0501044_0133588
1385 Ga0501045_0090883
1386 nmdc:mga05p37_16198_c1
1387 nmdc:mga05p37_16472_c1
1388 nmdc:mga09592_2620_c1
1389 nmdc:mga09592_5028_c1
1390 nmdc:mga09592_65910_c1
1391 nmdc:mga09592_92914_c1
1392 nmdc:mga0qj67_15475_c1
1393 nmdc:mga0qj67_193338_c1
1394 nmdc:mga0qj67_24238_c1
1395 nmdc:mga0qj67_48604_c1
1396 nmdc:mga06r32_1870_c1
1397 nmdc:mga06r32_31492_c1
1398 nmdc:mga06r32_565_c1
1399 nmdc:mga08y16_194376_c1
1400 nmdc:mga08y16_418371_c1
1401 nmdc:mga08y16_4678_c1
1402 nmdc:mga08y16_6258_c1
1403 nmdc:mga08y16_9872_c1
1404 nmdc:mga0rr50_167207_c1
1405 nmdc:mga0a205_267875_c1
1406 Ga0495612_0055481
1407 Ga0500647_0121747
1408 Ga0500588_0024178
1409 Ga0500622_0015771
1410 Ga0500630_043249
1411 Ga0501084_0034161
1412 Ga0501082_0004974
1413 Ga0501082_0052825
1414 Ga0501082_0486176
1415 Ga0530510_0000956
1416 Ga0530510_0136877
1417 2510248851
1418 2600813321
1419 2719642725
1420 2723876596
1421 2857359359
1422 2913846382
1423 2952254826
1424 8055307711

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

43

388

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6czz-assembly2.cif.gz_C crystal structure of arabidopsis thaliana phosphoserine aminotransferase isoform 1 (atpsat1) in complex with plp-phosphoserine geminal diamine intermediate 0.9847 2 360
4xk1-assembly1.cif.gz_B crystal structure of a phosphoserine/phosphohydroxythreonine aminotransferase (psat) from pseudomonas aeruginosa with cofactor pyridoxal phosphate and bound glutamate 0.9844 5 350
2bi5-assembly1.cif.gz_B radiation damage of the schiff base in phosphoserine aminotransferase (structure e) 0.9815 2 358
6xdk-assembly2.cif.gz_C crystal structure of phosphoserine aminotransferase (serc) from stenotrophomonas maltophilia k279a 0.9808 3 360
2bi2-assembly1.cif.gz_A radiation damage of the schiff base in phosphoserine aminotransferase (structure c) 0.9796 1 358
ID Description Score Start End Superfamily
af_Q55CQ6_268_374_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9859 264 360 3.90.1150.10
3qm2B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9847 257 360 3.90.1150.10
af_I1J8D7_67_308_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9819 16 254 3.40.640.10
2bi2B01 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9776 18 255 3.40.640.10
3m5uB02 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9763 264 360 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A3D1XR54-F1-model_v4 Phosphoserine aminotransferase (Phosphohydroxythreonine aminotransferase) 0.994 246 360 GO:0004648
GO:0005737
GO:0006564
GO:0030170
AF-A0A522QFA9-F1-model_v4 Phosphoserine aminotransferase (Phosphohydroxythreonine aminotransferase) 0.9938 244 360 GO:0004648
GO:0005737
GO:0006564
GO:0008615
GO:0030170
AF-A0A349SPC0-F1-model_v4 Phosphoserine aminotransferase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) 0.9932 143 360 GO:0004648
GO:0005737
GO:0006564
GO:0008615
GO:0030170
AF-A0A520WZI6-F1-model_v4 Phosphoserine aminotransferase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) 0.9917 164 360 GO:0004648
GO:0005737
GO:0006564
GO:0008615
GO:0030170
AF-A0A7Z6UN64-F1-model_v4 Phosphoserine aminotransferase (EC 2.6.1.52) (Phosphohydroxythreonine aminotransferase) (PSAT) 0.9916 2 360 GO:0004648
GO:0005737
GO:0006564
GO:0008615
GO:0030170

Map