F476831
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 712 | 338 | 712 | 98 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10348056|Ga0105239_103480563 |
| Length | 101 |
| Sequence | MSLHPNEVLLAPVVSEKSYEQIESNHRYSFRVHPDAHKTQIRQAVEEIFGVRVQDVRTMSVKSKPKRRGYTSGRSRAWKKAVVQLHPDDHIELFEGQELGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 67 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 68 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 69 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 112 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 183 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 187 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 194 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 207 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 208 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 209 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 210 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 217 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 218 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 219 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 220 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 221 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 222 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 223 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 232 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 289 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 316 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 328 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 329 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 1.97 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.21 |
| Nodule | 0 |
| Rhizoplane | 9.41 |
| Rhizosphere | 83.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10003124 | 3300001979 | Bacteria | 7308 |
| 2 | JGI24748J21848_1000332 | 3300002074 | Bacteria | 5454 |
| 3 | JGI24034J26672_10000068 | 3300002239 | Bacteria | 28347 |
| 4 | JGI24742J22300_10000389 | 3300002244 | Bacteria | 6508 |
| 5 | JGI25406J46586_10046371 | 3300003203 | Bacteria | 1489 |
| 6 | Ga0070658_10460061 | 3300005327 | Bacteria | 1097 |
| 7 | Ga0070658_11417642 | 3300005327 | Bacteria | 603 |
| 8 | Ga0070683_100066804 | 3300005329 | Bacteria | 3349 |
| 9 | Ga0070683_100138936 | 3300005329 | Bacteria | 2301 |
| 10 | Ga0070683_100733551 | 3300005329 | Bacteria | 946 |
| 11 | Ga0070683_100737480 | 3300005329 | Bacteria | 944 |
| 12 | Ga0070683_100935600 | 3300005329 | Bacteria | 832 |
| 13 | Ga0070670_100085569 | 3300005331 | Bacteria | 2709 |
| 14 | Ga0068869_100470828 | 3300005334 | Bacteria | 1044 |
| 15 | Ga0068869_101968049 | 3300005334 | Unclassified | 524 |
| 16 | Ga0070666_10019547 | 3300005335 | Bacteria | 4374 |
| 17 | Ga0070682_101560229 | 3300005337 | Bacteria | 570 |
| 18 | Ga0068868_100009889 | 3300005338 | Bacteria | 6887 |
| 19 | Ga0068868_100164708 | 3300005338 | Bacteria | 1833 |
| 20 | Ga0068868_100205078 | 3300005338 | Bacteria | 1645 |
| 21 | Ga0068868_102145587 | 3300005338 | Bacteria | 532 |
| 22 | Ga0070660_100977385 | 3300005339 | Bacteria | 715 |
| 23 | Ga0070691_10605351 | 3300005341 | Bacteria | 647 |
| 24 | Ga0070661_100000236 | 3300005344 | Bacteria | 45535 |
| 25 | Ga0070692_10073668 | 3300005345 | Bacteria | 1825 |
| 26 | Ga0070692_10476939 | 3300005345 | Bacteria | 804 |
| 27 | Ga0070692_11051645 | 3300005345 | Unclassified | 572 |
| 28 | Ga0070668_100493835 | 3300005347 | Bacteria | 1059 |
| 29 | Ga0070669_100063717 | 3300005353 | Bacteria | 2714 |
| 30 | Ga0070669_101019536 | 3300005353 | Bacteria | 711 |
| 31 | Ga0070675_100000930 | 3300005354 | Bacteria | 20823 |
| 32 | Ga0070675_102137551 | 3300005354 | Bacteria | 516 |
| 33 | Ga0070673_100044186 | 3300005364 | Bacteria | 3449 |
| 34 | Ga0070673_100086451 | 3300005364 | Bacteria | 2555 |
| 35 | Ga0070688_100001088 | 3300005365 | Bacteria | 13570 |
| 36 | Ga0070688_100002914 | 3300005365 | Bacteria | 8725 |
| 37 | Ga0070703_10007328 | 3300005406 | Bacteria | 3095 |
| 38 | Ga0070703_10184774 | 3300005406 | Bacteria | 808 |
| 39 | Ga0070709_10158499 | 3300005434 | Bacteria | 1571 |
| 40 | Ga0070714_100156543 | 3300005435 | Bacteria | 2057 |
| 41 | Ga0070714_100461620 | 3300005435 | Bacteria | 1207 |
| 42 | Ga0070714_101102191 | 3300005435 | Bacteria | 774 |
| 43 | Ga0070713_100000171 | 3300005436 | Bacteria | 43503 |
| 44 | Ga0070713_101851106 | 3300005436 | Bacteria | 586 |
| 45 | Ga0070710_10006050 | 3300005437 | Bacteria | 5783 |
| 46 | Ga0070701_10131180 | 3300005438 | Bacteria | 1424 |
| 47 | Ga0070701_10252862 | 3300005438 | Bacteria | 1065 |
| 48 | Ga0070711_100056501 | 3300005439 | Bacteria | 2714 |
| 49 | Ga0070711_100098619 | 3300005439 | Bacteria | 2121 |
| 50 | Ga0070711_100612532 | 3300005439 | Bacteria | 909 |
| 51 | Ga0070705_100035023 | 3300005440 | Bacteria | 2811 |
| 52 | Ga0070705_100122688 | 3300005440 | Bacteria | 1680 |
| 53 | Ga0070705_100204040 | 3300005440 | Bacteria | 1358 |
| 54 | Ga0070705_101143965 | 3300005440 | Bacteria | 639 |
| 55 | Ga0070700_100676660 | 3300005441 | Bacteria | 818 |
| 56 | Ga0070700_101133611 | 3300005441 | Bacteria | 650 |
| 57 | Ga0070700_101417870 | 3300005441 | Bacteria | 588 |
| 58 | Ga0070700_101604509 | 3300005441 | Bacteria | 556 |
| 59 | Ga0070694_100071519 | 3300005444 | Bacteria | 2391 |
| 60 | Ga0070694_100729993 | 3300005444 | Bacteria | 807 |
| 61 | Ga0070708_100121070 | 3300005445 | Bacteria | 2414 |
| 62 | Ga0070708_100134963 | 3300005445 | Bacteria | 2285 |
| 63 | Ga0070708_100350232 | 3300005445 | Bacteria | 1392 |
| 64 | Ga0070708_101054884 | 3300005445 | Unclassified | 761 |
| 65 | Ga0070708_101261013 | 3300005445 | Bacteria | 691 |
| 66 | Ga0070663_100477590 | 3300005455 | Bacteria | 1031 |
| 67 | Ga0070678_100131979 | 3300005456 | Bacteria | 1986 |
| 68 | Ga0070662_101463766 | 3300005457 | Bacteria | 589 |
| 69 | Ga0068867_100877000 | 3300005459 | Unclassified | 806 |
| 70 | Ga0070685_10001772 | 3300005466 | Bacteria | 11292 |
| 71 | Ga0070685_10005627 | 3300005466 | Bacteria | 6358 |
| 72 | Ga0070706_100117116 | 3300005467 | Bacteria | 2482 |
| 73 | Ga0070706_100252762 | 3300005467 | Bacteria | 1645 |
| 74 | Ga0070706_100289770 | 3300005467 | Bacteria | 1528 |
| 75 | Ga0070706_100877895 | 3300005467 | Bacteria | 829 |
| 76 | Ga0070707_100006023 | 3300005468 | Bacteria | 11317 |
| 77 | Ga0070707_100156984 | 3300005468 | Bacteria | 2216 |
| 78 | Ga0070707_101108328 | 3300005468 | Bacteria | 758 |
| 79 | Ga0070698_100006728 | 3300005471 | Bacteria | 12464 |
| 80 | Ga0070698_100727932 | 3300005471 | Bacteria | 935 |
| 81 | Ga0070699_100058662 | 3300005518 | Bacteria | 3334 |
| 82 | Ga0070699_100066816 | 3300005518 | Bacteria | 3122 |
| 83 | Ga0070699_101543319 | 3300005518 | Bacteria | 609 |
| 84 | Ga0070679_100648220 | 3300005530 | Bacteria | 999 |
| 85 | Ga0070684_100034382 | 3300005535 | Bacteria | 4334 |
| 86 | Ga0070684_100149887 | 3300005535 | Bacteria | 2112 |
| 87 | Ga0070684_100714527 | 3300005535 | Bacteria | 935 |
| 88 | Ga0070697_100038883 | 3300005536 | Bacteria | 3845 |
| 89 | Ga0070697_100054355 | 3300005536 | Bacteria | 3254 |
| 90 | Ga0070697_100451571 | 3300005536 | Bacteria | 1120 |
| 91 | Ga0070697_100631526 | 3300005536 | Bacteria | 942 |
| 92 | Ga0068853_101241998 | 3300005539 | Bacteria | 720 |
| 93 | Ga0070686_100172281 | 3300005544 | Bacteria | 1532 |
| 94 | Ga0070686_100784541 | 3300005544 | Bacteria | 767 |
| 95 | Ga0070686_100957621 | 3300005544 | Bacteria | 700 |
| 96 | Ga0070695_100026750 | 3300005545 | Bacteria | 3571 |
| 97 | Ga0070695_100395740 | 3300005545 | Bacteria | 1046 |
| 98 | Ga0070695_100521999 | 3300005545 | Bacteria | 921 |
| 99 | Ga0070695_101137426 | 3300005545 | Unclassified | 640 |
| 100 | Ga0070696_100011377 | 3300005546 | Bacteria | 5960 |
| 101 | Ga0070696_100255569 | 3300005546 | Bacteria | 1326 |
| 102 | Ga0070696_101922975 | 3300005546 | Bacteria | 513 |
| 103 | Ga0070693_100046459 | 3300005547 | Bacteria | 2465 |
| 104 | Ga0070693_100544655 | 3300005547 | Bacteria | 830 |
| 105 | Ga0070665_100379163 | 3300005548 | Bacteria | 1421 |
| 106 | Ga0070704_100009153 | 3300005549 | Bacteria | 5973 |
| 107 | Ga0070704_100088096 | 3300005549 | Bacteria | 2305 |
| 108 | Ga0070704_100103630 | 3300005549 | Bacteria | 2149 |
| 109 | Ga0070704_100129977 | 3300005549 | Bacteria | 1950 |
| 110 | Ga0070704_100321630 | 3300005549 | Bacteria | 1296 |
| 111 | Ga0070704_100449151 | 3300005549 | Bacteria | 1110 |
| 112 | Ga0070704_101773973 | 3300005549 | Bacteria | 571 |
| 113 | Ga0070664_100027426 | 3300005564 | Bacteria | 4733 |
| 114 | Ga0068857_100858969 | 3300005577 | Bacteria | 869 |
| 115 | Ga0068856_100007453 | 3300005614 | Bacteria | 10677 |
| 116 | Ga0068856_100174723 | 3300005614 | Bacteria | 2160 |
| 117 | Ga0070702_100204009 | 3300005615 | Bacteria | 1311 |
| 118 | Ga0070702_100229270 | 3300005615 | Bacteria | 1247 |
| 119 | Ga0070702_100995384 | 3300005615 | Bacteria | 663 |
| 120 | Ga0068852_100001042 | 3300005616 | Bacteria | 18249 |
| 121 | Ga0068852_100048086 | 3300005616 | Bacteria | 3643 |
| 122 | Ga0068866_10097922 | 3300005718 | Bacteria | 1612 |
| 123 | Ga0068866_10517920 | 3300005718 | Bacteria | 792 |
| 124 | Ga0068866_10809845 | 3300005718 | Bacteria | 652 |
| 125 | Ga0068861_100320641 | 3300005719 | Bacteria | 1349 |
| 126 | Ga0068858_100225659 | 3300005842 | Bacteria | 1775 |
| 127 | Ga0068862_100374424 | 3300005844 | Bacteria | 1326 |
| 128 | Ga0081455_10063369 | 3300005937 | Bacteria | 3102 |
| 129 | Ga0081455_10088805 | 3300005937 | Bacteria | 2510 |
| 130 | Ga0081455_10094536 | 3300005937 | Bacteria | 2414 |
| 131 | Ga0081455_10163236 | 3300005937 | Bacteria | 1705 |
| 132 | Ga0081538_10028056 | 3300005981 | Bacteria | 3884 |
| 133 | Ga0081538_10177458 | 3300005981 | Bacteria | 918 |
| 134 | Ga0081538_10241763 | 3300005981 | Bacteria | 695 |
| 135 | Ga0081540_1082547 | 3300005983 | Bacteria | 1441 |
| 136 | Ga0081540_1130288 | 3300005983 | Bacteria | 1028 |
| 137 | Ga0081539_10002195 | 3300005985 | Bacteria | 28613 |
| 138 | Ga0081539_10053821 | 3300005985 | Bacteria | 2251 |
| 139 | Ga0070717_10326610 | 3300006028 | Bacteria | 1368 |
| 140 | Ga0075365_10000565 | 3300006038 | Bacteria | 14356 |
| 141 | Ga0075365_10147156 | 3300006038 | Bacteria | 1637 |
| 142 | Ga0075365_10966079 | 3300006038 | Bacteria | 600 |
| 143 | Ga0075365_11129796 | 3300006038 | Bacteria | 551 |
| 144 | Ga0075368_10042987 | 3300006042 | Bacteria | 1780 |
| 145 | Ga0075368_10418026 | 3300006042 | Bacteria | 591 |
| 146 | Ga0075363_100023094 | 3300006048 | Bacteria | 3149 |
| 147 | Ga0075363_100052586 | 3300006048 | Bacteria | 2174 |
| 148 | Ga0075363_100784876 | 3300006048 | Bacteria | 579 |
| 149 | Ga0075364_10020535 | 3300006051 | Bacteria | 4154 |
| 150 | Ga0075364_10469890 | 3300006051 | Bacteria | 859 |
| 151 | Ga0075364_10597025 | 3300006051 | Bacteria | 754 |
| 152 | Ga0075432_10138437 | 3300006058 | Bacteria | 927 |
| 153 | Ga0075432_10190440 | 3300006058 | Bacteria | 807 |
| 154 | Ga0070715_10018624 | 3300006163 | Bacteria | 2649 |
| 155 | Ga0070715_11052010 | 3300006163 | Bacteria | 510 |
| 156 | Ga0070716_100151956 | 3300006173 | Bacteria | 1490 |
| 157 | Ga0070716_100204582 | 3300006173 | Bacteria | 1315 |
| 158 | Ga0070712_100000350 | 3300006175 | Bacteria | 26114 |
| 159 | Ga0070712_100003252 | 3300006175 | Bacteria | 10001 |
| 160 | Ga0070712_100009426 | 3300006175 | Bacteria | 6153 |
| 161 | Ga0070712_100029957 | 3300006175 | Bacteria | 3652 |
| 162 | Ga0070712_100065918 | 3300006175 | Bacteria | 2572 |
| 163 | Ga0070712_100932696 | 3300006175 | Bacteria | 749 |
| 164 | Ga0070712_101066316 | 3300006175 | Bacteria | 700 |
| 165 | Ga0075367_10053516 | 3300006178 | Bacteria | 2392 |
| 166 | Ga0075367_10089759 | 3300006178 | Bacteria | 1868 |
| 167 | Ga0075367_10383939 | 3300006178 | Bacteria | 887 |
| 168 | Ga0068871_100608759 | 3300006358 | Bacteria | 994 |
| 169 | Ga0068871_101152747 | 3300006358 | Bacteria | 726 |
| 170 | Ga0075428_100106741 | 3300006844 | Bacteria | 3053 |
| 171 | Ga0075430_100064783 | 3300006846 | Bacteria | 3070 |
| 172 | Ga0075430_100296788 | 3300006846 | Bacteria | 1337 |
| 173 | Ga0075431_100008449 | 3300006847 | Bacteria | 10310 |
| 174 | Ga0075431_100128099 | 3300006847 | Bacteria | 2619 |
| 175 | Ga0075433_10124042 | 3300006852 | Bacteria | 2294 |
| 176 | Ga0075433_10127527 | 3300006852 | Bacteria | 2260 |
| 177 | Ga0075433_10142114 | 3300006852 | Bacteria | 2133 |
| 178 | Ga0075433_11221515 | 3300006852 | Unclassified | 652 |
| 179 | Ga0075434_100034388 | 3300006871 | Bacteria | 5005 |
| 180 | Ga0075434_100051811 | 3300006871 | Bacteria | 4078 |
| 181 | Ga0075434_100091140 | 3300006871 | Bacteria | 3050 |
| 182 | Ga0075434_100152574 | 3300006871 | Bacteria | 2330 |
| 183 | Ga0075434_100440922 | 3300006871 | Bacteria | 1323 |
| 184 | Ga0068865_100000056 | 3300006881 | Bacteria | 62122 |
| 185 | Ga0068865_100560365 | 3300006881 | Bacteria | 961 |
| 186 | Ga0075436_100015159 | 3300006914 | Bacteria | 5281 |
| 187 | Ga0075436_100023145 | 3300006914 | Bacteria | 4267 |
| 188 | Ga0075436_100089801 | 3300006914 | Bacteria | 2135 |
| 189 | Ga0075436_100501609 | 3300006914 | Bacteria | 888 |
| 190 | Ga0075435_100172450 | 3300007076 | Bacteria | 1825 |
| 191 | Ga0075435_100238820 | 3300007076 | Bacteria | 1545 |
| 192 | Ga0075435_100242104 | 3300007076 | Bacteria | 1534 |
| 193 | Ga0075435_100433442 | 3300007076 | Bacteria | 1133 |
| 194 | Ga0111539_10094044 | 3300009094 | Bacteria | 3521 |
| 195 | Ga0111539_10157492 | 3300009094 | Bacteria | 2657 |
| 196 | Ga0111539_11156386 | 3300009094 | Bacteria | 899 |
| 197 | Ga0111539_11201731 | 3300009094 | Bacteria | 881 |
| 198 | Ga0111539_11995575 | 3300009094 | Bacteria | 673 |
| 199 | Ga0105245_10000528 | 3300009098 | Bacteria | 35016 |
| 200 | Ga0105245_10132007 | 3300009098 | Bacteria | 2343 |
| 201 | Ga0105245_10622788 | 3300009098 | Bacteria | 1107 |
| 202 | Ga0105245_12882671 | 3300009098 | Unclassified | 533 |
| 203 | Ga0105247_10056313 | 3300009101 | Bacteria | 2428 |
| 204 | Ga0114129_10022048 | 3300009147 | Bacteria | 9039 |
| 205 | Ga0114129_10050964 | 3300009147 | Bacteria | 5812 |
| 206 | Ga0114129_10087401 | 3300009147 | Bacteria | 4323 |
| 207 | Ga0114129_10443919 | 3300009147 | Bacteria | 1703 |
| 208 | Ga0114129_10537753 | 3300009147 | Bacteria | 1521 |
| 209 | Ga0114129_10564660 | 3300009147 | Bacteria | 1478 |
| 210 | Ga0105243_10080350 | 3300009148 | Bacteria | 2659 |
| 211 | Ga0105243_10166998 | 3300009148 | Bacteria | 1903 |
| 212 | Ga0105243_10229273 | 3300009148 | Bacteria | 1647 |
| 213 | Ga0105243_10457294 | 3300009148 | Bacteria | 1199 |
| 214 | Ga0105243_11305037 | 3300009148 | Bacteria | 743 |
| 215 | Ga0105243_11552551 | 3300009148 | Bacteria | 687 |
| 216 | Ga0105241_10290918 | 3300009174 | Bacteria | 1399 |
| 217 | Ga0105241_10331846 | 3300009174 | Bacteria | 1315 |
| 218 | Ga0105241_10412507 | 3300009174 | Bacteria | 1187 |
| 219 | Ga0105242_10280358 | 3300009176 | Bacteria | 1513 |
| 220 | Ga0105242_10479491 | 3300009176 | Bacteria | 1178 |
| 221 | Ga0105248_10001735 | 3300009177 | Bacteria | 24226 |
| 222 | Ga0105237_10310730 | 3300009545 | Bacteria | 1579 |
| 223 | Ga0105237_10865772 | 3300009545 | Bacteria | 910 |
| 224 | Ga0105249_10192765 | 3300009553 | Bacteria | 1990 |
| 225 | Ga0105249_10887626 | 3300009553 | Bacteria | 958 |
| 226 | Ga0105249_11199002 | 3300009553 | Bacteria | 830 |
| 227 | Ga0105249_12323880 | 3300009553 | Bacteria | 609 |
| 228 | Ga0105249_13546368 | 3300009553 | Unclassified | 503 |
| 229 | Ga0105239_10328645 | 3300010375 | Bacteria | 1724 |
| 230 | Ga0105239_10348056 | 3300010375 | Bacteria | 1673 |
| 231 | Ga0105239_10555738 | 3300010375 | Bacteria | 1307 |
| 232 | Ga0105239_10567142 | 3300010375 | Bacteria | 1293 |
| 233 | Ga0105239_10965151 | 3300010375 | Bacteria | 979 |
| 234 | Ga0105239_11078077 | 3300010375 | Bacteria | 924 |
| 235 | Ga0105239_11864998 | 3300010375 | Bacteria | 697 |
| 236 | Ga0105239_12573573 | 3300010375 | Bacteria | 593 |
| 237 | Ga0105246_10017131 | 3300011119 | Bacteria | 4602 |
| 238 | Ga0105246_10233529 | 3300011119 | Bacteria | 1450 |
| 239 | Ga0105246_11443917 | 3300011119 | Bacteria | 644 |
| 240 | Ga0105246_11788921 | 3300011119 | Bacteria | 587 |
| 241 | Ga0157373_10703726 | 3300013100 | Bacteria | 740 |
| 242 | Ga0157371_11145618 | 3300013102 | Bacteria | 598 |
| 243 | Ga0157370_10059005 | 3300013104 | Bacteria | 3647 |
| 244 | Ga0157370_10132352 | 3300013104 | Bacteria | 2326 |
| 245 | Ga0157369_10000068 | 3300013105 | Bacteria | 144274 |
| 246 | Ga0157369_10893652 | 3300013105 | Bacteria | 911 |
| 247 | Ga0157378_10141934 | 3300013297 | Bacteria | 2231 |
| 248 | Ga0157378_10192377 | 3300013297 | Bacteria | 1925 |
| 249 | Ga0157378_10578015 | 3300013297 | Bacteria | 1132 |
| 250 | Ga0157378_11210205 | 3300013297 | Bacteria | 795 |
| 251 | Ga0157378_11392702 | 3300013297 | Bacteria | 744 |
| 252 | Ga0157378_11724797 | 3300013297 | Bacteria | 674 |
| 253 | Ga0157378_11752016 | 3300013297 | Bacteria | 669 |
| 254 | Ga0163162_10322361 | 3300013306 | Bacteria | 1678 |
| 255 | Ga0157375_10008331 | 3300013308 | Bacteria | 9080 |
| 256 | Ga0157375_10213663 | 3300013308 | Bacteria | 2086 |
| 257 | Ga0157375_10237203 | 3300013308 | Bacteria | 1983 |
| 258 | Ga0157375_10993375 | 3300013308 | Bacteria | 979 |
| 259 | Ga0157375_12354902 | 3300013308 | Bacteria | 635 |
| 260 | Ga0163163_10536951 | 3300014325 | Bacteria | 1232 |
| 261 | Ga0157380_10000808 | 3300014326 | Bacteria | 19608 |
| 262 | Ga0157380_10550426 | 3300014326 | Bacteria | 1132 |
| 263 | Ga0157380_12294680 | 3300014326 | Bacteria | 604 |
| 264 | Ga0157380_13452389 | 3300014326 | Bacteria | 506 |
| 265 | Ga0157377_10448849 | 3300014745 | Bacteria | 890 |
| 266 | Ga0157377_11330290 | 3300014745 | Bacteria | 563 |
| 267 | Ga0157376_10028182 | 3300014969 | Bacteria | 4461 |
| 268 | Ga0157376_10147888 | 3300014969 | Bacteria | 2115 |
| 269 | Ga0157376_10380065 | 3300014969 | Bacteria | 1360 |
| 270 | Ga0163161_10505855 | 3300017792 | Bacteria | 984 |
| 271 | Ga0163161_10637845 | 3300017792 | Bacteria | 882 |
| 272 | Ga0163161_11595992 | 3300017792 | Bacteria | 575 |
| 273 | Ga0206356_11367151 | 3300020070 | Bacteria | 599 |
| 274 | Ga0206351_10990872 | 3300020077 | Bacteria | 709 |
| 275 | Ga0206353_11038649 | 3300020082 | Bacteria | 834 |
| 276 | Ga0154015_1231294 | 3300020610 | Bacteria | 800 |
| 277 | Ga0224712_10379224 | 3300022467 | Bacteria | 672 |
| 278 | Ga0207653_10005876 | 3300025885 | Bacteria | 3829 |
| 279 | Ga0207653_10066321 | 3300025885 | Bacteria | 1227 |
| 280 | Ga0207692_10132901 | 3300025898 | Bacteria | 1407 |
| 281 | Ga0207692_10179751 | 3300025898 | Bacteria | 1232 |
| 282 | Ga0207642_10418196 | 3300025899 | Bacteria | 806 |
| 283 | Ga0207642_11155049 | 3300025899 | Bacteria | 502 |
| 284 | Ga0207710_10015681 | 3300025900 | Bacteria | 3205 |
| 285 | Ga0207688_10013692 | 3300025901 | Bacteria | 4409 |
| 286 | Ga0207680_10024081 | 3300025903 | Bacteria | 3335 |
| 287 | Ga0207647_10426568 | 3300025904 | Bacteria | 745 |
| 288 | Ga0207699_10432943 | 3300025906 | Bacteria | 941 |
| 289 | Ga0207699_10774554 | 3300025906 | Bacteria | 705 |
| 290 | Ga0207645_10754135 | 3300025907 | Bacteria | 662 |
| 291 | Ga0207705_10367017 | 3300025909 | Bacteria | 1111 |
| 292 | Ga0207684_10190082 | 3300025910 | Bacteria | 1771 |
| 293 | Ga0207684_10244393 | 3300025910 | Bacteria | 1548 |
| 294 | Ga0207684_10282097 | 3300025910 | Bacteria | 1432 |
| 295 | Ga0207684_10742203 | 3300025910 | Bacteria | 832 |
| 296 | Ga0207654_10054051 | 3300025911 | Bacteria | 2320 |
| 297 | Ga0207654_10227130 | 3300025911 | Bacteria | 1241 |
| 298 | Ga0207707_10557590 | 3300025912 | Bacteria | 973 |
| 299 | Ga0207693_10000138 | 3300025915 | Bacteria | 66126 |
| 300 | Ga0207693_10001647 | 3300025915 | Bacteria | 19699 |
| 301 | Ga0207693_10021106 | 3300025915 | Bacteria | 5177 |
| 302 | Ga0207693_10060283 | 3300025915 | Bacteria | 2972 |
| 303 | Ga0207693_10065127 | 3300025915 | Bacteria | 2854 |
| 304 | Ga0207693_10597914 | 3300025915 | Bacteria | 859 |
| 305 | Ga0207663_10076229 | 3300025916 | Bacteria | 2178 |
| 306 | Ga0207663_10230238 | 3300025916 | Bacteria | 1353 |
| 307 | Ga0207663_10330257 | 3300025916 | Bacteria | 1148 |
| 308 | Ga0207662_11367771 | 3300025918 | Unclassified | 503 |
| 309 | Ga0207649_10000388 | 3300025920 | Bacteria | 32980 |
| 310 | Ga0207646_10004454 | 3300025922 | Bacteria | 15188 |
| 311 | Ga0207646_10382546 | 3300025922 | Bacteria | 1271 |
| 312 | Ga0207646_10943370 | 3300025922 | Unclassified | 764 |
| 313 | Ga0207681_10050045 | 3300025923 | Bacteria | 2826 |
| 314 | Ga0207681_10808220 | 3300025923 | Bacteria | 783 |
| 315 | Ga0207650_10043384 | 3300025925 | Bacteria | 3301 |
| 316 | Ga0207659_10000138 | 3300025926 | Bacteria | 42755 |
| 317 | Ga0207687_10000025 | 3300025927 | Bacteria | 175177 |
| 318 | Ga0207687_10456365 | 3300025927 | Bacteria | 1061 |
| 319 | Ga0207700_10000019 | 3300025928 | Bacteria | 183117 |
| 320 | Ga0207664_10061436 | 3300025929 | Bacteria | 2997 |
| 321 | Ga0207664_10104740 | 3300025929 | Bacteria | 2343 |
| 322 | Ga0207664_10259621 | 3300025929 | Bacteria | 1519 |
| 323 | Ga0207664_11769777 | 3300025929 | Bacteria | 540 |
| 324 | Ga0207690_10008867 | 3300025932 | Bacteria | 5969 |
| 325 | Ga0207690_11284706 | 3300025932 | Bacteria | 612 |
| 326 | Ga0207706_10034080 | 3300025933 | Bacteria | 4531 |
| 327 | Ga0207706_10258717 | 3300025933 | Bacteria | 1520 |
| 328 | Ga0207686_10131073 | 3300025934 | Bacteria | 1720 |
| 329 | Ga0207686_10243650 | 3300025934 | Bacteria | 1310 |
| 330 | Ga0207686_10560266 | 3300025934 | Bacteria | 894 |
| 331 | Ga0207709_10040649 | 3300025935 | Bacteria | 2785 |
| 332 | Ga0207709_10259854 | 3300025935 | Bacteria | 1273 |
| 333 | Ga0207670_11556278 | 3300025936 | Bacteria | 562 |
| 334 | Ga0207704_10011990 | 3300025938 | Bacteria | 4287 |
| 335 | Ga0207704_10162270 | 3300025938 | Bacteria | 1592 |
| 336 | Ga0207665_10010210 | 3300025939 | Bacteria | 6166 |
| 337 | Ga0207665_10066182 | 3300025939 | Bacteria | 2459 |
| 338 | Ga0207665_10210172 | 3300025939 | Bacteria | 1421 |
| 339 | Ga0207711_10000011 | 3300025941 | Bacteria | 518817 |
| 340 | Ga0207711_10346335 | 3300025941 | Bacteria | 1376 |
| 341 | Ga0207689_10602784 | 3300025942 | Bacteria | 924 |
| 342 | Ga0207689_11352336 | 3300025942 | Unclassified | 598 |
| 343 | Ga0207661_10037906 | 3300025944 | Bacteria | 3774 |
| 344 | Ga0207661_10058350 | 3300025944 | Bacteria | 3105 |
| 345 | Ga0207661_10757864 | 3300025944 | Bacteria | 894 |
| 346 | Ga0207661_11804479 | 3300025944 | Bacteria | 557 |
| 347 | Ga0207679_10135579 | 3300025945 | Bacteria | 1982 |
| 348 | Ga0207679_12107399 | 3300025945 | Bacteria | 512 |
| 349 | Ga0207667_10863008 | 3300025949 | Bacteria | 899 |
| 350 | Ga0207651_10000746 | 3300025960 | Bacteria | 13950 |
| 351 | Ga0207651_11408593 | 3300025960 | Bacteria | 627 |
| 352 | Ga0207712_10129766 | 3300025961 | Bacteria | 1919 |
| 353 | Ga0207712_10424053 | 3300025961 | Bacteria | 1123 |
| 354 | Ga0207668_10058465 | 3300025972 | Bacteria | 2695 |
| 355 | Ga0207668_10248318 | 3300025972 | Bacteria | 1444 |
| 356 | Ga0207640_11533875 | 3300025981 | Bacteria | 599 |
| 357 | Ga0207658_10122209 | 3300025986 | Bacteria | 2078 |
| 358 | Ga0207677_10092907 | 3300026023 | Bacteria | 2198 |
| 359 | Ga0207703_10088903 | 3300026035 | Bacteria | 2594 |
| 360 | Ga0207639_10647150 | 3300026041 | Bacteria | 978 |
| 361 | Ga0207678_10554473 | 3300026067 | Bacteria | 1005 |
| 362 | Ga0207708_11136141 | 3300026075 | Bacteria | 682 |
| 363 | Ga0207708_11239234 | 3300026075 | Bacteria | 653 |
| 364 | Ga0207702_10006219 | 3300026078 | Bacteria | 10321 |
| 365 | Ga0207702_10015335 | 3300026078 | Bacteria | 6351 |
| 366 | Ga0207676_11217105 | 3300026095 | Bacteria | 747 |
| 367 | Ga0207675_100118172 | 3300026118 | Bacteria | 2507 |
| 368 | Ga0207683_10110663 | 3300026121 | Bacteria | 2459 |
| 369 | Ga0207698_10000014 | 3300026142 | Bacteria | 240703 |
| 370 | Ga0207698_10021851 | 3300026142 | Bacteria | 4433 |
| 371 | Ga0209813_10010836 | 3300027866 | Bacteria | 2369 |
| 372 | Ga0209813_10171859 | 3300027866 | Bacteria | 788 |
| 373 | Ga0207428_10480986 | 3300027907 | Bacteria | 903 |
| 374 | Ga0207428_10542292 | 3300027907 | Bacteria | 842 |
| 375 | Ga0207428_11048566 | 3300027907 | Bacteria | 571 |
| 376 | Ga0268266_10005543 | 3300028379 | Bacteria | 11749 |
| 377 | Ga0268266_11232049 | 3300028379 | Bacteria | 723 |
| 378 | Ga0268265_11048541 | 3300028380 | Bacteria | 807 |
| 379 | Ga0268264_10300719 | 3300028381 | Bacteria | 1510 |
| 380 | Ga0268264_10936880 | 3300028381 | Bacteria | 871 |
| 381 | Ga0265319_1000030 | 3300028563 | Bacteria | 129742 |
| 382 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 383 | Ga0307511_10074607 | 3300030521 | Bacteria | 2443 |
| 384 | Ga0265332_10222548 | 3300031238 | Bacteria | 783 |
| 385 | Ga0265325_10005113 | 3300031241 | Bacteria | 8165 |
| 386 | Ga0265331_10231032 | 3300031250 | Bacteria | 830 |
| 387 | Ga0307513_10200086 | 3300031456 | Bacteria | 1840 |
| 388 | Ga0307408_101398187 | 3300031548 | Bacteria | 659 |
| 389 | Ga0307408_101887029 | 3300031548 | Bacteria | 573 |
| 390 | Ga0307405_10096705 | 3300031731 | Bacteria | 1970 |
| 391 | Ga0307410_10426422 | 3300031852 | Bacteria | 1077 |
| 392 | Ga0307406_10166733 | 3300031901 | Bacteria | 1590 |
| 393 | Ga0307406_10367682 | 3300031901 | Bacteria | 1130 |
| 394 | Ga0307407_10172862 | 3300031903 | Bacteria | 1425 |
| 395 | Ga0307412_10579457 | 3300031911 | Bacteria | 947 |
| 396 | Ga0307416_101892741 | 3300032002 | Bacteria | 700 |
| 397 | Ga0307414_10622117 | 3300032004 | Bacteria | 971 |
| 398 | Ga0307415_100314408 | 3300032126 | Bacteria | 1303 |
| 399 | Ga0307415_102570228 | 3300032126 | Bacteria | 502 |
| 400 | Ga0373948_0212505 | 3300034817 | Bacteria | 509 |
| 401 | Ga0373928_0005114 | 3300035084 | Bacteria | 2502 |
| 402 | Ga0373929_0000967 | 3300035085 | Bacteria | 5589 |
| 403 | Ga0373940_0000176 | 3300035088 | Bacteria | 8559 |
| 404 | Ga0373949_0007429 | 3300035090 | Bacteria | 2398 |
| 405 | Ga0373951_0001169 | 3300035091 | Bacteria | 6935 |
| 406 | Ga0373952_0017206 | 3300035092 | Bacteria | 1480 |
| 407 | Ga0373932_0001381 | 3300035112 | Bacteria | 6813 |
| 408 | Ga0373939_0002086 | 3300035114 | Bacteria | 4764 |
| 409 | Ga0373941_0001669 | 3300035115 | Bacteria | 4747 |
| 410 | Ga0373960_0030906 | 3300035121 | Bacteria | 1494 |
| 411 | Ga0373943_0674392 | 3300035170 | Bacteria | 612 |
| 412 | Ga0373942_0001255 | 3300035207 | Bacteria | 6648 |
| 413 | Ga0373961_0001439 | 3300035241 | Bacteria | 7046 |
| 414 | Ga0373962_0001897 | 3300035242 | Bacteria | 4971 |
| 415 | Ga0373931_0000630 | 3300035691 | Bacteria | 14643 |
| 416 | Ga0395899_0070435 | 3300037312 | Bacteria | 2559 |
| 417 | Ga0395899_0161383 | 3300037312 | Bacteria | 1583 |
| 418 | Ga0395899_0408712 | 3300037312 | Bacteria | 897 |
| 419 | Ga0395899_0621570 | 3300037312 | Unclassified | 686 |
| 420 | Ga0395899_0821417 | 3300037312 | Bacteria | 573 |
| 421 | Ga0395900_0036001 | 3300037418 | Bacteria | 5100 |
| 422 | Ga0395900_0054715 | 3300037418 | Bacteria | 4109 |
| 423 | Ga0395900_0096582 | 3300037418 | Bacteria | 3036 |
| 424 | Ga0395900_0436233 | 3300037418 | Bacteria | 1268 |
| 425 | Ga0395900_0806103 | 3300037418 | Bacteria | 867 |
| 426 | Ga0395900_1183143 | 3300037418 | Bacteria | 680 |
| 427 | Ga0395900_1192074 | 3300037418 | Bacteria | 677 |
| 428 | Ga0395900_1353037 | 3300037418 | Bacteria | 625 |
| 429 | Ga0395900_1544628 | 3300037418 | Bacteria | 575 |
| 430 | Ga0395898_0004111 | 3300037466 | Bacteria | 15953 |
| 431 | Ga0395898_0017781 | 3300037466 | Bacteria | 7254 |
| 432 | Ga0395898_0093521 | 3300037466 | Bacteria | 2889 |
| 433 | Ga0395898_0368695 | 3300037466 | Bacteria | 1369 |
| 434 | Ga0395898_0422362 | 3300037466 | Bacteria | 1270 |
| 435 | Ga0395898_0800121 | 3300037466 | Bacteria | 883 |
| 436 | Ga0395898_0840806 | 3300037466 | Bacteria | 857 |
| 437 | Ga0395898_1136471 | 3300037466 | Bacteria | 714 |
| 438 | Ga0395898_1654159 | 3300037466 | Bacteria | 564 |
| 439 | Ga0395905_0013334 | 3300037471 | Bacteria | 7878 |
| 440 | Ga0395905_0035350 | 3300037471 | Bacteria | 4691 |
| 441 | Ga0395905_0334539 | 3300037471 | Bacteria | 1405 |
| 442 | Ga0395905_1076920 | 3300037471 | Bacteria | 707 |
| 443 | Ga0395905_1236591 | 3300037471 | Bacteria | 650 |
| 444 | Ga0395901_0012327 | 3300038443 | Bacteria | 8674 |
| 445 | Ga0395901_0039011 | 3300038443 | Bacteria | 4913 |
| 446 | Ga0395901_0045141 | 3300038443 | Bacteria | 4572 |
| 447 | Ga0395901_0065123 | 3300038443 | Bacteria | 3794 |
| 448 | Ga0395901_0393601 | 3300038443 | Bacteria | 1424 |
| 449 | Ga0395901_0531828 | 3300038443 | Bacteria | 1193 |
| 450 | Ga0395901_0685768 | 3300038443 | Bacteria | 1024 |
| 451 | Ga0395901_0703553 | 3300038443 | Bacteria | 1008 |
| 452 | Ga0395901_0876270 | 3300038443 | Bacteria | 881 |
| 453 | Ga0395901_1198073 | 3300038443 | Bacteria | 725 |
| 454 | Ga0395901_1268007 | 3300038443 | Bacteria | 700 |
| 455 | Ga0395901_1663469 | 3300038443 | Bacteria | 590 |
| 456 | Ga0395901_1835826 | 3300038443 | Bacteria | 555 |
| 457 | Ga0395901_2128435 | 3300038443 | Bacteria | 506 |
| 458 | Ga0242419_015744 | 3300038698 | Bacteria | 610 |
| 459 | Ga0242420_065698 | 3300038996 | Bacteria | 730 |
| 460 | Ga0436360_0813424 | 3300039438 | Bacteria | 1319 |
| 461 | Ga0436363_0233675 | 3300039450 | Bacteria | 527 |
| 462 | Ga0451789_0948123 | 3300041443 | Bacteria | 516 |
| 463 | Ga0451789_1125219 | 3300041443 | Unclassified | 849 |
| 464 | Ga0451793_1823140 | 3300041452 | Bacteria | 971 |
| 465 | Ga0451797_0568949 | 3300041453 | Bacteria | 634 |
| 466 | Ga0451797_1592023 | 3300041453 | Bacteria | 834 |
| 467 | Ga0451798_0120783 | 3300041458 | Bacteria | 1489 |
| 468 | Ga0451800_0962893 | 3300041459 | Bacteria | 1231 |
| 469 | Ga0451800_1521351 | 3300041459 | Bacteria | 676 |
| 470 | Ga0451800_1531549 | 3300041459 | Bacteria | 578 |
| 471 | Ga0451807_2459553 | 3300041486 | Bacteria | 1023 |
| 472 | Ga0451807_2753639 | 3300041486 | Bacteria | 1312 |
| 473 | Ga0451835_0584404 | 3300041492 | Unclassified | 632 |
| 474 | Ga0451839_0104030 | 3300041496 | Bacteria | 553 |
| 475 | Ga0451839_1482669 | 3300041496 | Bacteria | 984 |
| 476 | Ga0451845_0690341 | 3300041501 | Bacteria | 1079 |
| 477 | Ga0451847_0533480 | 3300041503 | Bacteria | 659 |
| 478 | Ga0451847_1017840 | 3300041503 | Bacteria | 634 |
| 479 | Ga0451849_0015521 | 3300041505 | Bacteria | 1558 |
| 480 | Ga0451851_1071820 | 3300041507 | Bacteria | 837 |
| 481 | Ga0451843_0971763 | 3300041509 | Bacteria | 621 |
| 482 | Ga0451855_1128345 | 3300041511 | Bacteria | 812 |
| 483 | Ga0451853_0363567 | 3300041512 | Bacteria | 571 |
| 484 | Ga0451853_0696920 | 3300041512 | Bacteria | 795 |
| 485 | Ga0466972_0611188 | 3300044658 | Bacteria | 516 |
| 486 | Ga0466972_0623909 | 3300044658 | Bacteria | 510 |
| 487 | Ga0466965_0041809 | 3300044683 | Bacteria | 2259 |
| 488 | Ga0466965_0474984 | 3300044683 | Bacteria | 699 |
| 489 | Ga0466963_0000325 | 3300044694 | Bacteria | 21618 |
| 490 | Ga0466963_0091504 | 3300044694 | Bacteria | 2072 |
| 491 | Ga0466963_0148465 | 3300044694 | Bacteria | 1627 |
| 492 | Ga0466963_0189816 | 3300044694 | Bacteria | 1435 |
| 493 | Ga0466963_0243841 | 3300044694 | Bacteria | 1260 |
| 494 | Ga0466963_0802790 | 3300044694 | Bacteria | 664 |
| 495 | Ga0466963_1243059 | 3300044694 | Bacteria | 523 |
| 496 | Ga0466964_0012715 | 3300044706 | Bacteria | 3186 |
| 497 | Ga0466964_0699786 | 3300044706 | Bacteria | 565 |
| 498 | Ga0466971_0484410 | 3300044719 | Bacteria | 609 |
| 499 | Ga0466968_0092224 | 3300044735 | Bacteria | 1344 |
| 500 | Ga0466957_0001797 | 3300044842 | Bacteria | 11298 |
| 501 | Ga0466957_0047130 | 3300044842 | Bacteria | 2618 |
| 502 | Ga0466957_0249760 | 3300044842 | Bacteria | 1179 |
| 503 | Ga0466957_0312582 | 3300044842 | Bacteria | 1058 |
| 504 | Ga0466960_0027831 | 3300044901 | Bacteria | 2582 |
| 505 | Ga0466960_0326107 | 3300044901 | Bacteria | 871 |
| 506 | Ga0466960_0458185 | 3300044901 | Bacteria | 742 |
| 507 | Ga0466959_0157928 | 3300045049 | Bacteria | 1595 |
| 508 | Ga0466959_0651993 | 3300045049 | Unclassified | 707 |
| 509 | Ga0466967_0000003 | 3300045976 | Bacteria | 169144 |
| 510 | Ga0466967_0016300 | 3300045976 | Bacteria | 5855 |
| 511 | Ga0466967_0078881 | 3300045976 | Bacteria | 2967 |
| 512 | Ga0466967_0174648 | 3300045976 | Bacteria | 2023 |
| 513 | Ga0466967_0180576 | 3300045976 | Bacteria | 1990 |
| 514 | Ga0466967_0246362 | 3300045976 | Bacteria | 1705 |
| 515 | Ga0466967_0305451 | 3300045976 | Bacteria | 1531 |
| 516 | Ga0466967_0713344 | 3300045976 | Bacteria | 994 |
| 517 | Ga0466967_1164310 | 3300045976 | Unclassified | 768 |
| 518 | Ga0466967_1828363 | 3300045976 | Bacteria | 604 |
| 519 | Ga0466967_1901317 | 3300045976 | Bacteria | 592 |
| 520 | Ga0466967_2041674 | 3300045976 | Bacteria | 570 |
| 521 | Ga0495592_0379127 | 3300046454 | Bacteria | 900 |
| 522 | Ga0495603_0016811 | 3300046455 | Bacteria | 4426 |
| 523 | Ga0495603_0354205 | 3300046455 | Bacteria | 842 |
| 524 | Ga0495629_0000543 | 3300046459 | Bacteria | 31107 |
| 525 | Ga0495629_0004371 | 3300046459 | Bacteria | 10589 |
| 526 | Ga0495629_0012223 | 3300046459 | Bacteria | 6217 |
| 527 | Ga0495638_0020983 | 3300046460 | Bacteria | 4312 |
| 528 | Ga0495641_0224857 | 3300046461 | Bacteria | 842 |
| 529 | Ga0495651_0498329 | 3300046462 | Bacteria | 780 |
| 530 | Ga0495582_0102203 | 3300046473 | Bacteria | 1605 |
| 531 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 532 | Ga0495606_0000283 | 3300046507 | Bacteria | 88309 |
| 533 | Ga0495610_0195216 | 3300046512 | Bacteria | 833 |
| 534 | Ga0495620_0132685 | 3300046515 | Bacteria | 977 |
| 535 | Ga0495628_0551123 | 3300046516 | Bacteria | 828 |
| 536 | Ga0495630_0000148 | 3300046517 | Bacteria | 54619 |
| 537 | Ga0495630_0058503 | 3300046517 | Bacteria | 2890 |
| 538 | Ga0495632_0365621 | 3300046519 | Unclassified | 633 |
| 539 | Ga0495637_0269230 | 3300046520 | Bacteria | 610 |
| 540 | Ga0495663_0049848 | 3300046525 | Bacteria | 1294 |
| 541 | Ga0495587_0004030 | 3300046536 | Bacteria | 9732 |
| 542 | Ga0495609_0168465 | 3300046538 | Bacteria | 926 |
| 543 | Ga0495622_0000069 | 3300046557 | Bacteria | 89759 |
| 544 | Ga0495667_0000067 | 3300046559 | Bacteria | 81751 |
| 545 | Ga0495668_0495013 | 3300046616 | Bacteria | 674 |
| 546 | Ga0495635_0988306 | 3300046663 | Bacteria | 536 |
| 547 | Ga0495661_0182597 | 3300046665 | Bacteria | 1111 |
| 548 | Ga0495588_0000175 | 3300046674 | Bacteria | 80911 |
| 549 | Ga0495647_0000114 | 3300046681 | Bacteria | 20349 |
| 550 | Ga0495658_0001193 | 3300046683 | Bacteria | 13694 |
| 551 | Ga0495669_0145768 | 3300046684 | Bacteria | 1119 |
| 552 | Ga0495613_0000087 | 3300046689 | Bacteria | 88644 |
| 553 | Ga0495613_0438326 | 3300046689 | Unclassified | 886 |
| 554 | Ga0495624_0000429 | 3300046690 | Bacteria | 33305 |
| 555 | Ga0495624_0903785 | 3300046690 | Bacteria | 520 |
| 556 | Ga0495600_0199436 | 3300046809 | Bacteria | 1285 |
| 557 | Ga0495660_0280070 | 3300046810 | Bacteria | 763 |
| 558 | Ga0495604_0000294 | 3300047317 | Bacteria | 44723 |
| 559 | Ga0495604_0000322 | 3300047317 | Bacteria | 42966 |
| 560 | Ga0495676_0012216 | 3300047321 | Bacteria | 7743 |
| 561 | Ga0495676_0256531 | 3300047321 | Bacteria | 1191 |
| 562 | Ga0495680_0009089 | 3300047322 | Bacteria | 8968 |
| 563 | Ga0495680_0009545 | 3300047322 | Bacteria | 8718 |
| 564 | Ga0495679_159480 | 3300047446 | Bacteria | 603 |
| 565 | Ga0495686_0195056 | 3300047472 | Bacteria | 1165 |
| 566 | Ga0495602_0098658 | 3300048088 | Bacteria | 2403 |
| 567 | Ga0495614_0361580 | 3300048089 | Bacteria | 678 |
| 568 | Ga0496101_0098373 | 3300048904 | Bacteria | 2186 |
| 569 | Ga0496101_0261993 | 3300048904 | Bacteria | 1348 |
| 570 | Ga0496102_0205724 | 3300048905 | Bacteria | 1856 |
| 571 | Ga0496102_0443144 | 3300048905 | Bacteria | 1218 |
| 572 | Ga0496102_0676422 | 3300048905 | Bacteria | 955 |
| 573 | Ga0496103_0054861 | 3300048906 | Bacteria | 2470 |
| 574 | Ga0496103_0161620 | 3300048906 | Bacteria | 1437 |
| 575 | Ga0496103_0727147 | 3300048906 | Bacteria | 628 |
| 576 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 577 | Ga0496104_0014298 | 3300048907 | Bacteria | 7166 |
| 578 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 579 | Ga0496105_0016825 | 3300048908 | Bacteria | 5847 |
| 580 | Ga0496105_0582714 | 3300048908 | Bacteria | 870 |
| 581 | Ga0496106_0007093 | 3300048909 | Bacteria | 8281 |
| 582 | Ga0496106_0053622 | 3300048909 | Bacteria | 3046 |
| 583 | Ga0496106_0083694 | 3300048909 | Bacteria | 2454 |
| 584 | Ga0496106_0090380 | 3300048909 | Bacteria | 2363 |
| 585 | Ga0496106_0427825 | 3300048909 | Bacteria | 1064 |
| 586 | Ga0496106_1425971 | 3300048909 | Bacteria | 534 |
| 587 | Ga0496107_0003048 | 3300048910 | Bacteria | 11115 |
| 588 | Ga0496107_0102247 | 3300048910 | Bacteria | 2101 |
| 589 | Ga0496108_0000042 | 3300048911 | Bacteria | 146397 |
| 590 | Ga0496108_0025650 | 3300048911 | Bacteria | 4859 |
| 591 | Ga0496108_0146414 | 3300048911 | Bacteria | 2036 |
| 592 | Ga0496108_0146776 | 3300048911 | Bacteria | 2034 |
| 593 | Ga0496108_0688821 | 3300048911 | Bacteria | 887 |
| 594 | Ga0496109_0000034 | 3300048912 | Bacteria | 160397 |
| 595 | Ga0496109_0000062 | 3300048912 | Bacteria | 112843 |
| 596 | Ga0496109_0047839 | 3300048912 | Bacteria | 3890 |
| 597 | Ga0496109_0048581 | 3300048912 | Bacteria | 3861 |
| 598 | Ga0496109_0244706 | 3300048912 | Bacteria | 1688 |
| 599 | Ga0496109_0345152 | 3300048912 | Bacteria | 1406 |
| 600 | Ga0496110_0000325 | 3300048913 | Bacteria | 31707 |
| 601 | Ga0496110_0033230 | 3300048913 | Bacteria | 4460 |
| 602 | Ga0496110_0322477 | 3300048913 | Bacteria | 1407 |
| 603 | Ga0496111_0000171 | 3300048914 | Bacteria | 29367 |
| 604 | Ga0496111_0019086 | 3300048914 | Bacteria | 4757 |
| 605 | Ga0496111_0130566 | 3300048914 | Bacteria | 1859 |
| 606 | Ga0496111_0171265 | 3300048914 | Bacteria | 1613 |
| 607 | Ga0496112_0007934 | 3300048915 | Bacteria | 9463 |
| 608 | Ga0496112_0116679 | 3300048915 | Bacteria | 2640 |
| 609 | Ga0496112_0162496 | 3300048915 | Bacteria | 2200 |
| 610 | Ga0496112_0205890 | 3300048915 | Bacteria | 1925 |
| 611 | Ga0496112_0506865 | 3300048915 | Bacteria | 1142 |
| 612 | Ga0496112_0556271 | 3300048915 | Bacteria | 1081 |
| 613 | Ga0496112_0927707 | 3300048915 | Bacteria | 792 |
| 614 | Ga0496113_0000002 | 3300048916 | Bacteria | 220193 |
| 615 | Ga0496113_0152946 | 3300048916 | Bacteria | 1821 |
| 616 | Ga0496113_0332367 | 3300048916 | Bacteria | 1218 |
| 617 | Ga0496113_1195833 | 3300048916 | Bacteria | 594 |
| 618 | Ga0496114_0044319 | 3300048917 | Bacteria | 3690 |
| 619 | Ga0496114_1763687 | 3300048917 | Bacteria | 507 |
| 620 | Ga0496115_0000005 | 3300048918 | Bacteria | 290756 |
| 621 | Ga0496115_0059791 | 3300048918 | Bacteria | 3069 |
| 622 | Ga0496115_0849892 | 3300048918 | Bacteria | 707 |
| 623 | Ga0496115_1430136 | 3300048918 | Bacteria | 509 |
| 624 | Ga0496119_0008336 | 3300048922 | Bacteria | 9135 |
| 625 | Ga0496120_0024517 | 3300048923 | Bacteria | 3760 |
| 626 | Ga0496124_0339239 | 3300048927 | Bacteria | 1068 |
| 627 | Ga0496126_0061679 | 3300048929 | Bacteria | 3367 |
| 628 | Ga0501034_0081325 | 3300049571 | Bacteria | 3242 |
| 629 | Ga0501040_0254900 | 3300049576 | Bacteria | 1252 |
| 630 | Ga0501041_0683370 | 3300049577 | Bacteria | 657 |
| 631 | Ga0501042_0168994 | 3300049578 | Bacteria | 1578 |
| 632 | Ga0501042_0868902 | 3300049578 | Bacteria | 657 |
| 633 | Ga0501067_0072151 | 3300049583 | Bacteria | 1913 |
| 634 | Ga0501068_0510074 | 3300049584 | Bacteria | 780 |
| 635 | Ga0501069_0037955 | 3300049585 | Bacteria | 2658 |
| 636 | Ga0501069_0675716 | 3300049585 | Bacteria | 622 |
| 637 | Ga0501070_0045138 | 3300049586 | Bacteria | 3665 |
| 638 | Ga0501070_0119369 | 3300049586 | Bacteria | 2179 |
| 639 | Ga0501071_0116010 | 3300049587 | Bacteria | 1982 |
| 640 | Ga0501071_1423026 | 3300049587 | Bacteria | 535 |
| 641 | Ga0501072_0103023 | 3300049588 | Bacteria | 2268 |
| 642 | Ga0501072_0990683 | 3300049588 | Bacteria | 655 |
| 643 | Ga0501073_0065086 | 3300049589 | Bacteria | 2542 |
| 644 | Ga0501074_0080523 | 3300049590 | Bacteria | 2336 |
| 645 | Ga0501074_1078343 | 3300049590 | Bacteria | 564 |
| 646 | Ga0501075_1163576 | 3300049591 | Bacteria | 585 |
| 647 | Ga0501076_0052178 | 3300049592 | Bacteria | 3239 |
| 648 | Ga0501076_0540301 | 3300049592 | Bacteria | 961 |
| 649 | Ga0501223_047693 | 3300049663 | Bacteria | 831 |
| 650 | Ga0501080_0010572 | 3300049742 | Bacteria | 8449 |
| 651 | Ga0501081_0549433 | 3300049743 | Bacteria | 863 |
| 652 | Ga0501083_0059117 | 3300049744 | Bacteria | 2564 |
| 653 | Ga0501045_0648123 | 3300049824 | Bacteria | 781 |
| 654 | nmdc:mga03n38_46532_c1 | 3300050490 | Bacteria | 1916 |
| 655 | nmdc:mga03n38_74187_c1 | 3300050490 | Bacteria | 1582 |
| 656 | nmdc:mga03n38_912434_c1 | 3300050490 | Bacteria | 517 |
| 657 | nmdc:mga00v17_277105_c1 | 3300050491 | Bacteria | 1089 |
| 658 | nmdc:mga00v17_293610_c1 | 3300050491 | Bacteria | 1056 |
| 659 | nmdc:mga00v17_794267_c1 | 3300050491 | Bacteria | 603 |
| 660 | nmdc:mga0yw44_1227_c1 | 3300050492 | Bacteria | 10057 |
| 661 | nmdc:mga06z11_426041_c1 | 3300050494 | Bacteria | 800 |
| 662 | nmdc:mga06z11_470878_c1 | 3300050494 | Bacteria | 760 |
| 663 | nmdc:mga06z11_775005_c1 | 3300050494 | Archaea | 584 |
| 664 | nmdc:mga04h51_66654_c1 | 3300050495 | Bacteria | 1247 |
| 665 | nmdc:mga05p37_1389666_c1 | 3300050507 | Bacteria | 708 |
| 666 | nmdc:mga05p37_242619_c1 | 3300050507 | Bacteria | 2165 |
| 667 | nmdc:mga05p37_27608_c1 | 3300050507 | Bacteria | 6913 |
| 668 | nmdc:mga05p37_30668_c1 | 3300050507 | Bacteria | 4211 |
| 669 | nmdc:mga05p37_343611_c1 | 3300050507 | Bacteria | 1759 |
| 670 | nmdc:mga05p37_526288_c1 | 3300050507 | Bacteria | 1351 |
| 671 | nmdc:mga05p37_780875_c1 | 3300050507 | Bacteria | 1048 |
| 672 | nmdc:mga0qj67_251293_c1 | 3300050509 | Bacteria | 1435 |
| 673 | nmdc:mga06r32_133354_c1 | 3300050510 | Bacteria | 2458 |
| 674 | nmdc:mga06r32_137843_c1 | 3300050510 | Bacteria | 2415 |
| 675 | nmdc:mga08y16_186554_c1 | 3300050511 | Bacteria | 2152 |
| 676 | nmdc:mga08y16_279757_c1 | 3300050511 | Bacteria | 1721 |
| 677 | nmdc:mga08y16_69250_c1 | 3300050511 | Bacteria | 3678 |
| 678 | nmdc:mga0n895_124212_c1 | 3300050512 | Bacteria | 2604 |
| 679 | nmdc:mga0n895_221072_c1 | 3300050512 | Bacteria | 1923 |
| 680 | nmdc:mga0n895_221321_c1 | 3300050512 | Bacteria | 1922 |
| 681 | nmdc:mga0n895_300014_c1 | 3300050512 | Bacteria | 1629 |
| 682 | nmdc:mga0n895_304789_c1 | 3300050512 | Bacteria | 1615 |
| 683 | nmdc:mga0rr50_164353_c1 | 3300050513 | Bacteria | 1804 |
| 684 | nmdc:mga0rr50_352212_c1 | 3300050513 | Bacteria | 1238 |
| 685 | nmdc:mga0rr50_607137_c1 | 3300050513 | Bacteria | 933 |
| 686 | nmdc:mga0rr50_900039_c1 | 3300050513 | Bacteria | 755 |
| 687 | nmdc:mga08x19_20160_c1 | 3300050514 | Bacteria | 4104 |
| 688 | nmdc:mga08x19_218667_c2 | 3300050514 | Bacteria | 867 |
| 689 | nmdc:mga0a205_269804_c1 | 3300050515 | Bacteria | 1579 |
| 690 | nmdc:mga0a205_330056_c1 | 3300050515 | Bacteria | 1395 |
| 691 | nmdc:mga0a205_39097_c1 | 3300050515 | Bacteria | 4566 |
| 692 | nmdc:mga0a205_391337_c1 | 3300050515 | Bacteria | 1254 |
| 693 | nmdc:mga0a205_483808_c1 | 3300050515 | Bacteria | 1096 |
| 694 | nmdc:mga0a205_76480_c1 | 3300050515 | Bacteria | 3235 |
| 695 | nmdc:mga0a205_787049_c1 | 3300050515 | Bacteria | 799 |
| 696 | Ga0495601_0000065 | 3300053077 | Bacteria | 58386 |
| 697 | Ga0495601_0615364 | 3300053077 | Bacteria | 696 |
| 698 | Ga0495612_0004181 | 3300053078 | Bacteria | 5986 |
| 699 | Ga0495612_0127430 | 3300053078 | Bacteria | 1098 |
| 700 | Ga0495655_0001612 | 3300053083 | Bacteria | 3478 |
| 701 | Ga0500566_0001523 | 3300053094 | Bacteria | 13612 |
| 702 | Ga0500641_0001013 | 3300053096 | Bacteria | 9986 |
| 703 | Ga0587070_237860 | 3300059491 | Bacteria | 501 |
| 704 | Ga0587082_172648 | 3300059504 | Bacteria | 525 |
| 705 | Ga0587083_0170895 | 3300059505 | Bacteria | 602 |
| 706 | Ga0587088_157147 | 3300059508 | Bacteria | 554 |
| 707 | Ga0587122_014059 | 3300059628 | Bacteria | 803 |
| 708 | Ga0587128_131078 | 3300059630 | Bacteria | 555 |
| 709 | Ga0587062_142422 | 3300059639 | Bacteria | 501 |
| 710 | Ga0587075_131115 | 3300059644 | Bacteria | 528 |
| 711 | Ga0587107_110780 | 3300059652 | Bacteria | 555 |
| 712 | Ga0530510_0442489 | 3300061734 | Bacteria | 982 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037466 | Ga0395898_0800121 | Ga0395898_0800121_447_743 | 85 |
| 2 | 3300038443 | Ga0395901_0531828 | Ga0395901_0531828_735_1031 | 85 |
| 3 | 3300038996 | Ga0242420_065698 | Ga0242420_065698_99_362 | 86 |
| 4 | 3300044901 | Ga0466960_0458185 | Ga0466960_0458185_12_275 | 86 |
| 5 | 3300050509 | nmdc:mga0qj67_251293_c1 | nmdc:mga0qj67_251293_c1_299_568 | 87 |
| 6 | 3300050510 | nmdc:mga06r32_137843_c1 | nmdc:mga06r32_137843_c1_382_651 | 87 |
| 7 | 3300009147 | Ga0114129_10050964 | Ga0114129_100509646 | 92 |
| 8 | 3300009553 | Ga0105249_10887626 | Ga0105249_108876262 | 92 |
| 9 | 3300011119 | Ga0105246_11443917 | Ga0105246_114439172 | 92 |
| 10 | 3300044719 | Ga0466971_0484410 | Ga0466971_0484410_315_599 | 92 |
| 11 | 3300049590 | Ga0501074_1078343 | Ga0501074_1078343_11_292 | 92 |
| 12 | 3300049663 | Ga0501223_047693 | Ga0501223_047693_32_331 | 92 |
| 13 | 3300032126 | Ga0307415_100314408 | Ga0307415_1003144082 | 94 |
| 14 | 3300005334 | Ga0068869_100470828 | Ga0068869_1004708282 | 96 |
| 15 | 3300005337 | Ga0070682_101560229 | Ga0070682_1015602292 | 96 |
| 16 | 3300005338 | Ga0068868_100205078 | Ga0068868_1002050782 | 96 |
| 17 | 3300005339 | Ga0070660_100977385 | Ga0070660_1009773852 | 96 |
| 18 | 3300005341 | Ga0070691_10605351 | Ga0070691_106053512 | 96 |
| 19 | 3300005345 | Ga0070692_10476939 | Ga0070692_104769392 | 96 |
| 20 | 3300005347 | Ga0070668_100493835 | Ga0070668_1004938352 | 96 |
| 21 | 3300005353 | Ga0070669_101019536 | Ga0070669_1010195361 | 96 |
| 22 | 3300005364 | Ga0070673_100086451 | Ga0070673_1000864513 | 96 |
| 23 | 3300005406 | Ga0070703_10007328 | Ga0070703_100073285 | 96 |
| 24 | 3300005406 | Ga0070703_10184774 | Ga0070703_101847742 | 96 |
| 25 | 3300005434 | Ga0070709_10158499 | Ga0070709_101584992 | 96 |
| 26 | 3300005435 | Ga0070714_100461620 | Ga0070714_1004616202 | 96 |
| 27 | 3300005435 | Ga0070714_101102191 | Ga0070714_1011021912 | 96 |
| 28 | 3300005436 | Ga0070713_101851106 | Ga0070713_1018511062 | 96 |
| 29 | 3300005437 | Ga0070710_10006050 | Ga0070710_100060506 | 96 |
| 30 | 3300005438 | Ga0070701_10131180 | Ga0070701_101311802 | 96 |
| 31 | 3300005439 | Ga0070711_100056501 | Ga0070711_1000565014 | 96 |
| 32 | 3300005439 | Ga0070711_100098619 | Ga0070711_1000986193 | 96 |
| 33 | 3300005439 | Ga0070711_100612532 | Ga0070711_1006125322 | 96 |
| 34 | 3300005440 | Ga0070705_100035023 | Ga0070705_1000350233 | 96 |
| 35 | 3300005440 | Ga0070705_100122688 | Ga0070705_1001226882 | 96 |
| 36 | 3300005441 | Ga0070700_100676660 | Ga0070700_1006766602 | 96 |
| 37 | 3300005441 | Ga0070700_101604509 | Ga0070700_1016045091 | 96 |
| 38 | 3300005444 | Ga0070694_100071519 | Ga0070694_1000715193 | 96 |
| 39 | 3300005444 | Ga0070694_100729993 | Ga0070694_1007299932 | 96 |
| 40 | 3300005445 | Ga0070708_100121070 | Ga0070708_1001210704 | 96 |
| 41 | 3300005445 | Ga0070708_100134963 | Ga0070708_1001349632 | 96 |
| 42 | 3300005445 | Ga0070708_101054884 | Ga0070708_1010548842 | 96 |
| 43 | 3300005445 | Ga0070708_101261013 | Ga0070708_1012610132 | 96 |
| 44 | 3300005456 | Ga0070678_100131979 | Ga0070678_1001319793 | 96 |
| 45 | 3300005457 | Ga0070662_101463766 | Ga0070662_1014637662 | 96 |
| 46 | 3300005467 | Ga0070706_100117116 | Ga0070706_1001171163 | 96 |
| 47 | 3300005467 | Ga0070706_100252762 | Ga0070706_1002527622 | 96 |
| 48 | 3300005467 | Ga0070706_100289770 | Ga0070706_1002897702 | 96 |
| 49 | 3300005467 | Ga0070706_100877895 | Ga0070706_1008778952 | 96 |
| 50 | 3300005468 | Ga0070707_100006023 | Ga0070707_10000602319 | 96 |
| 51 | 3300005468 | Ga0070707_100156984 | Ga0070707_1001569843 | 96 |
| 52 | 3300005468 | Ga0070707_101108328 | Ga0070707_1011083282 | 96 |
| 53 | 3300005471 | Ga0070698_100006728 | Ga0070698_1000067286 | 96 |
| 54 | 3300005471 | Ga0070698_100727932 | Ga0070698_1007279322 | 96 |
| 55 | 3300005518 | Ga0070699_100058662 | Ga0070699_1000586625 | 96 |
| 56 | 3300005518 | Ga0070699_100066816 | Ga0070699_1000668163 | 96 |
| 57 | 3300005518 | Ga0070699_101543319 | Ga0070699_1015433191 | 96 |
| 58 | 3300005536 | Ga0070697_100038883 | Ga0070697_1000388832 | 96 |
| 59 | 3300005536 | Ga0070697_100054355 | Ga0070697_1000543552 | 96 |
| 60 | 3300005536 | Ga0070697_100451571 | Ga0070697_1004515712 | 96 |
| 61 | 3300005536 | Ga0070697_100631526 | Ga0070697_1006315261 | 96 |
| 62 | 3300005545 | Ga0070695_100026750 | Ga0070695_1000267503 | 96 |
| 63 | 3300005545 | Ga0070695_100521999 | Ga0070695_1005219992 | 96 |
| 64 | 3300005546 | Ga0070696_100011377 | Ga0070696_1000113775 | 96 |
| 65 | 3300005546 | Ga0070696_100255569 | Ga0070696_1002555692 | 96 |
| 66 | 3300005546 | Ga0070696_101922975 | Ga0070696_1019229751 | 96 |
| 67 | 3300005547 | Ga0070693_100046459 | Ga0070693_1000464592 | 96 |
| 68 | 3300005549 | Ga0070704_100088096 | Ga0070704_1000880962 | 96 |
| 69 | 3300005549 | Ga0070704_100103630 | Ga0070704_1001036302 | 96 |
| 70 | 3300005549 | Ga0070704_100321630 | Ga0070704_1003216301 | 96 |
| 71 | 3300005549 | Ga0070704_101773973 | Ga0070704_1017739731 | 96 |
| 72 | 3300005615 | Ga0070702_100229270 | Ga0070702_1002292702 | 96 |
| 73 | 3300005718 | Ga0068866_10097922 | Ga0068866_100979223 | 96 |
| 74 | 3300005718 | Ga0068866_10517920 | Ga0068866_105179202 | 96 |
| 75 | 3300005719 | Ga0068861_100320641 | Ga0068861_1003206412 | 96 |
| 76 | 3300005844 | Ga0068862_100374424 | Ga0068862_1003744242 | 96 |
| 77 | 3300006028 | Ga0070717_10326610 | Ga0070717_103266102 | 96 |
| 78 | 3300006058 | Ga0075432_10138437 | Ga0075432_101384372 | 96 |
| 79 | 3300006058 | Ga0075432_10190440 | Ga0075432_101904402 | 96 |
| 80 | 3300006163 | Ga0070715_10018624 | Ga0070715_100186244 | 96 |
| 81 | 3300006173 | Ga0070716_100151956 | Ga0070716_1001519562 | 96 |
| 82 | 3300006173 | Ga0070716_100204582 | Ga0070716_1002045823 | 96 |
| 83 | 3300006175 | Ga0070712_100009426 | Ga0070712_1000094262 | 96 |
| 84 | 3300006175 | Ga0070712_100029957 | Ga0070712_1000299574 | 96 |
| 85 | 3300006175 | Ga0070712_100065918 | Ga0070712_1000659184 | 96 |
| 86 | 3300006175 | Ga0070712_100932696 | Ga0070712_1009326962 | 96 |
| 87 | 3300006175 | Ga0070712_101066316 | Ga0070712_1010663162 | 96 |
| 88 | 3300006844 | Ga0075428_100106741 | Ga0075428_1001067415 | 96 |
| 89 | 3300006852 | Ga0075433_10124042 | Ga0075433_101240425 | 96 |
| 90 | 3300006852 | Ga0075433_10142114 | Ga0075433_101421142 | 96 |
| 91 | 3300006871 | Ga0075434_100091140 | Ga0075434_1000911405 | 96 |
| 92 | 3300006871 | Ga0075434_100152574 | Ga0075434_1001525743 | 96 |
| 93 | 3300006871 | Ga0075434_100440922 | Ga0075434_1004409222 | 96 |
| 94 | 3300006914 | Ga0075436_100015159 | Ga0075436_1000151595 | 96 |
| 95 | 3300006914 | Ga0075436_100023145 | Ga0075436_1000231452 | 96 |
| 96 | 3300006914 | Ga0075436_100089801 | Ga0075436_1000898012 | 96 |
| 97 | 3300007076 | Ga0075435_100172450 | Ga0075435_1001724502 | 96 |
| 98 | 3300007076 | Ga0075435_100242104 | Ga0075435_1002421042 | 96 |
| 99 | 3300007076 | Ga0075435_100433442 | Ga0075435_1004334422 | 96 |
| 100 | 3300009094 | Ga0111539_11156386 | Ga0111539_111563862 | 96 |
| 101 | 3300009098 | Ga0105245_10132007 | Ga0105245_101320074 | 96 |
| 102 | 3300009098 | Ga0105245_10622788 | Ga0105245_106227882 | 96 |
| 103 | 3300009147 | Ga0114129_10022048 | Ga0114129_1002204812 | 96 |
| 104 | 3300009147 | Ga0114129_10564660 | Ga0114129_105646602 | 96 |
| 105 | 3300009148 | Ga0105243_10166998 | Ga0105243_101669982 | 96 |
| 106 | 3300009148 | Ga0105243_10457294 | Ga0105243_104572942 | 96 |
| 107 | 3300009174 | Ga0105241_10331846 | Ga0105241_103318462 | 96 |
| 108 | 3300009174 | Ga0105241_10412507 | Ga0105241_104125072 | 96 |
| 109 | 3300009176 | Ga0105242_10280358 | Ga0105242_102803583 | 96 |
| 110 | 3300009545 | Ga0105237_10310730 | Ga0105237_103107303 | 96 |
| 111 | 3300009553 | Ga0105249_10192765 | Ga0105249_101927653 | 96 |
| 112 | 3300009553 | Ga0105249_11199002 | Ga0105249_111990022 | 96 |
| 113 | 3300010375 | Ga0105239_11078077 | Ga0105239_110780772 | 96 |
| 114 | 3300011119 | Ga0105246_10233529 | Ga0105246_102335292 | 96 |
| 115 | 3300013297 | Ga0157378_11210205 | Ga0157378_112102052 | 96 |
| 116 | 3300013297 | Ga0157378_11392702 | Ga0157378_113927022 | 96 |
| 117 | 3300013308 | Ga0157375_10213663 | Ga0157375_102136632 | 96 |
| 118 | 3300014745 | Ga0157377_10448849 | Ga0157377_104488492 | 96 |
| 119 | 3300014969 | Ga0157376_10147888 | Ga0157376_101478883 | 96 |
| 120 | 3300017792 | Ga0163161_10505855 | Ga0163161_105058551 | 96 |
| 121 | 3300025885 | Ga0207653_10005876 | Ga0207653_100058765 | 96 |
| 122 | 3300025885 | Ga0207653_10066321 | Ga0207653_100663212 | 96 |
| 123 | 3300025898 | Ga0207692_10179751 | Ga0207692_101797512 | 96 |
| 124 | 3300025899 | Ga0207642_10418196 | Ga0207642_104181962 | 96 |
| 125 | 3300025901 | Ga0207688_10013692 | Ga0207688_100136922 | 96 |
| 126 | 3300025906 | Ga0207699_10432943 | Ga0207699_104329432 | 96 |
| 127 | 3300025906 | Ga0207699_10774554 | Ga0207699_107745542 | 96 |
| 128 | 3300025907 | Ga0207645_10754135 | Ga0207645_107541352 | 96 |
| 129 | 3300025910 | Ga0207684_10190082 | Ga0207684_101900822 | 96 |
| 130 | 3300025910 | Ga0207684_10244393 | Ga0207684_102443933 | 96 |
| 131 | 3300025910 | Ga0207684_10282097 | Ga0207684_102820973 | 96 |
| 132 | 3300025910 | Ga0207684_10742203 | Ga0207684_107422031 | 96 |
| 133 | 3300025911 | Ga0207654_10227130 | Ga0207654_102271302 | 96 |
| 134 | 3300025915 | Ga0207693_10021106 | Ga0207693_100211066 | 96 |
| 135 | 3300025915 | Ga0207693_10060283 | Ga0207693_100602833 | 96 |
| 136 | 3300025915 | Ga0207693_10065127 | Ga0207693_100651272 | 96 |
| 137 | 3300025915 | Ga0207693_10597914 | Ga0207693_105979142 | 96 |
| 138 | 3300025916 | Ga0207663_10076229 | Ga0207663_100762292 | 96 |
| 139 | 3300025916 | Ga0207663_10230238 | Ga0207663_102302382 | 96 |
| 140 | 3300025916 | Ga0207663_10330257 | Ga0207663_103302572 | 96 |
| 141 | 3300025922 | Ga0207646_10004454 | Ga0207646_1000445420 | 96 |
| 142 | 3300025922 | Ga0207646_10382546 | Ga0207646_103825461 | 96 |
| 143 | 3300025922 | Ga0207646_10943370 | Ga0207646_109433701 | 96 |
| 144 | 3300025923 | Ga0207681_10808220 | Ga0207681_108082202 | 96 |
| 145 | 3300025927 | Ga0207687_10456365 | Ga0207687_104563652 | 96 |
| 146 | 3300025929 | Ga0207664_10061436 | Ga0207664_100614364 | 96 |
| 147 | 3300025929 | Ga0207664_11769777 | Ga0207664_117697772 | 96 |
| 148 | 3300025933 | Ga0207706_10258717 | Ga0207706_102587172 | 96 |
| 149 | 3300025934 | Ga0207686_10131073 | Ga0207686_101310731 | 96 |
| 150 | 3300025934 | Ga0207686_10243650 | Ga0207686_102436502 | 96 |
| 151 | 3300025935 | Ga0207709_10259854 | Ga0207709_102598542 | 96 |
| 152 | 3300025936 | Ga0207670_11556278 | Ga0207670_115562782 | 96 |
| 153 | 3300025939 | Ga0207665_10010210 | Ga0207665_100102109 | 96 |
| 154 | 3300025939 | Ga0207665_10066182 | Ga0207665_100661822 | 96 |
| 155 | 3300025939 | Ga0207665_10210172 | Ga0207665_102101723 | 96 |
| 156 | 3300025942 | Ga0207689_10602784 | Ga0207689_106027842 | 96 |
| 157 | 3300025960 | Ga0207651_11408593 | Ga0207651_114085932 | 96 |
| 158 | 3300025961 | Ga0207712_10424053 | Ga0207712_104240531 | 96 |
| 159 | 3300025972 | Ga0207668_10248318 | Ga0207668_102483183 | 96 |
| 160 | 3300026075 | Ga0207708_11239234 | Ga0207708_112392342 | 96 |
| 161 | 3300026095 | Ga0207676_11217105 | Ga0207676_112171052 | 96 |
| 162 | 3300026118 | Ga0207675_100118172 | Ga0207675_1001181722 | 96 |
| 163 | 3300026121 | Ga0207683_10110663 | Ga0207683_101106632 | 96 |
| 164 | 3300027907 | Ga0207428_10542292 | Ga0207428_105422922 | 96 |
| 165 | 3300028380 | Ga0268265_11048541 | Ga0268265_110485412 | 96 |
| 166 | 3300028381 | Ga0268264_10300719 | Ga0268264_103007193 | 96 |
| 167 | 3300034817 | Ga0373948_0212505 | Ga0373948_0212505_162_461 | 96 |
| 168 | 3300035084 | Ga0373928_0005114 | Ga0373928_0005114_1655_1954 | 96 |
| 169 | 3300035085 | Ga0373929_0000967 | Ga0373929_0000967_63_362 | 96 |
| 170 | 3300035088 | Ga0373940_0000176 | Ga0373940_0000176_2732_3031 | 96 |
| 171 | 3300035090 | Ga0373949_0007429 | Ga0373949_0007429_1781_2080 | 96 |
| 172 | 3300035091 | Ga0373951_0001169 | Ga0373951_0001169_3914_4213 | 96 |
| 173 | 3300035092 | Ga0373952_0017206 | Ga0373952_0017206_508_807 | 96 |
| 174 | 3300035112 | Ga0373932_0001381 | Ga0373932_0001381_4849_5148 | 96 |
| 175 | 3300035114 | Ga0373939_0002086 | Ga0373939_0002086_1122_1421 | 96 |
| 176 | 3300035115 | Ga0373941_0001669 | Ga0373941_0001669_764_1063 | 96 |
| 177 | 3300035121 | Ga0373960_0030906 | Ga0373960_0030906_616_915 | 96 |
| 178 | 3300035207 | Ga0373942_0001255 | Ga0373942_0001255_2629_2928 | 96 |
| 179 | 3300035241 | Ga0373961_0001439 | Ga0373961_0001439_1382_1681 | 96 |
| 180 | 3300035242 | Ga0373962_0001897 | Ga0373962_0001897_504_803 | 96 |
| 181 | 3300035691 | Ga0373931_0000630 | Ga0373931_0000630_12780_13079 | 96 |
| 182 | 3300037312 | Ga0395899_0070435 | Ga0395899_0070435_1034_1333 | 96 |
| 183 | 3300037312 | Ga0395899_0408712 | Ga0395899_0408712_576_875 | 96 |
| 184 | 3300037418 | Ga0395900_0036001 | Ga0395900_0036001_3703_4002 | 96 |
| 185 | 3300037418 | Ga0395900_0096582 | Ga0395900_0096582_1839_2138 | 96 |
| 186 | 3300037418 | Ga0395900_0436233 | Ga0395900_0436233_168_467 | 96 |
| 187 | 3300037418 | Ga0395900_1353037 | Ga0395900_1353037_179_478 | 96 |
| 188 | 3300037466 | Ga0395898_0004111 | Ga0395898_0004111_5554_5853 | 96 |
| 189 | 3300037466 | Ga0395898_0093521 | Ga0395898_0093521_2003_2302 | 96 |
| 190 | 3300037466 | Ga0395898_0422362 | Ga0395898_0422362_164_463 | 96 |
| 191 | 3300037471 | Ga0395905_0035350 | Ga0395905_0035350_3166_3465 | 96 |
| 192 | 3300037471 | Ga0395905_1236591 | Ga0395905_1236591_28_327 | 96 |
| 193 | 3300038443 | Ga0395901_0039011 | Ga0395901_0039011_2450_2749 | 96 |
| 194 | 3300038443 | Ga0395901_0065123 | Ga0395901_0065123_2050_2349 | 96 |
| 195 | 3300038443 | Ga0395901_0393601 | Ga0395901_0393601_1064_1363 | 96 |
| 196 | 3300038443 | Ga0395901_0876270 | Ga0395901_0876270_231_530 | 96 |
| 197 | 3300038443 | Ga0395901_1198073 | Ga0395901_1198073_84_383 | 96 |
| 198 | 3300038443 | Ga0395901_1268007 | Ga0395901_1268007_177_476 | 96 |
| 199 | 3300038698 | Ga0242419_015744 | Ga0242419_015744_205_504 | 96 |
| 200 | 3300041443 | Ga0451789_0948123 | Ga0451789_0948123_24_323 | 96 |
| 201 | 3300041443 | Ga0451789_1125219 | Ga0451789_1125219_361_660 | 96 |
| 202 | 3300041452 | Ga0451793_1823140 | Ga0451793_1823140_201_500 | 96 |
| 203 | 3300041453 | Ga0451797_0568949 | Ga0451797_0568949_249_548 | 96 |
| 204 | 3300041453 | Ga0451797_1592023 | Ga0451797_1592023_320_619 | 96 |
| 205 | 3300041458 | Ga0451798_0120783 | Ga0451798_0120783_377_676 | 96 |
| 206 | 3300041459 | Ga0451800_0962893 | Ga0451800_0962893_690_989 | 96 |
| 207 | 3300041459 | Ga0451800_1521351 | Ga0451800_1521351_72_371 | 96 |
| 208 | 3300041492 | Ga0451835_0584404 | Ga0451835_0584404_268_567 | 96 |
| 209 | 3300041496 | Ga0451839_1482669 | Ga0451839_1482669_435_734 | 96 |
| 210 | 3300041501 | Ga0451845_0690341 | Ga0451845_0690341_369_668 | 96 |
| 211 | 3300041503 | Ga0451847_0533480 | Ga0451847_0533480_290_589 | 96 |
| 212 | 3300041503 | Ga0451847_1017840 | Ga0451847_1017840_60_353 | 96 |
| 213 | 3300041505 | Ga0451849_0015521 | Ga0451849_0015521_443_742 | 96 |
| 214 | 3300041507 | Ga0451851_1071820 | Ga0451851_1071820_471_770 | 96 |
| 215 | 3300041511 | Ga0451855_1128345 | Ga0451855_1128345_390_689 | 96 |
| 216 | 3300041512 | Ga0451853_0696920 | Ga0451853_0696920_353_646 | 96 |
| 217 | 3300044658 | Ga0466972_0623909 | Ga0466972_0623909_88_387 | 96 |
| 218 | 3300044706 | Ga0466964_0012715 | Ga0466964_0012715_2677_2976 | 96 |
| 219 | 3300044901 | Ga0466960_0027831 | Ga0466960_0027831_1906_2205 | 96 |
| 220 | 3300045976 | Ga0466967_0016300 | Ga0466967_0016300_685_984 | 96 |
| 221 | 3300046455 | Ga0495603_0016811 | Ga0495603_0016811_2749_3048 | 96 |
| 222 | 3300046473 | Ga0495582_0102203 | Ga0495582_0102203_1273_1572 | 96 |
| 223 | 3300046538 | Ga0495609_0168465 | Ga0495609_0168465_136_435 | 96 |
| 224 | 3300048904 | Ga0496101_0098373 | Ga0496101_0098373_1108_1407 | 96 |
| 225 | 3300048904 | Ga0496101_0261993 | Ga0496101_0261993_234_533 | 96 |
| 226 | 3300048905 | Ga0496102_0205724 | Ga0496102_0205724_857_1156 | 96 |
| 227 | 3300048905 | Ga0496102_0443144 | Ga0496102_0443144_819_1118 | 96 |
| 228 | 3300048906 | Ga0496103_0054861 | Ga0496103_0054861_1602_1901 | 96 |
| 229 | 3300048906 | Ga0496103_0727147 | Ga0496103_0727147_282_581 | 96 |
| 230 | 3300048907 | Ga0496104_0014298 | Ga0496104_0014298_1479_1778 | 96 |
| 231 | 3300048908 | Ga0496105_0016825 | Ga0496105_0016825_697_996 | 96 |
| 232 | 3300048909 | Ga0496106_0007093 | Ga0496106_0007093_7883_8182 | 96 |
| 233 | 3300048909 | Ga0496106_0090380 | Ga0496106_0090380_467_766 | 96 |
| 234 | 3300048909 | Ga0496106_1425971 | Ga0496106_1425971_147_446 | 96 |
| 235 | 3300048910 | Ga0496107_0003048 | Ga0496107_0003048_3136_3435 | 96 |
| 236 | 3300048911 | Ga0496108_0025650 | Ga0496108_0025650_3124_3423 | 96 |
| 237 | 3300048912 | Ga0496109_0048581 | Ga0496109_0048581_223_522 | 96 |
| 238 | 3300048912 | Ga0496109_0244706 | Ga0496109_0244706_1268_1567 | 96 |
| 239 | 3300048912 | Ga0496109_0345152 | Ga0496109_0345152_815_1114 | 96 |
| 240 | 3300048913 | Ga0496110_0033230 | Ga0496110_0033230_2493_2792 | 96 |
| 241 | 3300048913 | Ga0496110_0322477 | Ga0496110_0322477_224_523 | 96 |
| 242 | 3300048914 | Ga0496111_0130566 | Ga0496111_0130566_1501_1800 | 96 |
| 243 | 3300048914 | Ga0496111_0171265 | Ga0496111_0171265_1268_1567 | 96 |
| 244 | 3300048915 | Ga0496112_0162496 | Ga0496112_0162496_176_475 | 96 |
| 245 | 3300048915 | Ga0496112_0205890 | Ga0496112_0205890_570_869 | 96 |
| 246 | 3300048915 | Ga0496112_0556271 | Ga0496112_0556271_102_401 | 96 |
| 247 | 3300048916 | Ga0496113_0332367 | Ga0496113_0332367_101_400 | 96 |
| 248 | 3300048916 | Ga0496113_1195833 | Ga0496113_1195833_184_483 | 96 |
| 249 | 3300048917 | Ga0496114_0044319 | Ga0496114_0044319_47_346 | 96 |
| 250 | 3300048918 | Ga0496115_0059791 | Ga0496115_0059791_1117_1416 | 96 |
| 251 | 3300048918 | Ga0496115_0849892 | Ga0496115_0849892_218_517 | 96 |
| 252 | 3300048918 | Ga0496115_1430136 | Ga0496115_1430136_27_326 | 96 |
| 253 | 3300050490 | nmdc:mga03n38_912434_c1 | nmdc:mga03n38_912434_c1_26_316 | 96 |
| 254 | 3300050494 | nmdc:mga06z11_775005_c1 | nmdc:mga06z11_775005_c1_122_412 | 96 |
| 255 | 3300050507 | nmdc:mga05p37_27608_c1 | nmdc:mga05p37_27608_c1_897_1196 | 96 |
| 256 | 3300050507 | nmdc:mga05p37_30668_c1 | nmdc:mga05p37_30668_c1_2273_2572 | 96 |
| 257 | 3300050511 | nmdc:mga08y16_186554_c1 | nmdc:mga08y16_186554_c1_157_456 | 96 |
| 258 | 3300050512 | nmdc:mga0n895_124212_c1 | nmdc:mga0n895_124212_c1_2178_2477 | 96 |
| 259 | 3300050512 | nmdc:mga0n895_221321_c1 | nmdc:mga0n895_221321_c1_697_996 | 96 |
| 260 | 3300050512 | nmdc:mga0n895_300014_c1 | nmdc:mga0n895_300014_c1_1295_1594 | 96 |
| 261 | 3300050513 | nmdc:mga0rr50_164353_c1 | nmdc:mga0rr50_164353_c1_92_391 | 96 |
| 262 | 3300050513 | nmdc:mga0rr50_900039_c1 | nmdc:mga0rr50_900039_c1_421_720 | 96 |
| 263 | 3300050514 | nmdc:mga08x19_20160_c1 | nmdc:mga08x19_20160_c1_2793_3092 | 96 |
| 264 | 3300050514 | nmdc:mga08x19_218667_c2 | nmdc:mga08x19_218667_c2_82_381 | 96 |
| 265 | 3300050515 | nmdc:mga0a205_269804_c1 | nmdc:mga0a205_269804_c1_158_457 | 96 |
| 266 | 3300050515 | nmdc:mga0a205_330056_c1 | nmdc:mga0a205_330056_c1_322_621 | 96 |
| 267 | 3300050515 | nmdc:mga0a205_39097_c1 | nmdc:mga0a205_39097_c1_2155_2454 | 96 |
| 268 | 3300059628 | Ga0587122_014059 | Ga0587122_014059_99_398 | 96 |
| 269 | 3300001979 | JGI24740J21852_10003124 | JGI24740J21852_1000312411 | 97 |
| 270 | 3300002074 | JGI24748J21848_1000332 | JGI24748J21848_10003326 | 97 |
| 271 | 3300002239 | JGI24034J26672_10000068 | JGI24034J26672_1000006825 | 97 |
| 272 | 3300002244 | JGI24742J22300_10000389 | JGI24742J22300_100003895 | 97 |
| 273 | 3300003203 | JGI25406J46586_10046371 | JGI25406J46586_100463712 | 97 |
| 274 | 3300005327 | Ga0070658_10460061 | Ga0070658_104600612 | 97 |
| 275 | 3300005327 | Ga0070658_11417642 | Ga0070658_114176422 | 97 |
| 276 | 3300005329 | Ga0070683_100066804 | Ga0070683_1000668045 | 97 |
| 277 | 3300005329 | Ga0070683_100138936 | Ga0070683_1001389364 | 97 |
| 278 | 3300005329 | Ga0070683_100733551 | Ga0070683_1007335512 | 97 |
| 279 | 3300005329 | Ga0070683_100737480 | Ga0070683_1007374802 | 97 |
| 280 | 3300005329 | Ga0070683_100935600 | Ga0070683_1009356002 | 97 |
| 281 | 3300005331 | Ga0070670_100085569 | Ga0070670_1000855693 | 97 |
| 282 | 3300005334 | Ga0068869_101968049 | Ga0068869_1019680492 | 97 |
| 283 | 3300005335 | Ga0070666_10019547 | Ga0070666_100195475 | 97 |
| 284 | 3300005338 | Ga0068868_100009889 | Ga0068868_1000098894 | 97 |
| 285 | 3300005338 | Ga0068868_100164708 | Ga0068868_1001647083 | 97 |
| 286 | 3300005338 | Ga0068868_102145587 | Ga0068868_1021455872 | 97 |
| 287 | 3300005344 | Ga0070661_100000236 | Ga0070661_10000023638 | 97 |
| 288 | 3300005345 | Ga0070692_10073668 | Ga0070692_100736682 | 97 |
| 289 | 3300005345 | Ga0070692_11051645 | Ga0070692_110516452 | 97 |
| 290 | 3300005353 | Ga0070669_100063717 | Ga0070669_1000637174 | 97 |
| 291 | 3300005354 | Ga0070675_100000930 | Ga0070675_10000093010 | 97 |
| 292 | 3300005354 | Ga0070675_102137551 | Ga0070675_1021375511 | 97 |
| 293 | 3300005364 | Ga0070673_100044186 | Ga0070673_1000441865 | 97 |
| 294 | 3300005365 | Ga0070688_100001088 | Ga0070688_1000010887 | 97 |
| 295 | 3300005365 | Ga0070688_100002914 | Ga0070688_1000029147 | 97 |
| 296 | 3300005435 | Ga0070714_100156543 | Ga0070714_1001565433 | 97 |
| 297 | 3300005436 | Ga0070713_100000171 | Ga0070713_10000017156 | 97 |
| 298 | 3300005438 | Ga0070701_10252862 | Ga0070701_102528622 | 97 |
| 299 | 3300005440 | Ga0070705_100204040 | Ga0070705_1002040402 | 97 |
| 300 | 3300005440 | Ga0070705_101143965 | Ga0070705_1011439651 | 97 |
| 301 | 3300005441 | Ga0070700_101133611 | Ga0070700_1011336112 | 97 |
| 302 | 3300005441 | Ga0070700_101417870 | Ga0070700_1014178702 | 97 |
| 303 | 3300005445 | Ga0070708_100350232 | Ga0070708_1003502322 | 97 |
| 304 | 3300005455 | Ga0070663_100477590 | Ga0070663_1004775902 | 97 |
| 305 | 3300005459 | Ga0068867_100877000 | Ga0068867_1008770002 | 97 |
| 306 | 3300005466 | Ga0070685_10001772 | Ga0070685_100017726 | 97 |
| 307 | 3300005466 | Ga0070685_10005627 | Ga0070685_100056276 | 97 |
| 308 | 3300005530 | Ga0070679_100648220 | Ga0070679_1006482202 | 97 |
| 309 | 3300005535 | Ga0070684_100034382 | Ga0070684_1000343828 | 97 |
| 310 | 3300005535 | Ga0070684_100149887 | Ga0070684_1001498872 | 97 |
| 311 | 3300005535 | Ga0070684_100714527 | Ga0070684_1007145272 | 97 |
| 312 | 3300005539 | Ga0068853_101241998 | Ga0068853_1012419982 | 97 |
| 313 | 3300005544 | Ga0070686_100172281 | Ga0070686_1001722813 | 97 |
| 314 | 3300005544 | Ga0070686_100784541 | Ga0070686_1007845412 | 97 |
| 315 | 3300005544 | Ga0070686_100957621 | Ga0070686_1009576212 | 97 |
| 316 | 3300005545 | Ga0070695_100395740 | Ga0070695_1003957402 | 97 |
| 317 | 3300005545 | Ga0070695_101137426 | Ga0070695_1011374262 | 97 |
| 318 | 3300005547 | Ga0070693_100544655 | Ga0070693_1005446552 | 97 |
| 319 | 3300005548 | Ga0070665_100379163 | Ga0070665_1003791633 | 97 |
| 320 | 3300005549 | Ga0070704_100009153 | Ga0070704_1000091536 | 97 |
| 321 | 3300005549 | Ga0070704_100129977 | Ga0070704_1001299771 | 97 |
| 322 | 3300005549 | Ga0070704_100449151 | Ga0070704_1004491511 | 97 |
| 323 | 3300005564 | Ga0070664_100027426 | Ga0070664_1000274266 | 97 |
| 324 | 3300005577 | Ga0068857_100858969 | Ga0068857_1008589692 | 97 |
| 325 | 3300005614 | Ga0068856_100007453 | Ga0068856_1000074536 | 97 |
| 326 | 3300005614 | Ga0068856_100174723 | Ga0068856_1001747233 | 97 |
| 327 | 3300005615 | Ga0070702_100204009 | Ga0070702_1002040092 | 97 |
| 328 | 3300005615 | Ga0070702_100995384 | Ga0070702_1009953842 | 97 |
| 329 | 3300005616 | Ga0068852_100001042 | Ga0068852_10000104216 | 97 |
| 330 | 3300005616 | Ga0068852_100048086 | Ga0068852_1000480864 | 97 |
| 331 | 3300005718 | Ga0068866_10809845 | Ga0068866_108098451 | 97 |
| 332 | 3300005842 | Ga0068858_100225659 | Ga0068858_1002256593 | 97 |
| 333 | 3300005937 | Ga0081455_10063369 | Ga0081455_100633692 | 97 |
| 334 | 3300005937 | Ga0081455_10088805 | Ga0081455_100888052 | 97 |
| 335 | 3300005937 | Ga0081455_10094536 | Ga0081455_100945362 | 97 |
| 336 | 3300005937 | Ga0081455_10163236 | Ga0081455_101632362 | 97 |
| 337 | 3300005981 | Ga0081538_10028056 | Ga0081538_100280565 | 97 |
| 338 | 3300005981 | Ga0081538_10177458 | Ga0081538_101774582 | 97 |
| 339 | 3300005981 | Ga0081538_10241763 | Ga0081538_102417631 | 97 |
| 340 | 3300005983 | Ga0081540_1082547 | Ga0081540_10825473 | 97 |
| 341 | 3300005983 | Ga0081540_1130288 | Ga0081540_11302882 | 97 |
| 342 | 3300005985 | Ga0081539_10002195 | Ga0081539_1000219514 | 97 |
| 343 | 3300005985 | Ga0081539_10053821 | Ga0081539_100538212 | 97 |
| 344 | 3300006038 | Ga0075365_10000565 | Ga0075365_100005656 | 97 |
| 345 | 3300006038 | Ga0075365_10147156 | Ga0075365_101471562 | 97 |
| 346 | 3300006038 | Ga0075365_10966079 | Ga0075365_109660792 | 97 |
| 347 | 3300006038 | Ga0075365_11129796 | Ga0075365_111297962 | 97 |
| 348 | 3300006042 | Ga0075368_10042987 | Ga0075368_100429874 | 97 |
| 349 | 3300006042 | Ga0075368_10418026 | Ga0075368_104180262 | 97 |
| 350 | 3300006048 | Ga0075363_100023094 | Ga0075363_1000230945 | 97 |
| 351 | 3300006048 | Ga0075363_100052586 | Ga0075363_1000525862 | 97 |
| 352 | 3300006048 | Ga0075363_100784876 | Ga0075363_1007848761 | 97 |
| 353 | 3300006051 | Ga0075364_10020535 | Ga0075364_100205352 | 97 |
| 354 | 3300006051 | Ga0075364_10469890 | Ga0075364_104698902 | 97 |
| 355 | 3300006051 | Ga0075364_10597025 | Ga0075364_105970252 | 97 |
| 356 | 3300006163 | Ga0070715_11052010 | Ga0070715_110520101 | 97 |
| 357 | 3300006175 | Ga0070712_100000350 | Ga0070712_10000035031 | 97 |
| 358 | 3300006175 | Ga0070712_100003252 | Ga0070712_10000325218 | 97 |
| 359 | 3300006178 | Ga0075367_10053516 | Ga0075367_100535162 | 97 |
| 360 | 3300006178 | Ga0075367_10089759 | Ga0075367_100897594 | 97 |
| 361 | 3300006178 | Ga0075367_10383939 | Ga0075367_103839392 | 97 |
| 362 | 3300006358 | Ga0068871_100608759 | Ga0068871_1006087592 | 97 |
| 363 | 3300006358 | Ga0068871_101152747 | Ga0068871_1011527471 | 97 |
| 364 | 3300006846 | Ga0075430_100064783 | Ga0075430_1000647835 | 97 |
| 365 | 3300006846 | Ga0075430_100296788 | Ga0075430_1002967882 | 97 |
| 366 | 3300006847 | Ga0075431_100008449 | Ga0075431_10000844919 | 97 |
| 367 | 3300006847 | Ga0075431_100128099 | Ga0075431_1001280993 | 97 |
| 368 | 3300006852 | Ga0075433_10127527 | Ga0075433_101275273 | 97 |
| 369 | 3300006852 | Ga0075433_11221515 | Ga0075433_112215152 | 97 |
| 370 | 3300006871 | Ga0075434_100034388 | Ga0075434_1000343885 | 97 |
| 371 | 3300006871 | Ga0075434_100051811 | Ga0075434_1000518115 | 97 |
| 372 | 3300006881 | Ga0068865_100000056 | Ga0068865_10000005616 | 97 |
| 373 | 3300006881 | Ga0068865_100560365 | Ga0068865_1005603652 | 97 |
| 374 | 3300006914 | Ga0075436_100501609 | Ga0075436_1005016092 | 97 |
| 375 | 3300007076 | Ga0075435_100238820 | Ga0075435_1002388203 | 97 |
| 376 | 3300009094 | Ga0111539_10094044 | Ga0111539_100940445 | 97 |
| 377 | 3300009094 | Ga0111539_10157492 | Ga0111539_101574923 | 97 |
| 378 | 3300009094 | Ga0111539_11201731 | Ga0111539_112017312 | 97 |
| 379 | 3300009094 | Ga0111539_11995575 | Ga0111539_119955751 | 97 |
| 380 | 3300009098 | Ga0105245_10000528 | Ga0105245_1000052844 | 97 |
| 381 | 3300009098 | Ga0105245_12882671 | Ga0105245_128826711 | 97 |
| 382 | 3300009101 | Ga0105247_10056313 | Ga0105247_100563134 | 97 |
| 383 | 3300009147 | Ga0114129_10087401 | Ga0114129_100874013 | 97 |
| 384 | 3300009147 | Ga0114129_10443919 | Ga0114129_104439192 | 97 |
| 385 | 3300009147 | Ga0114129_10537753 | Ga0114129_105377532 | 97 |
| 386 | 3300009148 | Ga0105243_10080350 | Ga0105243_100803502 | 97 |
| 387 | 3300009148 | Ga0105243_10229273 | Ga0105243_102292733 | 97 |
| 388 | 3300009148 | Ga0105243_11305037 | Ga0105243_113050372 | 97 |
| 389 | 3300009148 | Ga0105243_11552551 | Ga0105243_115525512 | 97 |
| 390 | 3300009174 | Ga0105241_10290918 | Ga0105241_102909182 | 97 |
| 391 | 3300009176 | Ga0105242_10479491 | Ga0105242_104794911 | 97 |
| 392 | 3300009177 | Ga0105248_10001735 | Ga0105248_1000173524 | 97 |
| 393 | 3300009545 | Ga0105237_10865772 | Ga0105237_108657722 | 97 |
| 394 | 3300009553 | Ga0105249_12323880 | Ga0105249_123238802 | 97 |
| 395 | 3300009553 | Ga0105249_13546368 | Ga0105249_135463682 | 97 |
| 396 | 3300010375 | Ga0105239_10328645 | Ga0105239_103286453 | 97 |
| 397 | 3300010375 | Ga0105239_10348056 | Ga0105239_103480563 | 97 |
| 398 | 3300010375 | Ga0105239_10555738 | Ga0105239_105557382 | 97 |
| 399 | 3300010375 | Ga0105239_10567142 | Ga0105239_105671422 | 97 |
| 400 | 3300010375 | Ga0105239_10965151 | Ga0105239_109651512 | 97 |
| 401 | 3300010375 | Ga0105239_11864998 | Ga0105239_118649982 | 97 |
| 402 | 3300010375 | Ga0105239_12573573 | Ga0105239_125735732 | 97 |
| 403 | 3300011119 | Ga0105246_10017131 | Ga0105246_100171315 | 97 |
| 404 | 3300011119 | Ga0105246_11788921 | Ga0105246_117889212 | 97 |
| 405 | 3300013100 | Ga0157373_10703726 | Ga0157373_107037262 | 97 |
| 406 | 3300013102 | Ga0157371_11145618 | Ga0157371_111456181 | 97 |
| 407 | 3300013104 | Ga0157370_10059005 | Ga0157370_100590055 | 97 |
| 408 | 3300013104 | Ga0157370_10132352 | Ga0157370_101323523 | 97 |
| 409 | 3300013105 | Ga0157369_10000068 | Ga0157369_10000068152 | 97 |
| 410 | 3300013105 | Ga0157369_10893652 | Ga0157369_108936522 | 97 |
| 411 | 3300013297 | Ga0157378_10141934 | Ga0157378_101419342 | 97 |
| 412 | 3300013297 | Ga0157378_10192377 | Ga0157378_101923774 | 97 |
| 413 | 3300013297 | Ga0157378_10578015 | Ga0157378_105780152 | 97 |
| 414 | 3300013297 | Ga0157378_11724797 | Ga0157378_117247972 | 97 |
| 415 | 3300013297 | Ga0157378_11752016 | Ga0157378_117520161 | 97 |
| 416 | 3300013306 | Ga0163162_10322361 | Ga0163162_103223612 | 97 |
| 417 | 3300013308 | Ga0157375_10008331 | Ga0157375_100083316 | 97 |
| 418 | 3300013308 | Ga0157375_10237203 | Ga0157375_102372033 | 97 |
| 419 | 3300013308 | Ga0157375_10993375 | Ga0157375_109933752 | 97 |
| 420 | 3300013308 | Ga0157375_12354902 | Ga0157375_123549022 | 97 |
| 421 | 3300014325 | Ga0163163_10536951 | Ga0163163_105369513 | 97 |
| 422 | 3300014326 | Ga0157380_10000808 | Ga0157380_1000080813 | 97 |
| 423 | 3300014326 | Ga0157380_10550426 | Ga0157380_105504263 | 97 |
| 424 | 3300014326 | Ga0157380_12294680 | Ga0157380_122946802 | 97 |
| 425 | 3300014326 | Ga0157380_13452389 | Ga0157380_134523892 | 97 |
| 426 | 3300014745 | Ga0157377_11330290 | Ga0157377_113302902 | 97 |
| 427 | 3300014969 | Ga0157376_10028182 | Ga0157376_100281825 | 97 |
| 428 | 3300014969 | Ga0157376_10380065 | Ga0157376_103800653 | 97 |
| 429 | 3300017792 | Ga0163161_10637845 | Ga0163161_106378452 | 97 |
| 430 | 3300017792 | Ga0163161_11595992 | Ga0163161_115959921 | 97 |
| 431 | 3300020070 | Ga0206356_11367151 | Ga0206356_113671512 | 97 |
| 432 | 3300020077 | Ga0206351_10990872 | Ga0206351_109908722 | 97 |
| 433 | 3300020082 | Ga0206353_11038649 | Ga0206353_110386492 | 97 |
| 434 | 3300020610 | Ga0154015_1231294 | Ga0154015_12312942 | 97 |
| 435 | 3300022467 | Ga0224712_10379224 | Ga0224712_103792242 | 97 |
| 436 | 3300025898 | Ga0207692_10132901 | Ga0207692_101329014 | 97 |
| 437 | 3300025899 | Ga0207642_11155049 | Ga0207642_111550491 | 97 |
| 438 | 3300025900 | Ga0207710_10015681 | Ga0207710_100156813 | 97 |
| 439 | 3300025903 | Ga0207680_10024081 | Ga0207680_100240813 | 97 |
| 440 | 3300025904 | Ga0207647_10426568 | Ga0207647_104265681 | 97 |
| 441 | 3300025909 | Ga0207705_10367017 | Ga0207705_103670172 | 97 |
| 442 | 3300025911 | Ga0207654_10054051 | Ga0207654_100540512 | 97 |
| 443 | 3300025912 | Ga0207707_10557590 | Ga0207707_105575902 | 97 |
| 444 | 3300025915 | Ga0207693_10000138 | Ga0207693_1000013876 | 97 |
| 445 | 3300025915 | Ga0207693_10001647 | Ga0207693_1000164716 | 97 |
| 446 | 3300025918 | Ga0207662_11367771 | Ga0207662_113677711 | 97 |
| 447 | 3300025920 | Ga0207649_10000388 | Ga0207649_1000038833 | 97 |
| 448 | 3300025923 | Ga0207681_10050045 | Ga0207681_100500454 | 97 |
| 449 | 3300025925 | Ga0207650_10043384 | Ga0207650_100433845 | 97 |
| 450 | 3300025926 | Ga0207659_10000138 | Ga0207659_1000013852 | 97 |
| 451 | 3300025927 | Ga0207687_10000025 | Ga0207687_1000002512 | 97 |
| 452 | 3300025928 | Ga0207700_10000019 | Ga0207700_10000019194 | 97 |
| 453 | 3300025929 | Ga0207664_10104740 | Ga0207664_101047405 | 97 |
| 454 | 3300025929 | Ga0207664_10259621 | Ga0207664_102596213 | 97 |
| 455 | 3300025932 | Ga0207690_10008867 | Ga0207690_100088676 | 97 |
| 456 | 3300025932 | Ga0207690_11284706 | Ga0207690_112847061 | 97 |
| 457 | 3300025933 | Ga0207706_10034080 | Ga0207706_100340806 | 97 |
| 458 | 3300025934 | Ga0207686_10560266 | Ga0207686_105602661 | 97 |
| 459 | 3300025935 | Ga0207709_10040649 | Ga0207709_100406492 | 97 |
| 460 | 3300025938 | Ga0207704_10011990 | Ga0207704_100119905 | 97 |
| 461 | 3300025938 | Ga0207704_10162270 | Ga0207704_101622702 | 97 |
| 462 | 3300025941 | Ga0207711_10000011 | Ga0207711_1000001125 | 97 |
| 463 | 3300025941 | Ga0207711_10346335 | Ga0207711_103463352 | 97 |
| 464 | 3300025942 | Ga0207689_11352336 | Ga0207689_113523362 | 97 |
| 465 | 3300025944 | Ga0207661_10037906 | Ga0207661_100379066 | 97 |
| 466 | 3300025944 | Ga0207661_10058350 | Ga0207661_100583502 | 97 |
| 467 | 3300025944 | Ga0207661_10757864 | Ga0207661_107578642 | 97 |
| 468 | 3300025944 | Ga0207661_11804479 | Ga0207661_118044792 | 97 |
| 469 | 3300025945 | Ga0207679_10135579 | Ga0207679_101355792 | 97 |
| 470 | 3300025945 | Ga0207679_12107399 | Ga0207679_121073992 | 97 |
| 471 | 3300025949 | Ga0207667_10863008 | Ga0207667_108630081 | 97 |
| 472 | 3300025960 | Ga0207651_10000746 | Ga0207651_100007463 | 97 |
| 473 | 3300025961 | Ga0207712_10129766 | Ga0207712_101297663 | 97 |
| 474 | 3300025972 | Ga0207668_10058465 | Ga0207668_100584655 | 97 |
| 475 | 3300025981 | Ga0207640_11533875 | Ga0207640_115338751 | 97 |
| 476 | 3300025986 | Ga0207658_10122209 | Ga0207658_101222092 | 97 |
| 477 | 3300026023 | Ga0207677_10092907 | Ga0207677_100929074 | 97 |
| 478 | 3300026035 | Ga0207703_10088903 | Ga0207703_100889035 | 97 |
| 479 | 3300026041 | Ga0207639_10647150 | Ga0207639_106471502 | 97 |
| 480 | 3300026067 | Ga0207678_10554473 | Ga0207678_105544732 | 97 |
| 481 | 3300026075 | Ga0207708_11136141 | Ga0207708_111361412 | 97 |
| 482 | 3300026078 | Ga0207702_10006219 | Ga0207702_1000621911 | 97 |
| 483 | 3300026078 | Ga0207702_10015335 | Ga0207702_100153355 | 97 |
| 484 | 3300026142 | Ga0207698_10000014 | Ga0207698_1000001443 | 97 |
| 485 | 3300026142 | Ga0207698_10021851 | Ga0207698_100218515 | 97 |
| 486 | 3300027866 | Ga0209813_10010836 | Ga0209813_100108365 | 97 |
| 487 | 3300027866 | Ga0209813_10171859 | Ga0209813_101718592 | 97 |
| 488 | 3300027907 | Ga0207428_10480986 | Ga0207428_104809862 | 97 |
| 489 | 3300027907 | Ga0207428_11048566 | Ga0207428_110485662 | 97 |
| 490 | 3300028379 | Ga0268266_10005543 | Ga0268266_1000554319 | 97 |
| 491 | 3300028379 | Ga0268266_11232049 | Ga0268266_112320492 | 97 |
| 492 | 3300028381 | Ga0268264_10936880 | Ga0268264_109368802 | 97 |
| 493 | 3300028563 | Ga0265319_1000030 | Ga0265319_100003036 | 97 |
| 494 | 3300028800 | Ga0265338_10000156 | Ga0265338_1000015636 | 97 |
| 495 | 3300030521 | Ga0307511_10074607 | Ga0307511_100746075 | 97 |
| 496 | 3300031238 | Ga0265332_10222548 | Ga0265332_102225482 | 97 |
| 497 | 3300031241 | Ga0265325_10005113 | Ga0265325_100051138 | 97 |
| 498 | 3300031250 | Ga0265331_10231032 | Ga0265331_102310322 | 97 |
| 499 | 3300031456 | Ga0307513_10200086 | Ga0307513_102000862 | 97 |
| 500 | 3300031548 | Ga0307408_101398187 | Ga0307408_1013981871 | 97 |
| 501 | 3300031548 | Ga0307408_101887029 | Ga0307408_1018870291 | 97 |
| 502 | 3300031731 | Ga0307405_10096705 | Ga0307405_100967054 | 97 |
| 503 | 3300031852 | Ga0307410_10426422 | Ga0307410_104264222 | 97 |
| 504 | 3300031901 | Ga0307406_10166733 | Ga0307406_101667333 | 97 |
| 505 | 3300031901 | Ga0307406_10367682 | Ga0307406_103676822 | 97 |
| 506 | 3300031903 | Ga0307407_10172862 | Ga0307407_101728623 | 97 |
| 507 | 3300031911 | Ga0307412_10579457 | Ga0307412_105794572 | 97 |
| 508 | 3300032002 | Ga0307416_101892741 | Ga0307416_1018927412 | 97 |
| 509 | 3300032004 | Ga0307414_10622117 | Ga0307414_106221172 | 97 |
| 510 | 3300032126 | Ga0307415_102570228 | Ga0307415_1025702281 | 97 |
| 511 | 3300035170 | Ga0373943_0674392 | Ga0373943_0674392_65_361 | 97 |
| 512 | 3300037312 | Ga0395899_0161383 | Ga0395899_0161383_401_697 | 97 |
| 513 | 3300037312 | Ga0395899_0621570 | Ga0395899_0621570_10_306 | 97 |
| 514 | 3300037312 | Ga0395899_0821417 | Ga0395899_0821417_178_474 | 97 |
| 515 | 3300037418 | Ga0395900_0054715 | Ga0395900_0054715_3301_3597 | 97 |
| 516 | 3300037418 | Ga0395900_0806103 | Ga0395900_0806103_529_831 | 97 |
| 517 | 3300037418 | Ga0395900_1183143 | Ga0395900_1183143_22_318 | 97 |
| 518 | 3300037418 | Ga0395900_1192074 | Ga0395900_1192074_179_475 | 97 |
| 519 | 3300037418 | Ga0395900_1544628 | Ga0395900_1544628_186_482 | 97 |
| 520 | 3300037466 | Ga0395898_0017781 | Ga0395898_0017781_2054_2350 | 97 |
| 521 | 3300037466 | Ga0395898_0368695 | Ga0395898_0368695_933_1229 | 97 |
| 522 | 3300037466 | Ga0395898_0840806 | Ga0395898_0840806_207_503 | 97 |
| 523 | 3300037466 | Ga0395898_1136471 | Ga0395898_1136471_89_385 | 97 |
| 524 | 3300037466 | Ga0395898_1654159 | Ga0395898_1654159_184_480 | 97 |
| 525 | 3300037471 | Ga0395905_0013334 | Ga0395905_0013334_2550_2846 | 97 |
| 526 | 3300037471 | Ga0395905_0334539 | Ga0395905_0334539_971_1267 | 97 |
| 527 | 3300037471 | Ga0395905_1076920 | Ga0395905_1076920_267_563 | 97 |
| 528 | 3300038443 | Ga0395901_0012327 | Ga0395901_0012327_2114_2410 | 97 |
| 529 | 3300038443 | Ga0395901_0045141 | Ga0395901_0045141_1506_1802 | 97 |
| 530 | 3300038443 | Ga0395901_0685768 | Ga0395901_0685768_141_437 | 97 |
| 531 | 3300038443 | Ga0395901_0703553 | Ga0395901_0703553_549_845 | 97 |
| 532 | 3300038443 | Ga0395901_1663469 | Ga0395901_1663469_47_343 | 97 |
| 533 | 3300038443 | Ga0395901_1835826 | Ga0395901_1835826_229_525 | 97 |
| 534 | 3300038443 | Ga0395901_2128435 | Ga0395901_2128435_96_392 | 97 |
| 535 | 3300039438 | Ga0436360_0813424 | Ga0436360_0813424_475_771 | 97 |
| 536 | 3300039450 | Ga0436363_0233675 | Ga0436363_0233675_73_372 | 97 |
| 537 | 3300041459 | Ga0451800_1531549 | Ga0451800_1531549_241_549 | 97 |
| 538 | 3300041486 | Ga0451807_2459553 | Ga0451807_2459553_382_675 | 97 |
| 539 | 3300041486 | Ga0451807_2753639 | Ga0451807_2753639_550_843 | 97 |
| 540 | 3300041496 | Ga0451839_0104030 | Ga0451839_0104030_152_451 | 97 |
| 541 | 3300041509 | Ga0451843_0971763 | Ga0451843_0971763_147_440 | 97 |
| 542 | 3300041512 | Ga0451853_0363567 | Ga0451853_0363567_83_376 | 97 |
| 543 | 3300044658 | Ga0466972_0611188 | Ga0466972_0611188_188_481 | 97 |
| 544 | 3300044683 | Ga0466965_0041809 | Ga0466965_0041809_362_661 | 97 |
| 545 | 3300044683 | Ga0466965_0474984 | Ga0466965_0474984_265_561 | 97 |
| 546 | 3300044694 | Ga0466963_0000325 | Ga0466963_0000325_11238_11531 | 97 |
| 547 | 3300044694 | Ga0466963_0091504 | Ga0466963_0091504_899_1198 | 97 |
| 548 | 3300044694 | Ga0466963_0148465 | Ga0466963_0148465_1009_1308 | 97 |
| 549 | 3300044694 | Ga0466963_0189816 | Ga0466963_0189816_1108_1401 | 97 |
| 550 | 3300044694 | Ga0466963_0243841 | Ga0466963_0243841_218_517 | 97 |
| 551 | 3300044694 | Ga0466963_0802790 | Ga0466963_0802790_37_330 | 97 |
| 552 | 3300044694 | Ga0466963_1243059 | Ga0466963_1243059_20_313 | 97 |
| 553 | 3300044706 | Ga0466964_0699786 | Ga0466964_0699786_150_446 | 97 |
| 554 | 3300044735 | Ga0466968_0092224 | Ga0466968_0092224_472_768 | 97 |
| 555 | 3300044842 | Ga0466957_0001797 | Ga0466957_0001797_4223_4516 | 97 |
| 556 | 3300044842 | Ga0466957_0047130 | Ga0466957_0047130_1574_1867 | 97 |
| 557 | 3300044842 | Ga0466957_0249760 | Ga0466957_0249760_25_324 | 97 |
| 558 | 3300044842 | Ga0466957_0312582 | Ga0466957_0312582_34_327 | 97 |
| 559 | 3300044901 | Ga0466960_0326107 | Ga0466960_0326107_272_568 | 97 |
| 560 | 3300045049 | Ga0466959_0157928 | Ga0466959_0157928_1074_1370 | 97 |
| 561 | 3300045049 | Ga0466959_0651993 | Ga0466959_0651993_38_334 | 97 |
| 562 | 3300045976 | Ga0466967_0000003 | Ga0466967_0000003_45849_46142 | 97 |
| 563 | 3300045976 | Ga0466967_0078881 | Ga0466967_0078881_1238_1531 | 97 |
| 564 | 3300045976 | Ga0466967_0174648 | Ga0466967_0174648_671_970 | 97 |
| 565 | 3300045976 | Ga0466967_0180576 | Ga0466967_0180576_657_956 | 97 |
| 566 | 3300045976 | Ga0466967_0246362 | Ga0466967_0246362_658_957 | 97 |
| 567 | 3300045976 | Ga0466967_0305451 | Ga0466967_0305451_374_673 | 97 |
| 568 | 3300045976 | Ga0466967_0713344 | Ga0466967_0713344_221_514 | 97 |
| 569 | 3300045976 | Ga0466967_1164310 | Ga0466967_1164310_366_662 | 97 |
| 570 | 3300045976 | Ga0466967_1828363 | Ga0466967_1828363_18_317 | 97 |
| 571 | 3300045976 | Ga0466967_1901317 | Ga0466967_1901317_65_358 | 97 |
| 572 | 3300045976 | Ga0466967_2041674 | Ga0466967_2041674_250_549 | 97 |
| 573 | 3300046454 | Ga0495592_0379127 | Ga0495592_0379127_292_585 | 97 |
| 574 | 3300046455 | Ga0495603_0354205 | Ga0495603_0354205_414_710 | 97 |
| 575 | 3300046459 | Ga0495629_0000543 | Ga0495629_0000543_6927_7220 | 97 |
| 576 | 3300046459 | Ga0495629_0004371 | Ga0495629_0004371_1981_2274 | 97 |
| 577 | 3300046459 | Ga0495629_0012223 | Ga0495629_0012223_1106_1399 | 97 |
| 578 | 3300046460 | Ga0495638_0020983 | Ga0495638_0020983_1723_2016 | 97 |
| 579 | 3300046461 | Ga0495641_0224857 | Ga0495641_0224857_477_770 | 97 |
| 580 | 3300046462 | Ga0495651_0498329 | Ga0495651_0498329_28_321 | 97 |
| 581 | 3300046499 | Ga0495594_0000001 | Ga0495594_0000001_26551_26844 | 97 |
| 582 | 3300046507 | Ga0495606_0000283 | Ga0495606_0000283_65218_65511 | 97 |
| 583 | 3300046512 | Ga0495610_0195216 | Ga0495610_0195216_56_349 | 97 |
| 584 | 3300046515 | Ga0495620_0132685 | Ga0495620_0132685_254_550 | 97 |
| 585 | 3300046516 | Ga0495628_0551123 | Ga0495628_0551123_102_395 | 97 |
| 586 | 3300046517 | Ga0495630_0000148 | Ga0495630_0000148_51792_52085 | 97 |
| 587 | 3300046517 | Ga0495630_0058503 | Ga0495630_0058503_2360_2653 | 97 |
| 588 | 3300046519 | Ga0495632_0365621 | Ga0495632_0365621_94_387 | 97 |
| 589 | 3300046520 | Ga0495637_0269230 | Ga0495637_0269230_164_457 | 97 |
| 590 | 3300046525 | Ga0495663_0049848 | Ga0495663_0049848_89_385 | 97 |
| 591 | 3300046536 | Ga0495587_0004030 | Ga0495587_0004030_2325_2618 | 97 |
| 592 | 3300046557 | Ga0495622_0000069 | Ga0495622_0000069_30987_31280 | 97 |
| 593 | 3300046559 | Ga0495667_0000067 | Ga0495667_0000067_52402_52695 | 97 |
| 594 | 3300046616 | Ga0495668_0495013 | Ga0495668_0495013_127_420 | 97 |
| 595 | 3300046663 | Ga0495635_0988306 | Ga0495635_0988306_178_474 | 97 |
| 596 | 3300046665 | Ga0495661_0182597 | Ga0495661_0182597_567_863 | 97 |
| 597 | 3300046674 | Ga0495588_0000175 | Ga0495588_0000175_34826_35119 | 97 |
| 598 | 3300046681 | Ga0495647_0000114 | Ga0495647_0000114_17937_18230 | 97 |
| 599 | 3300046683 | Ga0495658_0001193 | Ga0495658_0001193_1014_1307 | 97 |
| 600 | 3300046684 | Ga0495669_0145768 | Ga0495669_0145768_786_1079 | 97 |
| 601 | 3300046689 | Ga0495613_0000087 | Ga0495613_0000087_72693_72986 | 97 |
| 602 | 3300046689 | Ga0495613_0438326 | Ga0495613_0438326_378_671 | 97 |
| 603 | 3300046690 | Ga0495624_0000429 | Ga0495624_0000429_24051_24344 | 97 |
| 604 | 3300046690 | Ga0495624_0903785 | Ga0495624_0903785_192_485 | 97 |
| 605 | 3300046809 | Ga0495600_0199436 | Ga0495600_0199436_914_1207 | 97 |
| 606 | 3300046810 | Ga0495660_0280070 | Ga0495660_0280070_383_676 | 97 |
| 607 | 3300047317 | Ga0495604_0000294 | Ga0495604_0000294_21321_21614 | 97 |
| 608 | 3300047317 | Ga0495604_0000322 | Ga0495604_0000322_27430_27723 | 97 |
| 609 | 3300047321 | Ga0495676_0012216 | Ga0495676_0012216_7023_7316 | 97 |
| 610 | 3300047321 | Ga0495676_0256531 | Ga0495676_0256531_537_833 | 97 |
| 611 | 3300047322 | Ga0495680_0009089 | Ga0495680_0009089_1615_1908 | 97 |
| 612 | 3300047322 | Ga0495680_0009545 | Ga0495680_0009545_7422_7715 | 97 |
| 613 | 3300047446 | Ga0495679_159480 | Ga0495679_159480_24_317 | 97 |
| 614 | 3300047472 | Ga0495686_0195056 | Ga0495686_0195056_47_340 | 97 |
| 615 | 3300048088 | Ga0495602_0098658 | Ga0495602_0098658_1180_1473 | 97 |
| 616 | 3300048089 | Ga0495614_0361580 | Ga0495614_0361580_74_367 | 97 |
| 617 | 3300048905 | Ga0496102_0676422 | Ga0496102_0676422_348_644 | 97 |
| 618 | 3300048906 | Ga0496103_0161620 | Ga0496103_0161620_773_1069 | 97 |
| 619 | 3300048907 | Ga0496104_0000029 | Ga0496104_0000029_193588_193881 | 97 |
| 620 | 3300048908 | Ga0496105_0000002 | Ga0496105_0000002_193588_193881 | 97 |
| 621 | 3300048908 | Ga0496105_0582714 | Ga0496105_0582714_324_620 | 97 |
| 622 | 3300048909 | Ga0496106_0053622 | Ga0496106_0053622_58_354 | 97 |
| 623 | 3300048909 | Ga0496106_0083694 | Ga0496106_0083694_1122_1418 | 97 |
| 624 | 3300048909 | Ga0496106_0427825 | Ga0496106_0427825_441_737 | 97 |
| 625 | 3300048910 | Ga0496107_0102247 | Ga0496107_0102247_871_1167 | 97 |
| 626 | 3300048911 | Ga0496108_0000042 | Ga0496108_0000042_126021_126314 | 97 |
| 627 | 3300048911 | Ga0496108_0146414 | Ga0496108_0146414_293_586 | 97 |
| 628 | 3300048911 | Ga0496108_0146776 | Ga0496108_0146776_1117_1413 | 97 |
| 629 | 3300048911 | Ga0496108_0688821 | Ga0496108_0688821_408_701 | 97 |
| 630 | 3300048912 | Ga0496109_0000034 | Ga0496109_0000034_158660_158953 | 97 |
| 631 | 3300048912 | Ga0496109_0000062 | Ga0496109_0000062_20167_20460 | 97 |
| 632 | 3300048912 | Ga0496109_0047839 | Ga0496109_0047839_2374_2670 | 97 |
| 633 | 3300048913 | Ga0496110_0000325 | Ga0496110_0000325_26286_26579 | 97 |
| 634 | 3300048914 | Ga0496111_0000171 | Ga0496111_0000171_3028_3321 | 97 |
| 635 | 3300048914 | Ga0496111_0019086 | Ga0496111_0019086_267_563 | 97 |
| 636 | 3300048915 | Ga0496112_0007934 | Ga0496112_0007934_1463_1756 | 97 |
| 637 | 3300048915 | Ga0496112_0116679 | Ga0496112_0116679_985_1284 | 97 |
| 638 | 3300048915 | Ga0496112_0506865 | Ga0496112_0506865_760_1056 | 97 |
| 639 | 3300048915 | Ga0496112_0927707 | Ga0496112_0927707_54_347 | 97 |
| 640 | 3300048916 | Ga0496113_0000002 | Ga0496113_0000002_12735_13028 | 97 |
| 641 | 3300048916 | Ga0496113_0152946 | Ga0496113_0152946_333_626 | 97 |
| 642 | 3300048917 | Ga0496114_1763687 | Ga0496114_1763687_191_484 | 97 |
| 643 | 3300048918 | Ga0496115_0000005 | Ga0496115_0000005_135012_135305 | 97 |
| 644 | 3300048922 | Ga0496119_0008336 | Ga0496119_0008336_2650_2943 | 97 |
| 645 | 3300048923 | Ga0496120_0024517 | Ga0496120_0024517_1126_1419 | 97 |
| 646 | 3300048927 | Ga0496124_0339239 | Ga0496124_0339239_287_580 | 97 |
| 647 | 3300048929 | Ga0496126_0061679 | Ga0496126_0061679_1285_1578 | 97 |
| 648 | 3300049571 | Ga0501034_0081325 | Ga0501034_0081325_1148_1441 | 97 |
| 649 | 3300049576 | Ga0501040_0254900 | Ga0501040_0254900_261_557 | 97 |
| 650 | 3300049577 | Ga0501041_0683370 | Ga0501041_0683370_29_325 | 97 |
| 651 | 3300049578 | Ga0501042_0168994 | Ga0501042_0168994_1219_1512 | 97 |
| 652 | 3300049578 | Ga0501042_0868902 | Ga0501042_0868902_32_325 | 97 |
| 653 | 3300049583 | Ga0501067_0072151 | Ga0501067_0072151_44_340 | 97 |
| 654 | 3300049584 | Ga0501068_0510074 | Ga0501068_0510074_136_432 | 97 |
| 655 | 3300049585 | Ga0501069_0037955 | Ga0501069_0037955_1350_1643 | 97 |
| 656 | 3300049585 | Ga0501069_0675716 | Ga0501069_0675716_294_590 | 97 |
| 657 | 3300049586 | Ga0501070_0045138 | Ga0501070_0045138_576_869 | 97 |
| 658 | 3300049586 | Ga0501070_0119369 | Ga0501070_0119369_695_988 | 97 |
| 659 | 3300049587 | Ga0501071_0116010 | Ga0501071_0116010_837_1130 | 97 |
| 660 | 3300049587 | Ga0501071_1423026 | Ga0501071_1423026_21_317 | 97 |
| 661 | 3300049588 | Ga0501072_0103023 | Ga0501072_0103023_419_712 | 97 |
| 662 | 3300049588 | Ga0501072_0990683 | Ga0501072_0990683_164_460 | 97 |
| 663 | 3300049589 | Ga0501073_0065086 | Ga0501073_0065086_66_359 | 97 |
| 664 | 3300049590 | Ga0501074_0080523 | Ga0501074_0080523_1614_1907 | 97 |
| 665 | 3300049591 | Ga0501075_1163576 | Ga0501075_1163576_115_411 | 97 |
| 666 | 3300049592 | Ga0501076_0052178 | Ga0501076_0052178_1713_2006 | 97 |
| 667 | 3300049592 | Ga0501076_0540301 | Ga0501076_0540301_137_433 | 97 |
| 668 | 3300049742 | Ga0501080_0010572 | Ga0501080_0010572_1678_1971 | 97 |
| 669 | 3300049743 | Ga0501081_0549433 | Ga0501081_0549433_238_534 | 97 |
| 670 | 3300049744 | Ga0501083_0059117 | Ga0501083_0059117_1518_1811 | 97 |
| 671 | 3300049824 | Ga0501045_0648123 | Ga0501045_0648123_40_336 | 97 |
| 672 | 3300050490 | nmdc:mga03n38_46532_c1 | nmdc:mga03n38_46532_c1_1179_1472 | 97 |
| 673 | 3300050490 | nmdc:mga03n38_74187_c1 | nmdc:mga03n38_74187_c1_711_1004 | 97 |
| 674 | 3300050491 | nmdc:mga00v17_277105_c1 | nmdc:mga00v17_277105_c1_90_383 | 97 |
| 675 | 3300050491 | nmdc:mga00v17_293610_c1 | nmdc:mga00v17_293610_c1_370_663 | 97 |
| 676 | 3300050491 | nmdc:mga00v17_794267_c1 | nmdc:mga00v17_794267_c1_117_410 | 97 |
| 677 | 3300050492 | nmdc:mga0yw44_1227_c1 | nmdc:mga0yw44_1227_c1_6537_6833 | 97 |
| 678 | 3300050494 | nmdc:mga06z11_426041_c1 | nmdc:mga06z11_426041_c1_472_768 | 97 |
| 679 | 3300050494 | nmdc:mga06z11_470878_c1 | nmdc:mga06z11_470878_c1_57_350 | 97 |
| 680 | 3300050495 | nmdc:mga04h51_66654_c1 | nmdc:mga04h51_66654_c1_793_1086 | 97 |
| 681 | 3300050507 | nmdc:mga05p37_1389666_c1 | nmdc:mga05p37_1389666_c1_216_512 | 97 |
| 682 | 3300050507 | nmdc:mga05p37_242619_c1 | nmdc:mga05p37_242619_c1_236_532 | 97 |
| 683 | 3300050507 | nmdc:mga05p37_343611_c1 | nmdc:mga05p37_343611_c1_738_1034 | 97 |
| 684 | 3300050507 | nmdc:mga05p37_526288_c1 | nmdc:mga05p37_526288_c1_198_494 | 97 |
| 685 | 3300050507 | nmdc:mga05p37_780875_c1 | nmdc:mga05p37_780875_c1_104_400 | 97 |
| 686 | 3300050510 | nmdc:mga06r32_133354_c1 | nmdc:mga06r32_133354_c1_1476_1772 | 97 |
| 687 | 3300050511 | nmdc:mga08y16_279757_c1 | nmdc:mga08y16_279757_c1_798_1094 | 97 |
| 688 | 3300050511 | nmdc:mga08y16_69250_c1 | nmdc:mga08y16_69250_c1_1059_1355 | 97 |
| 689 | 3300050512 | nmdc:mga0n895_221072_c1 | nmdc:mga0n895_221072_c1_555_851 | 97 |
| 690 | 3300050512 | nmdc:mga0n895_304789_c1 | nmdc:mga0n895_304789_c1_977_1273 | 97 |
| 691 | 3300050513 | nmdc:mga0rr50_352212_c1 | nmdc:mga0rr50_352212_c1_765_1061 | 97 |
| 692 | 3300050513 | nmdc:mga0rr50_607137_c1 | nmdc:mga0rr50_607137_c1_144_440 | 97 |
| 693 | 3300050515 | nmdc:mga0a205_391337_c1 | nmdc:mga0a205_391337_c1_901_1197 | 97 |
| 694 | 3300050515 | nmdc:mga0a205_483808_c1 | nmdc:mga0a205_483808_c1_360_656 | 97 |
| 695 | 3300050515 | nmdc:mga0a205_76480_c1 | nmdc:mga0a205_76480_c1_83_379 | 97 |
| 696 | 3300050515 | nmdc:mga0a205_787049_c1 | nmdc:mga0a205_787049_c1_19_315 | 97 |
| 697 | 3300053077 | Ga0495601_0000065 | Ga0495601_0000065_7835_8128 | 97 |
| 698 | 3300053077 | Ga0495601_0615364 | Ga0495601_0615364_260_553 | 97 |
| 699 | 3300053078 | Ga0495612_0004181 | Ga0495612_0004181_1434_1727 | 97 |
| 700 | 3300053078 | Ga0495612_0127430 | Ga0495612_0127430_74_367 | 97 |
| 701 | 3300053083 | Ga0495655_0001612 | Ga0495655_0001612_2849_3142 | 97 |
| 702 | 3300053094 | Ga0500566_0001523 | Ga0500566_0001523_9690_9983 | 97 |
| 703 | 3300053096 | Ga0500641_0001013 | Ga0500641_0001013_7233_7526 | 97 |
| 704 | 3300059491 | Ga0587070_237860 | Ga0587070_237860_82_381 | 97 |
| 705 | 3300059504 | Ga0587082_172648 | Ga0587082_172648_160_459 | 97 |
| 706 | 3300059505 | Ga0587083_0170895 | Ga0587083_0170895_106_405 | 97 |
| 707 | 3300059508 | Ga0587088_157147 | Ga0587088_157147_90_389 | 97 |
| 708 | 3300059630 | Ga0587128_131078 | Ga0587128_131078_106_402 | 97 |
| 709 | 3300059639 | Ga0587062_142422 | Ga0587062_142422_112_411 | 97 |
| 710 | 3300059644 | Ga0587075_131115 | Ga0587075_131115_117_416 | 97 |
| 711 | 3300059652 | Ga0587107_110780 | Ga0587107_110780_63_362 | 97 |
| 712 | 3300061734 | Ga0530510_0442489 | Ga0530510_0442489_295_591 | 97 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9439 | 3 | 83 |
| 7nhm-assembly1.cif.gz_W | 70s ribosome from staphylococcus aureus | 0.9397 | 2 | 87 |
| 7nhn-assembly1.cif.gz_W | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9383 | 2 | 88 |
| 4v5d-assembly1.cif.gz_BX | structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. | 0.9368 | 3 | 93 |
| 6ppf-assembly1.cif.gz_T | bacterial 45srbga ribosomal particle class b | 0.9356 | 2 | 87 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9321 | 2 | 87 | 3.30.70.330 |
| 6fu8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8944 | 3 | 88 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8929 | 2 | 87 | 3.30.70.330 |
| 4garT00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8891 | 3 | 88 | 3.30.70.330 |
| 4qs3X00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8891 | 3 | 93 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q4A8H3-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9828 | 1 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-Q2NIV6-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9818 | 3 | 89 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-Q4AAE2-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9814 | 1 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-C4K2H7-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.98 | 3 | 88 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A537WDZ1-F1-model_v4 | Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL4; Large ribosomal subunit protein uL23] | 0.9796 | 3 | 94 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar