F476831

General Info

Members Datasets Scaffolds Average Seq Length
712 338 712 98

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10348056|Ga0105239_103480563
Length 101
Sequence MSLHPNEVLLAPVVSEKSYEQIESNHRYSFRVHPDAHKTQIRQAVEEIFGVRVQDVRTMSVKSKPKRRGYTSGRSRAWKKAVVQLHPDDHIELFEGQELGE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
207 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
211 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
212 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
213 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
214 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
215 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
216 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
217 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
218 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
219 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
220 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
221 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
222 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
223 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
242 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
246 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
247 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
248 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
249 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
250 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
271 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
272 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
297 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
326 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
327 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 1.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.21
Nodule 0
Rhizoplane 9.41
Rhizosphere 83.71
Stem 0
Stem Tuber 0
Unclassified 2.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003124 3300001979 Bacteria 7308
2 JGI24748J21848_1000332 3300002074 Bacteria 5454
3 JGI24034J26672_10000068 3300002239 Bacteria 28347
4 JGI24742J22300_10000389 3300002244 Bacteria 6508
5 JGI25406J46586_10046371 3300003203 Bacteria 1489
6 Ga0070658_10460061 3300005327 Bacteria 1097
7 Ga0070658_11417642 3300005327 Bacteria 603
8 Ga0070683_100066804 3300005329 Bacteria 3349
9 Ga0070683_100138936 3300005329 Bacteria 2301
10 Ga0070683_100733551 3300005329 Bacteria 946
11 Ga0070683_100737480 3300005329 Bacteria 944
12 Ga0070683_100935600 3300005329 Bacteria 832
13 Ga0070670_100085569 3300005331 Bacteria 2709
14 Ga0068869_100470828 3300005334 Bacteria 1044
15 Ga0068869_101968049 3300005334 Unclassified 524
16 Ga0070666_10019547 3300005335 Bacteria 4374
17 Ga0070682_101560229 3300005337 Bacteria 570
18 Ga0068868_100009889 3300005338 Bacteria 6887
19 Ga0068868_100164708 3300005338 Bacteria 1833
20 Ga0068868_100205078 3300005338 Bacteria 1645
21 Ga0068868_102145587 3300005338 Bacteria 532
22 Ga0070660_100977385 3300005339 Bacteria 715
23 Ga0070691_10605351 3300005341 Bacteria 647
24 Ga0070661_100000236 3300005344 Bacteria 45535
25 Ga0070692_10073668 3300005345 Bacteria 1825
26 Ga0070692_10476939 3300005345 Bacteria 804
27 Ga0070692_11051645 3300005345 Unclassified 572
28 Ga0070668_100493835 3300005347 Bacteria 1059
29 Ga0070669_100063717 3300005353 Bacteria 2714
30 Ga0070669_101019536 3300005353 Bacteria 711
31 Ga0070675_100000930 3300005354 Bacteria 20823
32 Ga0070675_102137551 3300005354 Bacteria 516
33 Ga0070673_100044186 3300005364 Bacteria 3449
34 Ga0070673_100086451 3300005364 Bacteria 2555
35 Ga0070688_100001088 3300005365 Bacteria 13570
36 Ga0070688_100002914 3300005365 Bacteria 8725
37 Ga0070703_10007328 3300005406 Bacteria 3095
38 Ga0070703_10184774 3300005406 Bacteria 808
39 Ga0070709_10158499 3300005434 Bacteria 1571
40 Ga0070714_100156543 3300005435 Bacteria 2057
41 Ga0070714_100461620 3300005435 Bacteria 1207
42 Ga0070714_101102191 3300005435 Bacteria 774
43 Ga0070713_100000171 3300005436 Bacteria 43503
44 Ga0070713_101851106 3300005436 Bacteria 586
45 Ga0070710_10006050 3300005437 Bacteria 5783
46 Ga0070701_10131180 3300005438 Bacteria 1424
47 Ga0070701_10252862 3300005438 Bacteria 1065
48 Ga0070711_100056501 3300005439 Bacteria 2714
49 Ga0070711_100098619 3300005439 Bacteria 2121
50 Ga0070711_100612532 3300005439 Bacteria 909
51 Ga0070705_100035023 3300005440 Bacteria 2811
52 Ga0070705_100122688 3300005440 Bacteria 1680
53 Ga0070705_100204040 3300005440 Bacteria 1358
54 Ga0070705_101143965 3300005440 Bacteria 639
55 Ga0070700_100676660 3300005441 Bacteria 818
56 Ga0070700_101133611 3300005441 Bacteria 650
57 Ga0070700_101417870 3300005441 Bacteria 588
58 Ga0070700_101604509 3300005441 Bacteria 556
59 Ga0070694_100071519 3300005444 Bacteria 2391
60 Ga0070694_100729993 3300005444 Bacteria 807
61 Ga0070708_100121070 3300005445 Bacteria 2414
62 Ga0070708_100134963 3300005445 Bacteria 2285
63 Ga0070708_100350232 3300005445 Bacteria 1392
64 Ga0070708_101054884 3300005445 Unclassified 761
65 Ga0070708_101261013 3300005445 Bacteria 691
66 Ga0070663_100477590 3300005455 Bacteria 1031
67 Ga0070678_100131979 3300005456 Bacteria 1986
68 Ga0070662_101463766 3300005457 Bacteria 589
69 Ga0068867_100877000 3300005459 Unclassified 806
70 Ga0070685_10001772 3300005466 Bacteria 11292
71 Ga0070685_10005627 3300005466 Bacteria 6358
72 Ga0070706_100117116 3300005467 Bacteria 2482
73 Ga0070706_100252762 3300005467 Bacteria 1645
74 Ga0070706_100289770 3300005467 Bacteria 1528
75 Ga0070706_100877895 3300005467 Bacteria 829
76 Ga0070707_100006023 3300005468 Bacteria 11317
77 Ga0070707_100156984 3300005468 Bacteria 2216
78 Ga0070707_101108328 3300005468 Bacteria 758
79 Ga0070698_100006728 3300005471 Bacteria 12464
80 Ga0070698_100727932 3300005471 Bacteria 935
81 Ga0070699_100058662 3300005518 Bacteria 3334
82 Ga0070699_100066816 3300005518 Bacteria 3122
83 Ga0070699_101543319 3300005518 Bacteria 609
84 Ga0070679_100648220 3300005530 Bacteria 999
85 Ga0070684_100034382 3300005535 Bacteria 4334
86 Ga0070684_100149887 3300005535 Bacteria 2112
87 Ga0070684_100714527 3300005535 Bacteria 935
88 Ga0070697_100038883 3300005536 Bacteria 3845
89 Ga0070697_100054355 3300005536 Bacteria 3254
90 Ga0070697_100451571 3300005536 Bacteria 1120
91 Ga0070697_100631526 3300005536 Bacteria 942
92 Ga0068853_101241998 3300005539 Bacteria 720
93 Ga0070686_100172281 3300005544 Bacteria 1532
94 Ga0070686_100784541 3300005544 Bacteria 767
95 Ga0070686_100957621 3300005544 Bacteria 700
96 Ga0070695_100026750 3300005545 Bacteria 3571
97 Ga0070695_100395740 3300005545 Bacteria 1046
98 Ga0070695_100521999 3300005545 Bacteria 921
99 Ga0070695_101137426 3300005545 Unclassified 640
100 Ga0070696_100011377 3300005546 Bacteria 5960
101 Ga0070696_100255569 3300005546 Bacteria 1326
102 Ga0070696_101922975 3300005546 Bacteria 513
103 Ga0070693_100046459 3300005547 Bacteria 2465
104 Ga0070693_100544655 3300005547 Bacteria 830
105 Ga0070665_100379163 3300005548 Bacteria 1421
106 Ga0070704_100009153 3300005549 Bacteria 5973
107 Ga0070704_100088096 3300005549 Bacteria 2305
108 Ga0070704_100103630 3300005549 Bacteria 2149
109 Ga0070704_100129977 3300005549 Bacteria 1950
110 Ga0070704_100321630 3300005549 Bacteria 1296
111 Ga0070704_100449151 3300005549 Bacteria 1110
112 Ga0070704_101773973 3300005549 Bacteria 571
113 Ga0070664_100027426 3300005564 Bacteria 4733
114 Ga0068857_100858969 3300005577 Bacteria 869
115 Ga0068856_100007453 3300005614 Bacteria 10677
116 Ga0068856_100174723 3300005614 Bacteria 2160
117 Ga0070702_100204009 3300005615 Bacteria 1311
118 Ga0070702_100229270 3300005615 Bacteria 1247
119 Ga0070702_100995384 3300005615 Bacteria 663
120 Ga0068852_100001042 3300005616 Bacteria 18249
121 Ga0068852_100048086 3300005616 Bacteria 3643
122 Ga0068866_10097922 3300005718 Bacteria 1612
123 Ga0068866_10517920 3300005718 Bacteria 792
124 Ga0068866_10809845 3300005718 Bacteria 652
125 Ga0068861_100320641 3300005719 Bacteria 1349
126 Ga0068858_100225659 3300005842 Bacteria 1775
127 Ga0068862_100374424 3300005844 Bacteria 1326
128 Ga0081455_10063369 3300005937 Bacteria 3102
129 Ga0081455_10088805 3300005937 Bacteria 2510
130 Ga0081455_10094536 3300005937 Bacteria 2414
131 Ga0081455_10163236 3300005937 Bacteria 1705
132 Ga0081538_10028056 3300005981 Bacteria 3884
133 Ga0081538_10177458 3300005981 Bacteria 918
134 Ga0081538_10241763 3300005981 Bacteria 695
135 Ga0081540_1082547 3300005983 Bacteria 1441
136 Ga0081540_1130288 3300005983 Bacteria 1028
137 Ga0081539_10002195 3300005985 Bacteria 28613
138 Ga0081539_10053821 3300005985 Bacteria 2251
139 Ga0070717_10326610 3300006028 Bacteria 1368
140 Ga0075365_10000565 3300006038 Bacteria 14356
141 Ga0075365_10147156 3300006038 Bacteria 1637
142 Ga0075365_10966079 3300006038 Bacteria 600
143 Ga0075365_11129796 3300006038 Bacteria 551
144 Ga0075368_10042987 3300006042 Bacteria 1780
145 Ga0075368_10418026 3300006042 Bacteria 591
146 Ga0075363_100023094 3300006048 Bacteria 3149
147 Ga0075363_100052586 3300006048 Bacteria 2174
148 Ga0075363_100784876 3300006048 Bacteria 579
149 Ga0075364_10020535 3300006051 Bacteria 4154
150 Ga0075364_10469890 3300006051 Bacteria 859
151 Ga0075364_10597025 3300006051 Bacteria 754
152 Ga0075432_10138437 3300006058 Bacteria 927
153 Ga0075432_10190440 3300006058 Bacteria 807
154 Ga0070715_10018624 3300006163 Bacteria 2649
155 Ga0070715_11052010 3300006163 Bacteria 510
156 Ga0070716_100151956 3300006173 Bacteria 1490
157 Ga0070716_100204582 3300006173 Bacteria 1315
158 Ga0070712_100000350 3300006175 Bacteria 26114
159 Ga0070712_100003252 3300006175 Bacteria 10001
160 Ga0070712_100009426 3300006175 Bacteria 6153
161 Ga0070712_100029957 3300006175 Bacteria 3652
162 Ga0070712_100065918 3300006175 Bacteria 2572
163 Ga0070712_100932696 3300006175 Bacteria 749
164 Ga0070712_101066316 3300006175 Bacteria 700
165 Ga0075367_10053516 3300006178 Bacteria 2392
166 Ga0075367_10089759 3300006178 Bacteria 1868
167 Ga0075367_10383939 3300006178 Bacteria 887
168 Ga0068871_100608759 3300006358 Bacteria 994
169 Ga0068871_101152747 3300006358 Bacteria 726
170 Ga0075428_100106741 3300006844 Bacteria 3053
171 Ga0075430_100064783 3300006846 Bacteria 3070
172 Ga0075430_100296788 3300006846 Bacteria 1337
173 Ga0075431_100008449 3300006847 Bacteria 10310
174 Ga0075431_100128099 3300006847 Bacteria 2619
175 Ga0075433_10124042 3300006852 Bacteria 2294
176 Ga0075433_10127527 3300006852 Bacteria 2260
177 Ga0075433_10142114 3300006852 Bacteria 2133
178 Ga0075433_11221515 3300006852 Unclassified 652
179 Ga0075434_100034388 3300006871 Bacteria 5005
180 Ga0075434_100051811 3300006871 Bacteria 4078
181 Ga0075434_100091140 3300006871 Bacteria 3050
182 Ga0075434_100152574 3300006871 Bacteria 2330
183 Ga0075434_100440922 3300006871 Bacteria 1323
184 Ga0068865_100000056 3300006881 Bacteria 62122
185 Ga0068865_100560365 3300006881 Bacteria 961
186 Ga0075436_100015159 3300006914 Bacteria 5281
187 Ga0075436_100023145 3300006914 Bacteria 4267
188 Ga0075436_100089801 3300006914 Bacteria 2135
189 Ga0075436_100501609 3300006914 Bacteria 888
190 Ga0075435_100172450 3300007076 Bacteria 1825
191 Ga0075435_100238820 3300007076 Bacteria 1545
192 Ga0075435_100242104 3300007076 Bacteria 1534
193 Ga0075435_100433442 3300007076 Bacteria 1133
194 Ga0111539_10094044 3300009094 Bacteria 3521
195 Ga0111539_10157492 3300009094 Bacteria 2657
196 Ga0111539_11156386 3300009094 Bacteria 899
197 Ga0111539_11201731 3300009094 Bacteria 881
198 Ga0111539_11995575 3300009094 Bacteria 673
199 Ga0105245_10000528 3300009098 Bacteria 35016
200 Ga0105245_10132007 3300009098 Bacteria 2343
201 Ga0105245_10622788 3300009098 Bacteria 1107
202 Ga0105245_12882671 3300009098 Unclassified 533
203 Ga0105247_10056313 3300009101 Bacteria 2428
204 Ga0114129_10022048 3300009147 Bacteria 9039
205 Ga0114129_10050964 3300009147 Bacteria 5812
206 Ga0114129_10087401 3300009147 Bacteria 4323
207 Ga0114129_10443919 3300009147 Bacteria 1703
208 Ga0114129_10537753 3300009147 Bacteria 1521
209 Ga0114129_10564660 3300009147 Bacteria 1478
210 Ga0105243_10080350 3300009148 Bacteria 2659
211 Ga0105243_10166998 3300009148 Bacteria 1903
212 Ga0105243_10229273 3300009148 Bacteria 1647
213 Ga0105243_10457294 3300009148 Bacteria 1199
214 Ga0105243_11305037 3300009148 Bacteria 743
215 Ga0105243_11552551 3300009148 Bacteria 687
216 Ga0105241_10290918 3300009174 Bacteria 1399
217 Ga0105241_10331846 3300009174 Bacteria 1315
218 Ga0105241_10412507 3300009174 Bacteria 1187
219 Ga0105242_10280358 3300009176 Bacteria 1513
220 Ga0105242_10479491 3300009176 Bacteria 1178
221 Ga0105248_10001735 3300009177 Bacteria 24226
222 Ga0105237_10310730 3300009545 Bacteria 1579
223 Ga0105237_10865772 3300009545 Bacteria 910
224 Ga0105249_10192765 3300009553 Bacteria 1990
225 Ga0105249_10887626 3300009553 Bacteria 958
226 Ga0105249_11199002 3300009553 Bacteria 830
227 Ga0105249_12323880 3300009553 Bacteria 609
228 Ga0105249_13546368 3300009553 Unclassified 503
229 Ga0105239_10328645 3300010375 Bacteria 1724
230 Ga0105239_10348056 3300010375 Bacteria 1673
231 Ga0105239_10555738 3300010375 Bacteria 1307
232 Ga0105239_10567142 3300010375 Bacteria 1293
233 Ga0105239_10965151 3300010375 Bacteria 979
234 Ga0105239_11078077 3300010375 Bacteria 924
235 Ga0105239_11864998 3300010375 Bacteria 697
236 Ga0105239_12573573 3300010375 Bacteria 593
237 Ga0105246_10017131 3300011119 Bacteria 4602
238 Ga0105246_10233529 3300011119 Bacteria 1450
239 Ga0105246_11443917 3300011119 Bacteria 644
240 Ga0105246_11788921 3300011119 Bacteria 587
241 Ga0157373_10703726 3300013100 Bacteria 740
242 Ga0157371_11145618 3300013102 Bacteria 598
243 Ga0157370_10059005 3300013104 Bacteria 3647
244 Ga0157370_10132352 3300013104 Bacteria 2326
245 Ga0157369_10000068 3300013105 Bacteria 144274
246 Ga0157369_10893652 3300013105 Bacteria 911
247 Ga0157378_10141934 3300013297 Bacteria 2231
248 Ga0157378_10192377 3300013297 Bacteria 1925
249 Ga0157378_10578015 3300013297 Bacteria 1132
250 Ga0157378_11210205 3300013297 Bacteria 795
251 Ga0157378_11392702 3300013297 Bacteria 744
252 Ga0157378_11724797 3300013297 Bacteria 674
253 Ga0157378_11752016 3300013297 Bacteria 669
254 Ga0163162_10322361 3300013306 Bacteria 1678
255 Ga0157375_10008331 3300013308 Bacteria 9080
256 Ga0157375_10213663 3300013308 Bacteria 2086
257 Ga0157375_10237203 3300013308 Bacteria 1983
258 Ga0157375_10993375 3300013308 Bacteria 979
259 Ga0157375_12354902 3300013308 Bacteria 635
260 Ga0163163_10536951 3300014325 Bacteria 1232
261 Ga0157380_10000808 3300014326 Bacteria 19608
262 Ga0157380_10550426 3300014326 Bacteria 1132
263 Ga0157380_12294680 3300014326 Bacteria 604
264 Ga0157380_13452389 3300014326 Bacteria 506
265 Ga0157377_10448849 3300014745 Bacteria 890
266 Ga0157377_11330290 3300014745 Bacteria 563
267 Ga0157376_10028182 3300014969 Bacteria 4461
268 Ga0157376_10147888 3300014969 Bacteria 2115
269 Ga0157376_10380065 3300014969 Bacteria 1360
270 Ga0163161_10505855 3300017792 Bacteria 984
271 Ga0163161_10637845 3300017792 Bacteria 882
272 Ga0163161_11595992 3300017792 Bacteria 575
273 Ga0206356_11367151 3300020070 Bacteria 599
274 Ga0206351_10990872 3300020077 Bacteria 709
275 Ga0206353_11038649 3300020082 Bacteria 834
276 Ga0154015_1231294 3300020610 Bacteria 800
277 Ga0224712_10379224 3300022467 Bacteria 672
278 Ga0207653_10005876 3300025885 Bacteria 3829
279 Ga0207653_10066321 3300025885 Bacteria 1227
280 Ga0207692_10132901 3300025898 Bacteria 1407
281 Ga0207692_10179751 3300025898 Bacteria 1232
282 Ga0207642_10418196 3300025899 Bacteria 806
283 Ga0207642_11155049 3300025899 Bacteria 502
284 Ga0207710_10015681 3300025900 Bacteria 3205
285 Ga0207688_10013692 3300025901 Bacteria 4409
286 Ga0207680_10024081 3300025903 Bacteria 3335
287 Ga0207647_10426568 3300025904 Bacteria 745
288 Ga0207699_10432943 3300025906 Bacteria 941
289 Ga0207699_10774554 3300025906 Bacteria 705
290 Ga0207645_10754135 3300025907 Bacteria 662
291 Ga0207705_10367017 3300025909 Bacteria 1111
292 Ga0207684_10190082 3300025910 Bacteria 1771
293 Ga0207684_10244393 3300025910 Bacteria 1548
294 Ga0207684_10282097 3300025910 Bacteria 1432
295 Ga0207684_10742203 3300025910 Bacteria 832
296 Ga0207654_10054051 3300025911 Bacteria 2320
297 Ga0207654_10227130 3300025911 Bacteria 1241
298 Ga0207707_10557590 3300025912 Bacteria 973
299 Ga0207693_10000138 3300025915 Bacteria 66126
300 Ga0207693_10001647 3300025915 Bacteria 19699
301 Ga0207693_10021106 3300025915 Bacteria 5177
302 Ga0207693_10060283 3300025915 Bacteria 2972
303 Ga0207693_10065127 3300025915 Bacteria 2854
304 Ga0207693_10597914 3300025915 Bacteria 859
305 Ga0207663_10076229 3300025916 Bacteria 2178
306 Ga0207663_10230238 3300025916 Bacteria 1353
307 Ga0207663_10330257 3300025916 Bacteria 1148
308 Ga0207662_11367771 3300025918 Unclassified 503
309 Ga0207649_10000388 3300025920 Bacteria 32980
310 Ga0207646_10004454 3300025922 Bacteria 15188
311 Ga0207646_10382546 3300025922 Bacteria 1271
312 Ga0207646_10943370 3300025922 Unclassified 764
313 Ga0207681_10050045 3300025923 Bacteria 2826
314 Ga0207681_10808220 3300025923 Bacteria 783
315 Ga0207650_10043384 3300025925 Bacteria 3301
316 Ga0207659_10000138 3300025926 Bacteria 42755
317 Ga0207687_10000025 3300025927 Bacteria 175177
318 Ga0207687_10456365 3300025927 Bacteria 1061
319 Ga0207700_10000019 3300025928 Bacteria 183117
320 Ga0207664_10061436 3300025929 Bacteria 2997
321 Ga0207664_10104740 3300025929 Bacteria 2343
322 Ga0207664_10259621 3300025929 Bacteria 1519
323 Ga0207664_11769777 3300025929 Bacteria 540
324 Ga0207690_10008867 3300025932 Bacteria 5969
325 Ga0207690_11284706 3300025932 Bacteria 612
326 Ga0207706_10034080 3300025933 Bacteria 4531
327 Ga0207706_10258717 3300025933 Bacteria 1520
328 Ga0207686_10131073 3300025934 Bacteria 1720
329 Ga0207686_10243650 3300025934 Bacteria 1310
330 Ga0207686_10560266 3300025934 Bacteria 894
331 Ga0207709_10040649 3300025935 Bacteria 2785
332 Ga0207709_10259854 3300025935 Bacteria 1273
333 Ga0207670_11556278 3300025936 Bacteria 562
334 Ga0207704_10011990 3300025938 Bacteria 4287
335 Ga0207704_10162270 3300025938 Bacteria 1592
336 Ga0207665_10010210 3300025939 Bacteria 6166
337 Ga0207665_10066182 3300025939 Bacteria 2459
338 Ga0207665_10210172 3300025939 Bacteria 1421
339 Ga0207711_10000011 3300025941 Bacteria 518817
340 Ga0207711_10346335 3300025941 Bacteria 1376
341 Ga0207689_10602784 3300025942 Bacteria 924
342 Ga0207689_11352336 3300025942 Unclassified 598
343 Ga0207661_10037906 3300025944 Bacteria 3774
344 Ga0207661_10058350 3300025944 Bacteria 3105
345 Ga0207661_10757864 3300025944 Bacteria 894
346 Ga0207661_11804479 3300025944 Bacteria 557
347 Ga0207679_10135579 3300025945 Bacteria 1982
348 Ga0207679_12107399 3300025945 Bacteria 512
349 Ga0207667_10863008 3300025949 Bacteria 899
350 Ga0207651_10000746 3300025960 Bacteria 13950
351 Ga0207651_11408593 3300025960 Bacteria 627
352 Ga0207712_10129766 3300025961 Bacteria 1919
353 Ga0207712_10424053 3300025961 Bacteria 1123
354 Ga0207668_10058465 3300025972 Bacteria 2695
355 Ga0207668_10248318 3300025972 Bacteria 1444
356 Ga0207640_11533875 3300025981 Bacteria 599
357 Ga0207658_10122209 3300025986 Bacteria 2078
358 Ga0207677_10092907 3300026023 Bacteria 2198
359 Ga0207703_10088903 3300026035 Bacteria 2594
360 Ga0207639_10647150 3300026041 Bacteria 978
361 Ga0207678_10554473 3300026067 Bacteria 1005
362 Ga0207708_11136141 3300026075 Bacteria 682
363 Ga0207708_11239234 3300026075 Bacteria 653
364 Ga0207702_10006219 3300026078 Bacteria 10321
365 Ga0207702_10015335 3300026078 Bacteria 6351
366 Ga0207676_11217105 3300026095 Bacteria 747
367 Ga0207675_100118172 3300026118 Bacteria 2507
368 Ga0207683_10110663 3300026121 Bacteria 2459
369 Ga0207698_10000014 3300026142 Bacteria 240703
370 Ga0207698_10021851 3300026142 Bacteria 4433
371 Ga0209813_10010836 3300027866 Bacteria 2369
372 Ga0209813_10171859 3300027866 Bacteria 788
373 Ga0207428_10480986 3300027907 Bacteria 903
374 Ga0207428_10542292 3300027907 Bacteria 842
375 Ga0207428_11048566 3300027907 Bacteria 571
376 Ga0268266_10005543 3300028379 Bacteria 11749
377 Ga0268266_11232049 3300028379 Bacteria 723
378 Ga0268265_11048541 3300028380 Bacteria 807
379 Ga0268264_10300719 3300028381 Bacteria 1510
380 Ga0268264_10936880 3300028381 Bacteria 871
381 Ga0265319_1000030 3300028563 Bacteria 129742
382 Ga0265338_10000156 3300028800 Bacteria 125065
383 Ga0307511_10074607 3300030521 Bacteria 2443
384 Ga0265332_10222548 3300031238 Bacteria 783
385 Ga0265325_10005113 3300031241 Bacteria 8165
386 Ga0265331_10231032 3300031250 Bacteria 830
387 Ga0307513_10200086 3300031456 Bacteria 1840
388 Ga0307408_101398187 3300031548 Bacteria 659
389 Ga0307408_101887029 3300031548 Bacteria 573
390 Ga0307405_10096705 3300031731 Bacteria 1970
391 Ga0307410_10426422 3300031852 Bacteria 1077
392 Ga0307406_10166733 3300031901 Bacteria 1590
393 Ga0307406_10367682 3300031901 Bacteria 1130
394 Ga0307407_10172862 3300031903 Bacteria 1425
395 Ga0307412_10579457 3300031911 Bacteria 947
396 Ga0307416_101892741 3300032002 Bacteria 700
397 Ga0307414_10622117 3300032004 Bacteria 971
398 Ga0307415_100314408 3300032126 Bacteria 1303
399 Ga0307415_102570228 3300032126 Bacteria 502
400 Ga0373948_0212505 3300034817 Bacteria 509
401 Ga0373928_0005114 3300035084 Bacteria 2502
402 Ga0373929_0000967 3300035085 Bacteria 5589
403 Ga0373940_0000176 3300035088 Bacteria 8559
404 Ga0373949_0007429 3300035090 Bacteria 2398
405 Ga0373951_0001169 3300035091 Bacteria 6935
406 Ga0373952_0017206 3300035092 Bacteria 1480
407 Ga0373932_0001381 3300035112 Bacteria 6813
408 Ga0373939_0002086 3300035114 Bacteria 4764
409 Ga0373941_0001669 3300035115 Bacteria 4747
410 Ga0373960_0030906 3300035121 Bacteria 1494
411 Ga0373943_0674392 3300035170 Bacteria 612
412 Ga0373942_0001255 3300035207 Bacteria 6648
413 Ga0373961_0001439 3300035241 Bacteria 7046
414 Ga0373962_0001897 3300035242 Bacteria 4971
415 Ga0373931_0000630 3300035691 Bacteria 14643
416 Ga0395899_0070435 3300037312 Bacteria 2559
417 Ga0395899_0161383 3300037312 Bacteria 1583
418 Ga0395899_0408712 3300037312 Bacteria 897
419 Ga0395899_0621570 3300037312 Unclassified 686
420 Ga0395899_0821417 3300037312 Bacteria 573
421 Ga0395900_0036001 3300037418 Bacteria 5100
422 Ga0395900_0054715 3300037418 Bacteria 4109
423 Ga0395900_0096582 3300037418 Bacteria 3036
424 Ga0395900_0436233 3300037418 Bacteria 1268
425 Ga0395900_0806103 3300037418 Bacteria 867
426 Ga0395900_1183143 3300037418 Bacteria 680
427 Ga0395900_1192074 3300037418 Bacteria 677
428 Ga0395900_1353037 3300037418 Bacteria 625
429 Ga0395900_1544628 3300037418 Bacteria 575
430 Ga0395898_0004111 3300037466 Bacteria 15953
431 Ga0395898_0017781 3300037466 Bacteria 7254
432 Ga0395898_0093521 3300037466 Bacteria 2889
433 Ga0395898_0368695 3300037466 Bacteria 1369
434 Ga0395898_0422362 3300037466 Bacteria 1270
435 Ga0395898_0800121 3300037466 Bacteria 883
436 Ga0395898_0840806 3300037466 Bacteria 857
437 Ga0395898_1136471 3300037466 Bacteria 714
438 Ga0395898_1654159 3300037466 Bacteria 564
439 Ga0395905_0013334 3300037471 Bacteria 7878
440 Ga0395905_0035350 3300037471 Bacteria 4691
441 Ga0395905_0334539 3300037471 Bacteria 1405
442 Ga0395905_1076920 3300037471 Bacteria 707
443 Ga0395905_1236591 3300037471 Bacteria 650
444 Ga0395901_0012327 3300038443 Bacteria 8674
445 Ga0395901_0039011 3300038443 Bacteria 4913
446 Ga0395901_0045141 3300038443 Bacteria 4572
447 Ga0395901_0065123 3300038443 Bacteria 3794
448 Ga0395901_0393601 3300038443 Bacteria 1424
449 Ga0395901_0531828 3300038443 Bacteria 1193
450 Ga0395901_0685768 3300038443 Bacteria 1024
451 Ga0395901_0703553 3300038443 Bacteria 1008
452 Ga0395901_0876270 3300038443 Bacteria 881
453 Ga0395901_1198073 3300038443 Bacteria 725
454 Ga0395901_1268007 3300038443 Bacteria 700
455 Ga0395901_1663469 3300038443 Bacteria 590
456 Ga0395901_1835826 3300038443 Bacteria 555
457 Ga0395901_2128435 3300038443 Bacteria 506
458 Ga0242419_015744 3300038698 Bacteria 610
459 Ga0242420_065698 3300038996 Bacteria 730
460 Ga0436360_0813424 3300039438 Bacteria 1319
461 Ga0436363_0233675 3300039450 Bacteria 527
462 Ga0451789_0948123 3300041443 Bacteria 516
463 Ga0451789_1125219 3300041443 Unclassified 849
464 Ga0451793_1823140 3300041452 Bacteria 971
465 Ga0451797_0568949 3300041453 Bacteria 634
466 Ga0451797_1592023 3300041453 Bacteria 834
467 Ga0451798_0120783 3300041458 Bacteria 1489
468 Ga0451800_0962893 3300041459 Bacteria 1231
469 Ga0451800_1521351 3300041459 Bacteria 676
470 Ga0451800_1531549 3300041459 Bacteria 578
471 Ga0451807_2459553 3300041486 Bacteria 1023
472 Ga0451807_2753639 3300041486 Bacteria 1312
473 Ga0451835_0584404 3300041492 Unclassified 632
474 Ga0451839_0104030 3300041496 Bacteria 553
475 Ga0451839_1482669 3300041496 Bacteria 984
476 Ga0451845_0690341 3300041501 Bacteria 1079
477 Ga0451847_0533480 3300041503 Bacteria 659
478 Ga0451847_1017840 3300041503 Bacteria 634
479 Ga0451849_0015521 3300041505 Bacteria 1558
480 Ga0451851_1071820 3300041507 Bacteria 837
481 Ga0451843_0971763 3300041509 Bacteria 621
482 Ga0451855_1128345 3300041511 Bacteria 812
483 Ga0451853_0363567 3300041512 Bacteria 571
484 Ga0451853_0696920 3300041512 Bacteria 795
485 Ga0466972_0611188 3300044658 Bacteria 516
486 Ga0466972_0623909 3300044658 Bacteria 510
487 Ga0466965_0041809 3300044683 Bacteria 2259
488 Ga0466965_0474984 3300044683 Bacteria 699
489 Ga0466963_0000325 3300044694 Bacteria 21618
490 Ga0466963_0091504 3300044694 Bacteria 2072
491 Ga0466963_0148465 3300044694 Bacteria 1627
492 Ga0466963_0189816 3300044694 Bacteria 1435
493 Ga0466963_0243841 3300044694 Bacteria 1260
494 Ga0466963_0802790 3300044694 Bacteria 664
495 Ga0466963_1243059 3300044694 Bacteria 523
496 Ga0466964_0012715 3300044706 Bacteria 3186
497 Ga0466964_0699786 3300044706 Bacteria 565
498 Ga0466971_0484410 3300044719 Bacteria 609
499 Ga0466968_0092224 3300044735 Bacteria 1344
500 Ga0466957_0001797 3300044842 Bacteria 11298
501 Ga0466957_0047130 3300044842 Bacteria 2618
502 Ga0466957_0249760 3300044842 Bacteria 1179
503 Ga0466957_0312582 3300044842 Bacteria 1058
504 Ga0466960_0027831 3300044901 Bacteria 2582
505 Ga0466960_0326107 3300044901 Bacteria 871
506 Ga0466960_0458185 3300044901 Bacteria 742
507 Ga0466959_0157928 3300045049 Bacteria 1595
508 Ga0466959_0651993 3300045049 Unclassified 707
509 Ga0466967_0000003 3300045976 Bacteria 169144
510 Ga0466967_0016300 3300045976 Bacteria 5855
511 Ga0466967_0078881 3300045976 Bacteria 2967
512 Ga0466967_0174648 3300045976 Bacteria 2023
513 Ga0466967_0180576 3300045976 Bacteria 1990
514 Ga0466967_0246362 3300045976 Bacteria 1705
515 Ga0466967_0305451 3300045976 Bacteria 1531
516 Ga0466967_0713344 3300045976 Bacteria 994
517 Ga0466967_1164310 3300045976 Unclassified 768
518 Ga0466967_1828363 3300045976 Bacteria 604
519 Ga0466967_1901317 3300045976 Bacteria 592
520 Ga0466967_2041674 3300045976 Bacteria 570
521 Ga0495592_0379127 3300046454 Bacteria 900
522 Ga0495603_0016811 3300046455 Bacteria 4426
523 Ga0495603_0354205 3300046455 Bacteria 842
524 Ga0495629_0000543 3300046459 Bacteria 31107
525 Ga0495629_0004371 3300046459 Bacteria 10589
526 Ga0495629_0012223 3300046459 Bacteria 6217
527 Ga0495638_0020983 3300046460 Bacteria 4312
528 Ga0495641_0224857 3300046461 Bacteria 842
529 Ga0495651_0498329 3300046462 Bacteria 780
530 Ga0495582_0102203 3300046473 Bacteria 1605
531 Ga0495594_0000001 3300046499 Bacteria 293051
532 Ga0495606_0000283 3300046507 Bacteria 88309
533 Ga0495610_0195216 3300046512 Bacteria 833
534 Ga0495620_0132685 3300046515 Bacteria 977
535 Ga0495628_0551123 3300046516 Bacteria 828
536 Ga0495630_0000148 3300046517 Bacteria 54619
537 Ga0495630_0058503 3300046517 Bacteria 2890
538 Ga0495632_0365621 3300046519 Unclassified 633
539 Ga0495637_0269230 3300046520 Bacteria 610
540 Ga0495663_0049848 3300046525 Bacteria 1294
541 Ga0495587_0004030 3300046536 Bacteria 9732
542 Ga0495609_0168465 3300046538 Bacteria 926
543 Ga0495622_0000069 3300046557 Bacteria 89759
544 Ga0495667_0000067 3300046559 Bacteria 81751
545 Ga0495668_0495013 3300046616 Bacteria 674
546 Ga0495635_0988306 3300046663 Bacteria 536
547 Ga0495661_0182597 3300046665 Bacteria 1111
548 Ga0495588_0000175 3300046674 Bacteria 80911
549 Ga0495647_0000114 3300046681 Bacteria 20349
550 Ga0495658_0001193 3300046683 Bacteria 13694
551 Ga0495669_0145768 3300046684 Bacteria 1119
552 Ga0495613_0000087 3300046689 Bacteria 88644
553 Ga0495613_0438326 3300046689 Unclassified 886
554 Ga0495624_0000429 3300046690 Bacteria 33305
555 Ga0495624_0903785 3300046690 Bacteria 520
556 Ga0495600_0199436 3300046809 Bacteria 1285
557 Ga0495660_0280070 3300046810 Bacteria 763
558 Ga0495604_0000294 3300047317 Bacteria 44723
559 Ga0495604_0000322 3300047317 Bacteria 42966
560 Ga0495676_0012216 3300047321 Bacteria 7743
561 Ga0495676_0256531 3300047321 Bacteria 1191
562 Ga0495680_0009089 3300047322 Bacteria 8968
563 Ga0495680_0009545 3300047322 Bacteria 8718
564 Ga0495679_159480 3300047446 Bacteria 603
565 Ga0495686_0195056 3300047472 Bacteria 1165
566 Ga0495602_0098658 3300048088 Bacteria 2403
567 Ga0495614_0361580 3300048089 Bacteria 678
568 Ga0496101_0098373 3300048904 Bacteria 2186
569 Ga0496101_0261993 3300048904 Bacteria 1348
570 Ga0496102_0205724 3300048905 Bacteria 1856
571 Ga0496102_0443144 3300048905 Bacteria 1218
572 Ga0496102_0676422 3300048905 Bacteria 955
573 Ga0496103_0054861 3300048906 Bacteria 2470
574 Ga0496103_0161620 3300048906 Bacteria 1437
575 Ga0496103_0727147 3300048906 Bacteria 628
576 Ga0496104_0000029 3300048907 Bacteria 202968
577 Ga0496104_0014298 3300048907 Bacteria 7166
578 Ga0496105_0000002 3300048908 Bacteria 753215
579 Ga0496105_0016825 3300048908 Bacteria 5847
580 Ga0496105_0582714 3300048908 Bacteria 870
581 Ga0496106_0007093 3300048909 Bacteria 8281
582 Ga0496106_0053622 3300048909 Bacteria 3046
583 Ga0496106_0083694 3300048909 Bacteria 2454
584 Ga0496106_0090380 3300048909 Bacteria 2363
585 Ga0496106_0427825 3300048909 Bacteria 1064
586 Ga0496106_1425971 3300048909 Bacteria 534
587 Ga0496107_0003048 3300048910 Bacteria 11115
588 Ga0496107_0102247 3300048910 Bacteria 2101
589 Ga0496108_0000042 3300048911 Bacteria 146397
590 Ga0496108_0025650 3300048911 Bacteria 4859
591 Ga0496108_0146414 3300048911 Bacteria 2036
592 Ga0496108_0146776 3300048911 Bacteria 2034
593 Ga0496108_0688821 3300048911 Bacteria 887
594 Ga0496109_0000034 3300048912 Bacteria 160397
595 Ga0496109_0000062 3300048912 Bacteria 112843
596 Ga0496109_0047839 3300048912 Bacteria 3890
597 Ga0496109_0048581 3300048912 Bacteria 3861
598 Ga0496109_0244706 3300048912 Bacteria 1688
599 Ga0496109_0345152 3300048912 Bacteria 1406
600 Ga0496110_0000325 3300048913 Bacteria 31707
601 Ga0496110_0033230 3300048913 Bacteria 4460
602 Ga0496110_0322477 3300048913 Bacteria 1407
603 Ga0496111_0000171 3300048914 Bacteria 29367
604 Ga0496111_0019086 3300048914 Bacteria 4757
605 Ga0496111_0130566 3300048914 Bacteria 1859
606 Ga0496111_0171265 3300048914 Bacteria 1613
607 Ga0496112_0007934 3300048915 Bacteria 9463
608 Ga0496112_0116679 3300048915 Bacteria 2640
609 Ga0496112_0162496 3300048915 Bacteria 2200
610 Ga0496112_0205890 3300048915 Bacteria 1925
611 Ga0496112_0506865 3300048915 Bacteria 1142
612 Ga0496112_0556271 3300048915 Bacteria 1081
613 Ga0496112_0927707 3300048915 Bacteria 792
614 Ga0496113_0000002 3300048916 Bacteria 220193
615 Ga0496113_0152946 3300048916 Bacteria 1821
616 Ga0496113_0332367 3300048916 Bacteria 1218
617 Ga0496113_1195833 3300048916 Bacteria 594
618 Ga0496114_0044319 3300048917 Bacteria 3690
619 Ga0496114_1763687 3300048917 Bacteria 507
620 Ga0496115_0000005 3300048918 Bacteria 290756
621 Ga0496115_0059791 3300048918 Bacteria 3069
622 Ga0496115_0849892 3300048918 Bacteria 707
623 Ga0496115_1430136 3300048918 Bacteria 509
624 Ga0496119_0008336 3300048922 Bacteria 9135
625 Ga0496120_0024517 3300048923 Bacteria 3760
626 Ga0496124_0339239 3300048927 Bacteria 1068
627 Ga0496126_0061679 3300048929 Bacteria 3367
628 Ga0501034_0081325 3300049571 Bacteria 3242
629 Ga0501040_0254900 3300049576 Bacteria 1252
630 Ga0501041_0683370 3300049577 Bacteria 657
631 Ga0501042_0168994 3300049578 Bacteria 1578
632 Ga0501042_0868902 3300049578 Bacteria 657
633 Ga0501067_0072151 3300049583 Bacteria 1913
634 Ga0501068_0510074 3300049584 Bacteria 780
635 Ga0501069_0037955 3300049585 Bacteria 2658
636 Ga0501069_0675716 3300049585 Bacteria 622
637 Ga0501070_0045138 3300049586 Bacteria 3665
638 Ga0501070_0119369 3300049586 Bacteria 2179
639 Ga0501071_0116010 3300049587 Bacteria 1982
640 Ga0501071_1423026 3300049587 Bacteria 535
641 Ga0501072_0103023 3300049588 Bacteria 2268
642 Ga0501072_0990683 3300049588 Bacteria 655
643 Ga0501073_0065086 3300049589 Bacteria 2542
644 Ga0501074_0080523 3300049590 Bacteria 2336
645 Ga0501074_1078343 3300049590 Bacteria 564
646 Ga0501075_1163576 3300049591 Bacteria 585
647 Ga0501076_0052178 3300049592 Bacteria 3239
648 Ga0501076_0540301 3300049592 Bacteria 961
649 Ga0501223_047693 3300049663 Bacteria 831
650 Ga0501080_0010572 3300049742 Bacteria 8449
651 Ga0501081_0549433 3300049743 Bacteria 863
652 Ga0501083_0059117 3300049744 Bacteria 2564
653 Ga0501045_0648123 3300049824 Bacteria 781
654 nmdc:mga03n38_46532_c1 3300050490 Bacteria 1916
655 nmdc:mga03n38_74187_c1 3300050490 Bacteria 1582
656 nmdc:mga03n38_912434_c1 3300050490 Bacteria 517
657 nmdc:mga00v17_277105_c1 3300050491 Bacteria 1089
658 nmdc:mga00v17_293610_c1 3300050491 Bacteria 1056
659 nmdc:mga00v17_794267_c1 3300050491 Bacteria 603
660 nmdc:mga0yw44_1227_c1 3300050492 Bacteria 10057
661 nmdc:mga06z11_426041_c1 3300050494 Bacteria 800
662 nmdc:mga06z11_470878_c1 3300050494 Bacteria 760
663 nmdc:mga06z11_775005_c1 3300050494 Archaea 584
664 nmdc:mga04h51_66654_c1 3300050495 Bacteria 1247
665 nmdc:mga05p37_1389666_c1 3300050507 Bacteria 708
666 nmdc:mga05p37_242619_c1 3300050507 Bacteria 2165
667 nmdc:mga05p37_27608_c1 3300050507 Bacteria 6913
668 nmdc:mga05p37_30668_c1 3300050507 Bacteria 4211
669 nmdc:mga05p37_343611_c1 3300050507 Bacteria 1759
670 nmdc:mga05p37_526288_c1 3300050507 Bacteria 1351
671 nmdc:mga05p37_780875_c1 3300050507 Bacteria 1048
672 nmdc:mga0qj67_251293_c1 3300050509 Bacteria 1435
673 nmdc:mga06r32_133354_c1 3300050510 Bacteria 2458
674 nmdc:mga06r32_137843_c1 3300050510 Bacteria 2415
675 nmdc:mga08y16_186554_c1 3300050511 Bacteria 2152
676 nmdc:mga08y16_279757_c1 3300050511 Bacteria 1721
677 nmdc:mga08y16_69250_c1 3300050511 Bacteria 3678
678 nmdc:mga0n895_124212_c1 3300050512 Bacteria 2604
679 nmdc:mga0n895_221072_c1 3300050512 Bacteria 1923
680 nmdc:mga0n895_221321_c1 3300050512 Bacteria 1922
681 nmdc:mga0n895_300014_c1 3300050512 Bacteria 1629
682 nmdc:mga0n895_304789_c1 3300050512 Bacteria 1615
683 nmdc:mga0rr50_164353_c1 3300050513 Bacteria 1804
684 nmdc:mga0rr50_352212_c1 3300050513 Bacteria 1238
685 nmdc:mga0rr50_607137_c1 3300050513 Bacteria 933
686 nmdc:mga0rr50_900039_c1 3300050513 Bacteria 755
687 nmdc:mga08x19_20160_c1 3300050514 Bacteria 4104
688 nmdc:mga08x19_218667_c2 3300050514 Bacteria 867
689 nmdc:mga0a205_269804_c1 3300050515 Bacteria 1579
690 nmdc:mga0a205_330056_c1 3300050515 Bacteria 1395
691 nmdc:mga0a205_39097_c1 3300050515 Bacteria 4566
692 nmdc:mga0a205_391337_c1 3300050515 Bacteria 1254
693 nmdc:mga0a205_483808_c1 3300050515 Bacteria 1096
694 nmdc:mga0a205_76480_c1 3300050515 Bacteria 3235
695 nmdc:mga0a205_787049_c1 3300050515 Bacteria 799
696 Ga0495601_0000065 3300053077 Bacteria 58386
697 Ga0495601_0615364 3300053077 Bacteria 696
698 Ga0495612_0004181 3300053078 Bacteria 5986
699 Ga0495612_0127430 3300053078 Bacteria 1098
700 Ga0495655_0001612 3300053083 Bacteria 3478
701 Ga0500566_0001523 3300053094 Bacteria 13612
702 Ga0500641_0001013 3300053096 Bacteria 9986
703 Ga0587070_237860 3300059491 Bacteria 501
704 Ga0587082_172648 3300059504 Bacteria 525
705 Ga0587083_0170895 3300059505 Bacteria 602
706 Ga0587088_157147 3300059508 Bacteria 554
707 Ga0587122_014059 3300059628 Bacteria 803
708 Ga0587128_131078 3300059630 Bacteria 555
709 Ga0587062_142422 3300059639 Bacteria 501
710 Ga0587075_131115 3300059644 Bacteria 528
711 Ga0587107_110780 3300059652 Bacteria 555
712 Ga0530510_0442489 3300061734 Bacteria 982

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0800121 Ga0395898_0800121_447_743 85
2 3300038443 Ga0395901_0531828 Ga0395901_0531828_735_1031 85
3 3300038996 Ga0242420_065698 Ga0242420_065698_99_362 86
4 3300044901 Ga0466960_0458185 Ga0466960_0458185_12_275 86
5 3300050509 nmdc:mga0qj67_251293_c1 nmdc:mga0qj67_251293_c1_299_568 87
6 3300050510 nmdc:mga06r32_137843_c1 nmdc:mga06r32_137843_c1_382_651 87
7 3300009147 Ga0114129_10050964 Ga0114129_100509646 92
8 3300009553 Ga0105249_10887626 Ga0105249_108876262 92
9 3300011119 Ga0105246_11443917 Ga0105246_114439172 92
10 3300044719 Ga0466971_0484410 Ga0466971_0484410_315_599 92
11 3300049590 Ga0501074_1078343 Ga0501074_1078343_11_292 92
12 3300049663 Ga0501223_047693 Ga0501223_047693_32_331 92
13 3300032126 Ga0307415_100314408 Ga0307415_1003144082 94
14 3300005334 Ga0068869_100470828 Ga0068869_1004708282 96
15 3300005337 Ga0070682_101560229 Ga0070682_1015602292 96
16 3300005338 Ga0068868_100205078 Ga0068868_1002050782 96
17 3300005339 Ga0070660_100977385 Ga0070660_1009773852 96
18 3300005341 Ga0070691_10605351 Ga0070691_106053512 96
19 3300005345 Ga0070692_10476939 Ga0070692_104769392 96
20 3300005347 Ga0070668_100493835 Ga0070668_1004938352 96
21 3300005353 Ga0070669_101019536 Ga0070669_1010195361 96
22 3300005364 Ga0070673_100086451 Ga0070673_1000864513 96
23 3300005406 Ga0070703_10007328 Ga0070703_100073285 96
24 3300005406 Ga0070703_10184774 Ga0070703_101847742 96
25 3300005434 Ga0070709_10158499 Ga0070709_101584992 96
26 3300005435 Ga0070714_100461620 Ga0070714_1004616202 96
27 3300005435 Ga0070714_101102191 Ga0070714_1011021912 96
28 3300005436 Ga0070713_101851106 Ga0070713_1018511062 96
29 3300005437 Ga0070710_10006050 Ga0070710_100060506 96
30 3300005438 Ga0070701_10131180 Ga0070701_101311802 96
31 3300005439 Ga0070711_100056501 Ga0070711_1000565014 96
32 3300005439 Ga0070711_100098619 Ga0070711_1000986193 96
33 3300005439 Ga0070711_100612532 Ga0070711_1006125322 96
34 3300005440 Ga0070705_100035023 Ga0070705_1000350233 96
35 3300005440 Ga0070705_100122688 Ga0070705_1001226882 96
36 3300005441 Ga0070700_100676660 Ga0070700_1006766602 96
37 3300005441 Ga0070700_101604509 Ga0070700_1016045091 96
38 3300005444 Ga0070694_100071519 Ga0070694_1000715193 96
39 3300005444 Ga0070694_100729993 Ga0070694_1007299932 96
40 3300005445 Ga0070708_100121070 Ga0070708_1001210704 96
41 3300005445 Ga0070708_100134963 Ga0070708_1001349632 96
42 3300005445 Ga0070708_101054884 Ga0070708_1010548842 96
43 3300005445 Ga0070708_101261013 Ga0070708_1012610132 96
44 3300005456 Ga0070678_100131979 Ga0070678_1001319793 96
45 3300005457 Ga0070662_101463766 Ga0070662_1014637662 96
46 3300005467 Ga0070706_100117116 Ga0070706_1001171163 96
47 3300005467 Ga0070706_100252762 Ga0070706_1002527622 96
48 3300005467 Ga0070706_100289770 Ga0070706_1002897702 96
49 3300005467 Ga0070706_100877895 Ga0070706_1008778952 96
50 3300005468 Ga0070707_100006023 Ga0070707_10000602319 96
51 3300005468 Ga0070707_100156984 Ga0070707_1001569843 96
52 3300005468 Ga0070707_101108328 Ga0070707_1011083282 96
53 3300005471 Ga0070698_100006728 Ga0070698_1000067286 96
54 3300005471 Ga0070698_100727932 Ga0070698_1007279322 96
55 3300005518 Ga0070699_100058662 Ga0070699_1000586625 96
56 3300005518 Ga0070699_100066816 Ga0070699_1000668163 96
57 3300005518 Ga0070699_101543319 Ga0070699_1015433191 96
58 3300005536 Ga0070697_100038883 Ga0070697_1000388832 96
59 3300005536 Ga0070697_100054355 Ga0070697_1000543552 96
60 3300005536 Ga0070697_100451571 Ga0070697_1004515712 96
61 3300005536 Ga0070697_100631526 Ga0070697_1006315261 96
62 3300005545 Ga0070695_100026750 Ga0070695_1000267503 96
63 3300005545 Ga0070695_100521999 Ga0070695_1005219992 96
64 3300005546 Ga0070696_100011377 Ga0070696_1000113775 96
65 3300005546 Ga0070696_100255569 Ga0070696_1002555692 96
66 3300005546 Ga0070696_101922975 Ga0070696_1019229751 96
67 3300005547 Ga0070693_100046459 Ga0070693_1000464592 96
68 3300005549 Ga0070704_100088096 Ga0070704_1000880962 96
69 3300005549 Ga0070704_100103630 Ga0070704_1001036302 96
70 3300005549 Ga0070704_100321630 Ga0070704_1003216301 96
71 3300005549 Ga0070704_101773973 Ga0070704_1017739731 96
72 3300005615 Ga0070702_100229270 Ga0070702_1002292702 96
73 3300005718 Ga0068866_10097922 Ga0068866_100979223 96
74 3300005718 Ga0068866_10517920 Ga0068866_105179202 96
75 3300005719 Ga0068861_100320641 Ga0068861_1003206412 96
76 3300005844 Ga0068862_100374424 Ga0068862_1003744242 96
77 3300006028 Ga0070717_10326610 Ga0070717_103266102 96
78 3300006058 Ga0075432_10138437 Ga0075432_101384372 96
79 3300006058 Ga0075432_10190440 Ga0075432_101904402 96
80 3300006163 Ga0070715_10018624 Ga0070715_100186244 96
81 3300006173 Ga0070716_100151956 Ga0070716_1001519562 96
82 3300006173 Ga0070716_100204582 Ga0070716_1002045823 96
83 3300006175 Ga0070712_100009426 Ga0070712_1000094262 96
84 3300006175 Ga0070712_100029957 Ga0070712_1000299574 96
85 3300006175 Ga0070712_100065918 Ga0070712_1000659184 96
86 3300006175 Ga0070712_100932696 Ga0070712_1009326962 96
87 3300006175 Ga0070712_101066316 Ga0070712_1010663162 96
88 3300006844 Ga0075428_100106741 Ga0075428_1001067415 96
89 3300006852 Ga0075433_10124042 Ga0075433_101240425 96
90 3300006852 Ga0075433_10142114 Ga0075433_101421142 96
91 3300006871 Ga0075434_100091140 Ga0075434_1000911405 96
92 3300006871 Ga0075434_100152574 Ga0075434_1001525743 96
93 3300006871 Ga0075434_100440922 Ga0075434_1004409222 96
94 3300006914 Ga0075436_100015159 Ga0075436_1000151595 96
95 3300006914 Ga0075436_100023145 Ga0075436_1000231452 96
96 3300006914 Ga0075436_100089801 Ga0075436_1000898012 96
97 3300007076 Ga0075435_100172450 Ga0075435_1001724502 96
98 3300007076 Ga0075435_100242104 Ga0075435_1002421042 96
99 3300007076 Ga0075435_100433442 Ga0075435_1004334422 96
100 3300009094 Ga0111539_11156386 Ga0111539_111563862 96
101 3300009098 Ga0105245_10132007 Ga0105245_101320074 96
102 3300009098 Ga0105245_10622788 Ga0105245_106227882 96
103 3300009147 Ga0114129_10022048 Ga0114129_1002204812 96
104 3300009147 Ga0114129_10564660 Ga0114129_105646602 96
105 3300009148 Ga0105243_10166998 Ga0105243_101669982 96
106 3300009148 Ga0105243_10457294 Ga0105243_104572942 96
107 3300009174 Ga0105241_10331846 Ga0105241_103318462 96
108 3300009174 Ga0105241_10412507 Ga0105241_104125072 96
109 3300009176 Ga0105242_10280358 Ga0105242_102803583 96
110 3300009545 Ga0105237_10310730 Ga0105237_103107303 96
111 3300009553 Ga0105249_10192765 Ga0105249_101927653 96
112 3300009553 Ga0105249_11199002 Ga0105249_111990022 96
113 3300010375 Ga0105239_11078077 Ga0105239_110780772 96
114 3300011119 Ga0105246_10233529 Ga0105246_102335292 96
115 3300013297 Ga0157378_11210205 Ga0157378_112102052 96
116 3300013297 Ga0157378_11392702 Ga0157378_113927022 96
117 3300013308 Ga0157375_10213663 Ga0157375_102136632 96
118 3300014745 Ga0157377_10448849 Ga0157377_104488492 96
119 3300014969 Ga0157376_10147888 Ga0157376_101478883 96
120 3300017792 Ga0163161_10505855 Ga0163161_105058551 96
121 3300025885 Ga0207653_10005876 Ga0207653_100058765 96
122 3300025885 Ga0207653_10066321 Ga0207653_100663212 96
123 3300025898 Ga0207692_10179751 Ga0207692_101797512 96
124 3300025899 Ga0207642_10418196 Ga0207642_104181962 96
125 3300025901 Ga0207688_10013692 Ga0207688_100136922 96
126 3300025906 Ga0207699_10432943 Ga0207699_104329432 96
127 3300025906 Ga0207699_10774554 Ga0207699_107745542 96
128 3300025907 Ga0207645_10754135 Ga0207645_107541352 96
129 3300025910 Ga0207684_10190082 Ga0207684_101900822 96
130 3300025910 Ga0207684_10244393 Ga0207684_102443933 96
131 3300025910 Ga0207684_10282097 Ga0207684_102820973 96
132 3300025910 Ga0207684_10742203 Ga0207684_107422031 96
133 3300025911 Ga0207654_10227130 Ga0207654_102271302 96
134 3300025915 Ga0207693_10021106 Ga0207693_100211066 96
135 3300025915 Ga0207693_10060283 Ga0207693_100602833 96
136 3300025915 Ga0207693_10065127 Ga0207693_100651272 96
137 3300025915 Ga0207693_10597914 Ga0207693_105979142 96
138 3300025916 Ga0207663_10076229 Ga0207663_100762292 96
139 3300025916 Ga0207663_10230238 Ga0207663_102302382 96
140 3300025916 Ga0207663_10330257 Ga0207663_103302572 96
141 3300025922 Ga0207646_10004454 Ga0207646_1000445420 96
142 3300025922 Ga0207646_10382546 Ga0207646_103825461 96
143 3300025922 Ga0207646_10943370 Ga0207646_109433701 96
144 3300025923 Ga0207681_10808220 Ga0207681_108082202 96
145 3300025927 Ga0207687_10456365 Ga0207687_104563652 96
146 3300025929 Ga0207664_10061436 Ga0207664_100614364 96
147 3300025929 Ga0207664_11769777 Ga0207664_117697772 96
148 3300025933 Ga0207706_10258717 Ga0207706_102587172 96
149 3300025934 Ga0207686_10131073 Ga0207686_101310731 96
150 3300025934 Ga0207686_10243650 Ga0207686_102436502 96
151 3300025935 Ga0207709_10259854 Ga0207709_102598542 96
152 3300025936 Ga0207670_11556278 Ga0207670_115562782 96
153 3300025939 Ga0207665_10010210 Ga0207665_100102109 96
154 3300025939 Ga0207665_10066182 Ga0207665_100661822 96
155 3300025939 Ga0207665_10210172 Ga0207665_102101723 96
156 3300025942 Ga0207689_10602784 Ga0207689_106027842 96
157 3300025960 Ga0207651_11408593 Ga0207651_114085932 96
158 3300025961 Ga0207712_10424053 Ga0207712_104240531 96
159 3300025972 Ga0207668_10248318 Ga0207668_102483183 96
160 3300026075 Ga0207708_11239234 Ga0207708_112392342 96
161 3300026095 Ga0207676_11217105 Ga0207676_112171052 96
162 3300026118 Ga0207675_100118172 Ga0207675_1001181722 96
163 3300026121 Ga0207683_10110663 Ga0207683_101106632 96
164 3300027907 Ga0207428_10542292 Ga0207428_105422922 96
165 3300028380 Ga0268265_11048541 Ga0268265_110485412 96
166 3300028381 Ga0268264_10300719 Ga0268264_103007193 96
167 3300034817 Ga0373948_0212505 Ga0373948_0212505_162_461 96
168 3300035084 Ga0373928_0005114 Ga0373928_0005114_1655_1954 96
169 3300035085 Ga0373929_0000967 Ga0373929_0000967_63_362 96
170 3300035088 Ga0373940_0000176 Ga0373940_0000176_2732_3031 96
171 3300035090 Ga0373949_0007429 Ga0373949_0007429_1781_2080 96
172 3300035091 Ga0373951_0001169 Ga0373951_0001169_3914_4213 96
173 3300035092 Ga0373952_0017206 Ga0373952_0017206_508_807 96
174 3300035112 Ga0373932_0001381 Ga0373932_0001381_4849_5148 96
175 3300035114 Ga0373939_0002086 Ga0373939_0002086_1122_1421 96
176 3300035115 Ga0373941_0001669 Ga0373941_0001669_764_1063 96
177 3300035121 Ga0373960_0030906 Ga0373960_0030906_616_915 96
178 3300035207 Ga0373942_0001255 Ga0373942_0001255_2629_2928 96
179 3300035241 Ga0373961_0001439 Ga0373961_0001439_1382_1681 96
180 3300035242 Ga0373962_0001897 Ga0373962_0001897_504_803 96
181 3300035691 Ga0373931_0000630 Ga0373931_0000630_12780_13079 96
182 3300037312 Ga0395899_0070435 Ga0395899_0070435_1034_1333 96
183 3300037312 Ga0395899_0408712 Ga0395899_0408712_576_875 96
184 3300037418 Ga0395900_0036001 Ga0395900_0036001_3703_4002 96
185 3300037418 Ga0395900_0096582 Ga0395900_0096582_1839_2138 96
186 3300037418 Ga0395900_0436233 Ga0395900_0436233_168_467 96
187 3300037418 Ga0395900_1353037 Ga0395900_1353037_179_478 96
188 3300037466 Ga0395898_0004111 Ga0395898_0004111_5554_5853 96
189 3300037466 Ga0395898_0093521 Ga0395898_0093521_2003_2302 96
190 3300037466 Ga0395898_0422362 Ga0395898_0422362_164_463 96
191 3300037471 Ga0395905_0035350 Ga0395905_0035350_3166_3465 96
192 3300037471 Ga0395905_1236591 Ga0395905_1236591_28_327 96
193 3300038443 Ga0395901_0039011 Ga0395901_0039011_2450_2749 96
194 3300038443 Ga0395901_0065123 Ga0395901_0065123_2050_2349 96
195 3300038443 Ga0395901_0393601 Ga0395901_0393601_1064_1363 96
196 3300038443 Ga0395901_0876270 Ga0395901_0876270_231_530 96
197 3300038443 Ga0395901_1198073 Ga0395901_1198073_84_383 96
198 3300038443 Ga0395901_1268007 Ga0395901_1268007_177_476 96
199 3300038698 Ga0242419_015744 Ga0242419_015744_205_504 96
200 3300041443 Ga0451789_0948123 Ga0451789_0948123_24_323 96
201 3300041443 Ga0451789_1125219 Ga0451789_1125219_361_660 96
202 3300041452 Ga0451793_1823140 Ga0451793_1823140_201_500 96
203 3300041453 Ga0451797_0568949 Ga0451797_0568949_249_548 96
204 3300041453 Ga0451797_1592023 Ga0451797_1592023_320_619 96
205 3300041458 Ga0451798_0120783 Ga0451798_0120783_377_676 96
206 3300041459 Ga0451800_0962893 Ga0451800_0962893_690_989 96
207 3300041459 Ga0451800_1521351 Ga0451800_1521351_72_371 96
208 3300041492 Ga0451835_0584404 Ga0451835_0584404_268_567 96
209 3300041496 Ga0451839_1482669 Ga0451839_1482669_435_734 96
210 3300041501 Ga0451845_0690341 Ga0451845_0690341_369_668 96
211 3300041503 Ga0451847_0533480 Ga0451847_0533480_290_589 96
212 3300041503 Ga0451847_1017840 Ga0451847_1017840_60_353 96
213 3300041505 Ga0451849_0015521 Ga0451849_0015521_443_742 96
214 3300041507 Ga0451851_1071820 Ga0451851_1071820_471_770 96
215 3300041511 Ga0451855_1128345 Ga0451855_1128345_390_689 96
216 3300041512 Ga0451853_0696920 Ga0451853_0696920_353_646 96
217 3300044658 Ga0466972_0623909 Ga0466972_0623909_88_387 96
218 3300044706 Ga0466964_0012715 Ga0466964_0012715_2677_2976 96
219 3300044901 Ga0466960_0027831 Ga0466960_0027831_1906_2205 96
220 3300045976 Ga0466967_0016300 Ga0466967_0016300_685_984 96
221 3300046455 Ga0495603_0016811 Ga0495603_0016811_2749_3048 96
222 3300046473 Ga0495582_0102203 Ga0495582_0102203_1273_1572 96
223 3300046538 Ga0495609_0168465 Ga0495609_0168465_136_435 96
224 3300048904 Ga0496101_0098373 Ga0496101_0098373_1108_1407 96
225 3300048904 Ga0496101_0261993 Ga0496101_0261993_234_533 96
226 3300048905 Ga0496102_0205724 Ga0496102_0205724_857_1156 96
227 3300048905 Ga0496102_0443144 Ga0496102_0443144_819_1118 96
228 3300048906 Ga0496103_0054861 Ga0496103_0054861_1602_1901 96
229 3300048906 Ga0496103_0727147 Ga0496103_0727147_282_581 96
230 3300048907 Ga0496104_0014298 Ga0496104_0014298_1479_1778 96
231 3300048908 Ga0496105_0016825 Ga0496105_0016825_697_996 96
232 3300048909 Ga0496106_0007093 Ga0496106_0007093_7883_8182 96
233 3300048909 Ga0496106_0090380 Ga0496106_0090380_467_766 96
234 3300048909 Ga0496106_1425971 Ga0496106_1425971_147_446 96
235 3300048910 Ga0496107_0003048 Ga0496107_0003048_3136_3435 96
236 3300048911 Ga0496108_0025650 Ga0496108_0025650_3124_3423 96
237 3300048912 Ga0496109_0048581 Ga0496109_0048581_223_522 96
238 3300048912 Ga0496109_0244706 Ga0496109_0244706_1268_1567 96
239 3300048912 Ga0496109_0345152 Ga0496109_0345152_815_1114 96
240 3300048913 Ga0496110_0033230 Ga0496110_0033230_2493_2792 96
241 3300048913 Ga0496110_0322477 Ga0496110_0322477_224_523 96
242 3300048914 Ga0496111_0130566 Ga0496111_0130566_1501_1800 96
243 3300048914 Ga0496111_0171265 Ga0496111_0171265_1268_1567 96
244 3300048915 Ga0496112_0162496 Ga0496112_0162496_176_475 96
245 3300048915 Ga0496112_0205890 Ga0496112_0205890_570_869 96
246 3300048915 Ga0496112_0556271 Ga0496112_0556271_102_401 96
247 3300048916 Ga0496113_0332367 Ga0496113_0332367_101_400 96
248 3300048916 Ga0496113_1195833 Ga0496113_1195833_184_483 96
249 3300048917 Ga0496114_0044319 Ga0496114_0044319_47_346 96
250 3300048918 Ga0496115_0059791 Ga0496115_0059791_1117_1416 96
251 3300048918 Ga0496115_0849892 Ga0496115_0849892_218_517 96
252 3300048918 Ga0496115_1430136 Ga0496115_1430136_27_326 96
253 3300050490 nmdc:mga03n38_912434_c1 nmdc:mga03n38_912434_c1_26_316 96
254 3300050494 nmdc:mga06z11_775005_c1 nmdc:mga06z11_775005_c1_122_412 96
255 3300050507 nmdc:mga05p37_27608_c1 nmdc:mga05p37_27608_c1_897_1196 96
256 3300050507 nmdc:mga05p37_30668_c1 nmdc:mga05p37_30668_c1_2273_2572 96
257 3300050511 nmdc:mga08y16_186554_c1 nmdc:mga08y16_186554_c1_157_456 96
258 3300050512 nmdc:mga0n895_124212_c1 nmdc:mga0n895_124212_c1_2178_2477 96
259 3300050512 nmdc:mga0n895_221321_c1 nmdc:mga0n895_221321_c1_697_996 96
260 3300050512 nmdc:mga0n895_300014_c1 nmdc:mga0n895_300014_c1_1295_1594 96
261 3300050513 nmdc:mga0rr50_164353_c1 nmdc:mga0rr50_164353_c1_92_391 96
262 3300050513 nmdc:mga0rr50_900039_c1 nmdc:mga0rr50_900039_c1_421_720 96
263 3300050514 nmdc:mga08x19_20160_c1 nmdc:mga08x19_20160_c1_2793_3092 96
264 3300050514 nmdc:mga08x19_218667_c2 nmdc:mga08x19_218667_c2_82_381 96
265 3300050515 nmdc:mga0a205_269804_c1 nmdc:mga0a205_269804_c1_158_457 96
266 3300050515 nmdc:mga0a205_330056_c1 nmdc:mga0a205_330056_c1_322_621 96
267 3300050515 nmdc:mga0a205_39097_c1 nmdc:mga0a205_39097_c1_2155_2454 96
268 3300059628 Ga0587122_014059 Ga0587122_014059_99_398 96
269 3300001979 JGI24740J21852_10003124 JGI24740J21852_1000312411 97
270 3300002074 JGI24748J21848_1000332 JGI24748J21848_10003326 97
271 3300002239 JGI24034J26672_10000068 JGI24034J26672_1000006825 97
272 3300002244 JGI24742J22300_10000389 JGI24742J22300_100003895 97
273 3300003203 JGI25406J46586_10046371 JGI25406J46586_100463712 97
274 3300005327 Ga0070658_10460061 Ga0070658_104600612 97
275 3300005327 Ga0070658_11417642 Ga0070658_114176422 97
276 3300005329 Ga0070683_100066804 Ga0070683_1000668045 97
277 3300005329 Ga0070683_100138936 Ga0070683_1001389364 97
278 3300005329 Ga0070683_100733551 Ga0070683_1007335512 97
279 3300005329 Ga0070683_100737480 Ga0070683_1007374802 97
280 3300005329 Ga0070683_100935600 Ga0070683_1009356002 97
281 3300005331 Ga0070670_100085569 Ga0070670_1000855693 97
282 3300005334 Ga0068869_101968049 Ga0068869_1019680492 97
283 3300005335 Ga0070666_10019547 Ga0070666_100195475 97
284 3300005338 Ga0068868_100009889 Ga0068868_1000098894 97
285 3300005338 Ga0068868_100164708 Ga0068868_1001647083 97
286 3300005338 Ga0068868_102145587 Ga0068868_1021455872 97
287 3300005344 Ga0070661_100000236 Ga0070661_10000023638 97
288 3300005345 Ga0070692_10073668 Ga0070692_100736682 97
289 3300005345 Ga0070692_11051645 Ga0070692_110516452 97
290 3300005353 Ga0070669_100063717 Ga0070669_1000637174 97
291 3300005354 Ga0070675_100000930 Ga0070675_10000093010 97
292 3300005354 Ga0070675_102137551 Ga0070675_1021375511 97
293 3300005364 Ga0070673_100044186 Ga0070673_1000441865 97
294 3300005365 Ga0070688_100001088 Ga0070688_1000010887 97
295 3300005365 Ga0070688_100002914 Ga0070688_1000029147 97
296 3300005435 Ga0070714_100156543 Ga0070714_1001565433 97
297 3300005436 Ga0070713_100000171 Ga0070713_10000017156 97
298 3300005438 Ga0070701_10252862 Ga0070701_102528622 97
299 3300005440 Ga0070705_100204040 Ga0070705_1002040402 97
300 3300005440 Ga0070705_101143965 Ga0070705_1011439651 97
301 3300005441 Ga0070700_101133611 Ga0070700_1011336112 97
302 3300005441 Ga0070700_101417870 Ga0070700_1014178702 97
303 3300005445 Ga0070708_100350232 Ga0070708_1003502322 97
304 3300005455 Ga0070663_100477590 Ga0070663_1004775902 97
305 3300005459 Ga0068867_100877000 Ga0068867_1008770002 97
306 3300005466 Ga0070685_10001772 Ga0070685_100017726 97
307 3300005466 Ga0070685_10005627 Ga0070685_100056276 97
308 3300005530 Ga0070679_100648220 Ga0070679_1006482202 97
309 3300005535 Ga0070684_100034382 Ga0070684_1000343828 97
310 3300005535 Ga0070684_100149887 Ga0070684_1001498872 97
311 3300005535 Ga0070684_100714527 Ga0070684_1007145272 97
312 3300005539 Ga0068853_101241998 Ga0068853_1012419982 97
313 3300005544 Ga0070686_100172281 Ga0070686_1001722813 97
314 3300005544 Ga0070686_100784541 Ga0070686_1007845412 97
315 3300005544 Ga0070686_100957621 Ga0070686_1009576212 97
316 3300005545 Ga0070695_100395740 Ga0070695_1003957402 97
317 3300005545 Ga0070695_101137426 Ga0070695_1011374262 97
318 3300005547 Ga0070693_100544655 Ga0070693_1005446552 97
319 3300005548 Ga0070665_100379163 Ga0070665_1003791633 97
320 3300005549 Ga0070704_100009153 Ga0070704_1000091536 97
321 3300005549 Ga0070704_100129977 Ga0070704_1001299771 97
322 3300005549 Ga0070704_100449151 Ga0070704_1004491511 97
323 3300005564 Ga0070664_100027426 Ga0070664_1000274266 97
324 3300005577 Ga0068857_100858969 Ga0068857_1008589692 97
325 3300005614 Ga0068856_100007453 Ga0068856_1000074536 97
326 3300005614 Ga0068856_100174723 Ga0068856_1001747233 97
327 3300005615 Ga0070702_100204009 Ga0070702_1002040092 97
328 3300005615 Ga0070702_100995384 Ga0070702_1009953842 97
329 3300005616 Ga0068852_100001042 Ga0068852_10000104216 97
330 3300005616 Ga0068852_100048086 Ga0068852_1000480864 97
331 3300005718 Ga0068866_10809845 Ga0068866_108098451 97
332 3300005842 Ga0068858_100225659 Ga0068858_1002256593 97
333 3300005937 Ga0081455_10063369 Ga0081455_100633692 97
334 3300005937 Ga0081455_10088805 Ga0081455_100888052 97
335 3300005937 Ga0081455_10094536 Ga0081455_100945362 97
336 3300005937 Ga0081455_10163236 Ga0081455_101632362 97
337 3300005981 Ga0081538_10028056 Ga0081538_100280565 97
338 3300005981 Ga0081538_10177458 Ga0081538_101774582 97
339 3300005981 Ga0081538_10241763 Ga0081538_102417631 97
340 3300005983 Ga0081540_1082547 Ga0081540_10825473 97
341 3300005983 Ga0081540_1130288 Ga0081540_11302882 97
342 3300005985 Ga0081539_10002195 Ga0081539_1000219514 97
343 3300005985 Ga0081539_10053821 Ga0081539_100538212 97
344 3300006038 Ga0075365_10000565 Ga0075365_100005656 97
345 3300006038 Ga0075365_10147156 Ga0075365_101471562 97
346 3300006038 Ga0075365_10966079 Ga0075365_109660792 97
347 3300006038 Ga0075365_11129796 Ga0075365_111297962 97
348 3300006042 Ga0075368_10042987 Ga0075368_100429874 97
349 3300006042 Ga0075368_10418026 Ga0075368_104180262 97
350 3300006048 Ga0075363_100023094 Ga0075363_1000230945 97
351 3300006048 Ga0075363_100052586 Ga0075363_1000525862 97
352 3300006048 Ga0075363_100784876 Ga0075363_1007848761 97
353 3300006051 Ga0075364_10020535 Ga0075364_100205352 97
354 3300006051 Ga0075364_10469890 Ga0075364_104698902 97
355 3300006051 Ga0075364_10597025 Ga0075364_105970252 97
356 3300006163 Ga0070715_11052010 Ga0070715_110520101 97
357 3300006175 Ga0070712_100000350 Ga0070712_10000035031 97
358 3300006175 Ga0070712_100003252 Ga0070712_10000325218 97
359 3300006178 Ga0075367_10053516 Ga0075367_100535162 97
360 3300006178 Ga0075367_10089759 Ga0075367_100897594 97
361 3300006178 Ga0075367_10383939 Ga0075367_103839392 97
362 3300006358 Ga0068871_100608759 Ga0068871_1006087592 97
363 3300006358 Ga0068871_101152747 Ga0068871_1011527471 97
364 3300006846 Ga0075430_100064783 Ga0075430_1000647835 97
365 3300006846 Ga0075430_100296788 Ga0075430_1002967882 97
366 3300006847 Ga0075431_100008449 Ga0075431_10000844919 97
367 3300006847 Ga0075431_100128099 Ga0075431_1001280993 97
368 3300006852 Ga0075433_10127527 Ga0075433_101275273 97
369 3300006852 Ga0075433_11221515 Ga0075433_112215152 97
370 3300006871 Ga0075434_100034388 Ga0075434_1000343885 97
371 3300006871 Ga0075434_100051811 Ga0075434_1000518115 97
372 3300006881 Ga0068865_100000056 Ga0068865_10000005616 97
373 3300006881 Ga0068865_100560365 Ga0068865_1005603652 97
374 3300006914 Ga0075436_100501609 Ga0075436_1005016092 97
375 3300007076 Ga0075435_100238820 Ga0075435_1002388203 97
376 3300009094 Ga0111539_10094044 Ga0111539_100940445 97
377 3300009094 Ga0111539_10157492 Ga0111539_101574923 97
378 3300009094 Ga0111539_11201731 Ga0111539_112017312 97
379 3300009094 Ga0111539_11995575 Ga0111539_119955751 97
380 3300009098 Ga0105245_10000528 Ga0105245_1000052844 97
381 3300009098 Ga0105245_12882671 Ga0105245_128826711 97
382 3300009101 Ga0105247_10056313 Ga0105247_100563134 97
383 3300009147 Ga0114129_10087401 Ga0114129_100874013 97
384 3300009147 Ga0114129_10443919 Ga0114129_104439192 97
385 3300009147 Ga0114129_10537753 Ga0114129_105377532 97
386 3300009148 Ga0105243_10080350 Ga0105243_100803502 97
387 3300009148 Ga0105243_10229273 Ga0105243_102292733 97
388 3300009148 Ga0105243_11305037 Ga0105243_113050372 97
389 3300009148 Ga0105243_11552551 Ga0105243_115525512 97
390 3300009174 Ga0105241_10290918 Ga0105241_102909182 97
391 3300009176 Ga0105242_10479491 Ga0105242_104794911 97
392 3300009177 Ga0105248_10001735 Ga0105248_1000173524 97
393 3300009545 Ga0105237_10865772 Ga0105237_108657722 97
394 3300009553 Ga0105249_12323880 Ga0105249_123238802 97
395 3300009553 Ga0105249_13546368 Ga0105249_135463682 97
396 3300010375 Ga0105239_10328645 Ga0105239_103286453 97
397 3300010375 Ga0105239_10348056 Ga0105239_103480563 97
398 3300010375 Ga0105239_10555738 Ga0105239_105557382 97
399 3300010375 Ga0105239_10567142 Ga0105239_105671422 97
400 3300010375 Ga0105239_10965151 Ga0105239_109651512 97
401 3300010375 Ga0105239_11864998 Ga0105239_118649982 97
402 3300010375 Ga0105239_12573573 Ga0105239_125735732 97
403 3300011119 Ga0105246_10017131 Ga0105246_100171315 97
404 3300011119 Ga0105246_11788921 Ga0105246_117889212 97
405 3300013100 Ga0157373_10703726 Ga0157373_107037262 97
406 3300013102 Ga0157371_11145618 Ga0157371_111456181 97
407 3300013104 Ga0157370_10059005 Ga0157370_100590055 97
408 3300013104 Ga0157370_10132352 Ga0157370_101323523 97
409 3300013105 Ga0157369_10000068 Ga0157369_10000068152 97
410 3300013105 Ga0157369_10893652 Ga0157369_108936522 97
411 3300013297 Ga0157378_10141934 Ga0157378_101419342 97
412 3300013297 Ga0157378_10192377 Ga0157378_101923774 97
413 3300013297 Ga0157378_10578015 Ga0157378_105780152 97
414 3300013297 Ga0157378_11724797 Ga0157378_117247972 97
415 3300013297 Ga0157378_11752016 Ga0157378_117520161 97
416 3300013306 Ga0163162_10322361 Ga0163162_103223612 97
417 3300013308 Ga0157375_10008331 Ga0157375_100083316 97
418 3300013308 Ga0157375_10237203 Ga0157375_102372033 97
419 3300013308 Ga0157375_10993375 Ga0157375_109933752 97
420 3300013308 Ga0157375_12354902 Ga0157375_123549022 97
421 3300014325 Ga0163163_10536951 Ga0163163_105369513 97
422 3300014326 Ga0157380_10000808 Ga0157380_1000080813 97
423 3300014326 Ga0157380_10550426 Ga0157380_105504263 97
424 3300014326 Ga0157380_12294680 Ga0157380_122946802 97
425 3300014326 Ga0157380_13452389 Ga0157380_134523892 97
426 3300014745 Ga0157377_11330290 Ga0157377_113302902 97
427 3300014969 Ga0157376_10028182 Ga0157376_100281825 97
428 3300014969 Ga0157376_10380065 Ga0157376_103800653 97
429 3300017792 Ga0163161_10637845 Ga0163161_106378452 97
430 3300017792 Ga0163161_11595992 Ga0163161_115959921 97
431 3300020070 Ga0206356_11367151 Ga0206356_113671512 97
432 3300020077 Ga0206351_10990872 Ga0206351_109908722 97
433 3300020082 Ga0206353_11038649 Ga0206353_110386492 97
434 3300020610 Ga0154015_1231294 Ga0154015_12312942 97
435 3300022467 Ga0224712_10379224 Ga0224712_103792242 97
436 3300025898 Ga0207692_10132901 Ga0207692_101329014 97
437 3300025899 Ga0207642_11155049 Ga0207642_111550491 97
438 3300025900 Ga0207710_10015681 Ga0207710_100156813 97
439 3300025903 Ga0207680_10024081 Ga0207680_100240813 97
440 3300025904 Ga0207647_10426568 Ga0207647_104265681 97
441 3300025909 Ga0207705_10367017 Ga0207705_103670172 97
442 3300025911 Ga0207654_10054051 Ga0207654_100540512 97
443 3300025912 Ga0207707_10557590 Ga0207707_105575902 97
444 3300025915 Ga0207693_10000138 Ga0207693_1000013876 97
445 3300025915 Ga0207693_10001647 Ga0207693_1000164716 97
446 3300025918 Ga0207662_11367771 Ga0207662_113677711 97
447 3300025920 Ga0207649_10000388 Ga0207649_1000038833 97
448 3300025923 Ga0207681_10050045 Ga0207681_100500454 97
449 3300025925 Ga0207650_10043384 Ga0207650_100433845 97
450 3300025926 Ga0207659_10000138 Ga0207659_1000013852 97
451 3300025927 Ga0207687_10000025 Ga0207687_1000002512 97
452 3300025928 Ga0207700_10000019 Ga0207700_10000019194 97
453 3300025929 Ga0207664_10104740 Ga0207664_101047405 97
454 3300025929 Ga0207664_10259621 Ga0207664_102596213 97
455 3300025932 Ga0207690_10008867 Ga0207690_100088676 97
456 3300025932 Ga0207690_11284706 Ga0207690_112847061 97
457 3300025933 Ga0207706_10034080 Ga0207706_100340806 97
458 3300025934 Ga0207686_10560266 Ga0207686_105602661 97
459 3300025935 Ga0207709_10040649 Ga0207709_100406492 97
460 3300025938 Ga0207704_10011990 Ga0207704_100119905 97
461 3300025938 Ga0207704_10162270 Ga0207704_101622702 97
462 3300025941 Ga0207711_10000011 Ga0207711_1000001125 97
463 3300025941 Ga0207711_10346335 Ga0207711_103463352 97
464 3300025942 Ga0207689_11352336 Ga0207689_113523362 97
465 3300025944 Ga0207661_10037906 Ga0207661_100379066 97
466 3300025944 Ga0207661_10058350 Ga0207661_100583502 97
467 3300025944 Ga0207661_10757864 Ga0207661_107578642 97
468 3300025944 Ga0207661_11804479 Ga0207661_118044792 97
469 3300025945 Ga0207679_10135579 Ga0207679_101355792 97
470 3300025945 Ga0207679_12107399 Ga0207679_121073992 97
471 3300025949 Ga0207667_10863008 Ga0207667_108630081 97
472 3300025960 Ga0207651_10000746 Ga0207651_100007463 97
473 3300025961 Ga0207712_10129766 Ga0207712_101297663 97
474 3300025972 Ga0207668_10058465 Ga0207668_100584655 97
475 3300025981 Ga0207640_11533875 Ga0207640_115338751 97
476 3300025986 Ga0207658_10122209 Ga0207658_101222092 97
477 3300026023 Ga0207677_10092907 Ga0207677_100929074 97
478 3300026035 Ga0207703_10088903 Ga0207703_100889035 97
479 3300026041 Ga0207639_10647150 Ga0207639_106471502 97
480 3300026067 Ga0207678_10554473 Ga0207678_105544732 97
481 3300026075 Ga0207708_11136141 Ga0207708_111361412 97
482 3300026078 Ga0207702_10006219 Ga0207702_1000621911 97
483 3300026078 Ga0207702_10015335 Ga0207702_100153355 97
484 3300026142 Ga0207698_10000014 Ga0207698_1000001443 97
485 3300026142 Ga0207698_10021851 Ga0207698_100218515 97
486 3300027866 Ga0209813_10010836 Ga0209813_100108365 97
487 3300027866 Ga0209813_10171859 Ga0209813_101718592 97
488 3300027907 Ga0207428_10480986 Ga0207428_104809862 97
489 3300027907 Ga0207428_11048566 Ga0207428_110485662 97
490 3300028379 Ga0268266_10005543 Ga0268266_1000554319 97
491 3300028379 Ga0268266_11232049 Ga0268266_112320492 97
492 3300028381 Ga0268264_10936880 Ga0268264_109368802 97
493 3300028563 Ga0265319_1000030 Ga0265319_100003036 97
494 3300028800 Ga0265338_10000156 Ga0265338_1000015636 97
495 3300030521 Ga0307511_10074607 Ga0307511_100746075 97
496 3300031238 Ga0265332_10222548 Ga0265332_102225482 97
497 3300031241 Ga0265325_10005113 Ga0265325_100051138 97
498 3300031250 Ga0265331_10231032 Ga0265331_102310322 97
499 3300031456 Ga0307513_10200086 Ga0307513_102000862 97
500 3300031548 Ga0307408_101398187 Ga0307408_1013981871 97
501 3300031548 Ga0307408_101887029 Ga0307408_1018870291 97
502 3300031731 Ga0307405_10096705 Ga0307405_100967054 97
503 3300031852 Ga0307410_10426422 Ga0307410_104264222 97
504 3300031901 Ga0307406_10166733 Ga0307406_101667333 97
505 3300031901 Ga0307406_10367682 Ga0307406_103676822 97
506 3300031903 Ga0307407_10172862 Ga0307407_101728623 97
507 3300031911 Ga0307412_10579457 Ga0307412_105794572 97
508 3300032002 Ga0307416_101892741 Ga0307416_1018927412 97
509 3300032004 Ga0307414_10622117 Ga0307414_106221172 97
510 3300032126 Ga0307415_102570228 Ga0307415_1025702281 97
511 3300035170 Ga0373943_0674392 Ga0373943_0674392_65_361 97
512 3300037312 Ga0395899_0161383 Ga0395899_0161383_401_697 97
513 3300037312 Ga0395899_0621570 Ga0395899_0621570_10_306 97
514 3300037312 Ga0395899_0821417 Ga0395899_0821417_178_474 97
515 3300037418 Ga0395900_0054715 Ga0395900_0054715_3301_3597 97
516 3300037418 Ga0395900_0806103 Ga0395900_0806103_529_831 97
517 3300037418 Ga0395900_1183143 Ga0395900_1183143_22_318 97
518 3300037418 Ga0395900_1192074 Ga0395900_1192074_179_475 97
519 3300037418 Ga0395900_1544628 Ga0395900_1544628_186_482 97
520 3300037466 Ga0395898_0017781 Ga0395898_0017781_2054_2350 97
521 3300037466 Ga0395898_0368695 Ga0395898_0368695_933_1229 97
522 3300037466 Ga0395898_0840806 Ga0395898_0840806_207_503 97
523 3300037466 Ga0395898_1136471 Ga0395898_1136471_89_385 97
524 3300037466 Ga0395898_1654159 Ga0395898_1654159_184_480 97
525 3300037471 Ga0395905_0013334 Ga0395905_0013334_2550_2846 97
526 3300037471 Ga0395905_0334539 Ga0395905_0334539_971_1267 97
527 3300037471 Ga0395905_1076920 Ga0395905_1076920_267_563 97
528 3300038443 Ga0395901_0012327 Ga0395901_0012327_2114_2410 97
529 3300038443 Ga0395901_0045141 Ga0395901_0045141_1506_1802 97
530 3300038443 Ga0395901_0685768 Ga0395901_0685768_141_437 97
531 3300038443 Ga0395901_0703553 Ga0395901_0703553_549_845 97
532 3300038443 Ga0395901_1663469 Ga0395901_1663469_47_343 97
533 3300038443 Ga0395901_1835826 Ga0395901_1835826_229_525 97
534 3300038443 Ga0395901_2128435 Ga0395901_2128435_96_392 97
535 3300039438 Ga0436360_0813424 Ga0436360_0813424_475_771 97
536 3300039450 Ga0436363_0233675 Ga0436363_0233675_73_372 97
537 3300041459 Ga0451800_1531549 Ga0451800_1531549_241_549 97
538 3300041486 Ga0451807_2459553 Ga0451807_2459553_382_675 97
539 3300041486 Ga0451807_2753639 Ga0451807_2753639_550_843 97
540 3300041496 Ga0451839_0104030 Ga0451839_0104030_152_451 97
541 3300041509 Ga0451843_0971763 Ga0451843_0971763_147_440 97
542 3300041512 Ga0451853_0363567 Ga0451853_0363567_83_376 97
543 3300044658 Ga0466972_0611188 Ga0466972_0611188_188_481 97
544 3300044683 Ga0466965_0041809 Ga0466965_0041809_362_661 97
545 3300044683 Ga0466965_0474984 Ga0466965_0474984_265_561 97
546 3300044694 Ga0466963_0000325 Ga0466963_0000325_11238_11531 97
547 3300044694 Ga0466963_0091504 Ga0466963_0091504_899_1198 97
548 3300044694 Ga0466963_0148465 Ga0466963_0148465_1009_1308 97
549 3300044694 Ga0466963_0189816 Ga0466963_0189816_1108_1401 97
550 3300044694 Ga0466963_0243841 Ga0466963_0243841_218_517 97
551 3300044694 Ga0466963_0802790 Ga0466963_0802790_37_330 97
552 3300044694 Ga0466963_1243059 Ga0466963_1243059_20_313 97
553 3300044706 Ga0466964_0699786 Ga0466964_0699786_150_446 97
554 3300044735 Ga0466968_0092224 Ga0466968_0092224_472_768 97
555 3300044842 Ga0466957_0001797 Ga0466957_0001797_4223_4516 97
556 3300044842 Ga0466957_0047130 Ga0466957_0047130_1574_1867 97
557 3300044842 Ga0466957_0249760 Ga0466957_0249760_25_324 97
558 3300044842 Ga0466957_0312582 Ga0466957_0312582_34_327 97
559 3300044901 Ga0466960_0326107 Ga0466960_0326107_272_568 97
560 3300045049 Ga0466959_0157928 Ga0466959_0157928_1074_1370 97
561 3300045049 Ga0466959_0651993 Ga0466959_0651993_38_334 97
562 3300045976 Ga0466967_0000003 Ga0466967_0000003_45849_46142 97
563 3300045976 Ga0466967_0078881 Ga0466967_0078881_1238_1531 97
564 3300045976 Ga0466967_0174648 Ga0466967_0174648_671_970 97
565 3300045976 Ga0466967_0180576 Ga0466967_0180576_657_956 97
566 3300045976 Ga0466967_0246362 Ga0466967_0246362_658_957 97
567 3300045976 Ga0466967_0305451 Ga0466967_0305451_374_673 97
568 3300045976 Ga0466967_0713344 Ga0466967_0713344_221_514 97
569 3300045976 Ga0466967_1164310 Ga0466967_1164310_366_662 97
570 3300045976 Ga0466967_1828363 Ga0466967_1828363_18_317 97
571 3300045976 Ga0466967_1901317 Ga0466967_1901317_65_358 97
572 3300045976 Ga0466967_2041674 Ga0466967_2041674_250_549 97
573 3300046454 Ga0495592_0379127 Ga0495592_0379127_292_585 97
574 3300046455 Ga0495603_0354205 Ga0495603_0354205_414_710 97
575 3300046459 Ga0495629_0000543 Ga0495629_0000543_6927_7220 97
576 3300046459 Ga0495629_0004371 Ga0495629_0004371_1981_2274 97
577 3300046459 Ga0495629_0012223 Ga0495629_0012223_1106_1399 97
578 3300046460 Ga0495638_0020983 Ga0495638_0020983_1723_2016 97
579 3300046461 Ga0495641_0224857 Ga0495641_0224857_477_770 97
580 3300046462 Ga0495651_0498329 Ga0495651_0498329_28_321 97
581 3300046499 Ga0495594_0000001 Ga0495594_0000001_26551_26844 97
582 3300046507 Ga0495606_0000283 Ga0495606_0000283_65218_65511 97
583 3300046512 Ga0495610_0195216 Ga0495610_0195216_56_349 97
584 3300046515 Ga0495620_0132685 Ga0495620_0132685_254_550 97
585 3300046516 Ga0495628_0551123 Ga0495628_0551123_102_395 97
586 3300046517 Ga0495630_0000148 Ga0495630_0000148_51792_52085 97
587 3300046517 Ga0495630_0058503 Ga0495630_0058503_2360_2653 97
588 3300046519 Ga0495632_0365621 Ga0495632_0365621_94_387 97
589 3300046520 Ga0495637_0269230 Ga0495637_0269230_164_457 97
590 3300046525 Ga0495663_0049848 Ga0495663_0049848_89_385 97
591 3300046536 Ga0495587_0004030 Ga0495587_0004030_2325_2618 97
592 3300046557 Ga0495622_0000069 Ga0495622_0000069_30987_31280 97
593 3300046559 Ga0495667_0000067 Ga0495667_0000067_52402_52695 97
594 3300046616 Ga0495668_0495013 Ga0495668_0495013_127_420 97
595 3300046663 Ga0495635_0988306 Ga0495635_0988306_178_474 97
596 3300046665 Ga0495661_0182597 Ga0495661_0182597_567_863 97
597 3300046674 Ga0495588_0000175 Ga0495588_0000175_34826_35119 97
598 3300046681 Ga0495647_0000114 Ga0495647_0000114_17937_18230 97
599 3300046683 Ga0495658_0001193 Ga0495658_0001193_1014_1307 97
600 3300046684 Ga0495669_0145768 Ga0495669_0145768_786_1079 97
601 3300046689 Ga0495613_0000087 Ga0495613_0000087_72693_72986 97
602 3300046689 Ga0495613_0438326 Ga0495613_0438326_378_671 97
603 3300046690 Ga0495624_0000429 Ga0495624_0000429_24051_24344 97
604 3300046690 Ga0495624_0903785 Ga0495624_0903785_192_485 97
605 3300046809 Ga0495600_0199436 Ga0495600_0199436_914_1207 97
606 3300046810 Ga0495660_0280070 Ga0495660_0280070_383_676 97
607 3300047317 Ga0495604_0000294 Ga0495604_0000294_21321_21614 97
608 3300047317 Ga0495604_0000322 Ga0495604_0000322_27430_27723 97
609 3300047321 Ga0495676_0012216 Ga0495676_0012216_7023_7316 97
610 3300047321 Ga0495676_0256531 Ga0495676_0256531_537_833 97
611 3300047322 Ga0495680_0009089 Ga0495680_0009089_1615_1908 97
612 3300047322 Ga0495680_0009545 Ga0495680_0009545_7422_7715 97
613 3300047446 Ga0495679_159480 Ga0495679_159480_24_317 97
614 3300047472 Ga0495686_0195056 Ga0495686_0195056_47_340 97
615 3300048088 Ga0495602_0098658 Ga0495602_0098658_1180_1473 97
616 3300048089 Ga0495614_0361580 Ga0495614_0361580_74_367 97
617 3300048905 Ga0496102_0676422 Ga0496102_0676422_348_644 97
618 3300048906 Ga0496103_0161620 Ga0496103_0161620_773_1069 97
619 3300048907 Ga0496104_0000029 Ga0496104_0000029_193588_193881 97
620 3300048908 Ga0496105_0000002 Ga0496105_0000002_193588_193881 97
621 3300048908 Ga0496105_0582714 Ga0496105_0582714_324_620 97
622 3300048909 Ga0496106_0053622 Ga0496106_0053622_58_354 97
623 3300048909 Ga0496106_0083694 Ga0496106_0083694_1122_1418 97
624 3300048909 Ga0496106_0427825 Ga0496106_0427825_441_737 97
625 3300048910 Ga0496107_0102247 Ga0496107_0102247_871_1167 97
626 3300048911 Ga0496108_0000042 Ga0496108_0000042_126021_126314 97
627 3300048911 Ga0496108_0146414 Ga0496108_0146414_293_586 97
628 3300048911 Ga0496108_0146776 Ga0496108_0146776_1117_1413 97
629 3300048911 Ga0496108_0688821 Ga0496108_0688821_408_701 97
630 3300048912 Ga0496109_0000034 Ga0496109_0000034_158660_158953 97
631 3300048912 Ga0496109_0000062 Ga0496109_0000062_20167_20460 97
632 3300048912 Ga0496109_0047839 Ga0496109_0047839_2374_2670 97
633 3300048913 Ga0496110_0000325 Ga0496110_0000325_26286_26579 97
634 3300048914 Ga0496111_0000171 Ga0496111_0000171_3028_3321 97
635 3300048914 Ga0496111_0019086 Ga0496111_0019086_267_563 97
636 3300048915 Ga0496112_0007934 Ga0496112_0007934_1463_1756 97
637 3300048915 Ga0496112_0116679 Ga0496112_0116679_985_1284 97
638 3300048915 Ga0496112_0506865 Ga0496112_0506865_760_1056 97
639 3300048915 Ga0496112_0927707 Ga0496112_0927707_54_347 97
640 3300048916 Ga0496113_0000002 Ga0496113_0000002_12735_13028 97
641 3300048916 Ga0496113_0152946 Ga0496113_0152946_333_626 97
642 3300048917 Ga0496114_1763687 Ga0496114_1763687_191_484 97
643 3300048918 Ga0496115_0000005 Ga0496115_0000005_135012_135305 97
644 3300048922 Ga0496119_0008336 Ga0496119_0008336_2650_2943 97
645 3300048923 Ga0496120_0024517 Ga0496120_0024517_1126_1419 97
646 3300048927 Ga0496124_0339239 Ga0496124_0339239_287_580 97
647 3300048929 Ga0496126_0061679 Ga0496126_0061679_1285_1578 97
648 3300049571 Ga0501034_0081325 Ga0501034_0081325_1148_1441 97
649 3300049576 Ga0501040_0254900 Ga0501040_0254900_261_557 97
650 3300049577 Ga0501041_0683370 Ga0501041_0683370_29_325 97
651 3300049578 Ga0501042_0168994 Ga0501042_0168994_1219_1512 97
652 3300049578 Ga0501042_0868902 Ga0501042_0868902_32_325 97
653 3300049583 Ga0501067_0072151 Ga0501067_0072151_44_340 97
654 3300049584 Ga0501068_0510074 Ga0501068_0510074_136_432 97
655 3300049585 Ga0501069_0037955 Ga0501069_0037955_1350_1643 97
656 3300049585 Ga0501069_0675716 Ga0501069_0675716_294_590 97
657 3300049586 Ga0501070_0045138 Ga0501070_0045138_576_869 97
658 3300049586 Ga0501070_0119369 Ga0501070_0119369_695_988 97
659 3300049587 Ga0501071_0116010 Ga0501071_0116010_837_1130 97
660 3300049587 Ga0501071_1423026 Ga0501071_1423026_21_317 97
661 3300049588 Ga0501072_0103023 Ga0501072_0103023_419_712 97
662 3300049588 Ga0501072_0990683 Ga0501072_0990683_164_460 97
663 3300049589 Ga0501073_0065086 Ga0501073_0065086_66_359 97
664 3300049590 Ga0501074_0080523 Ga0501074_0080523_1614_1907 97
665 3300049591 Ga0501075_1163576 Ga0501075_1163576_115_411 97
666 3300049592 Ga0501076_0052178 Ga0501076_0052178_1713_2006 97
667 3300049592 Ga0501076_0540301 Ga0501076_0540301_137_433 97
668 3300049742 Ga0501080_0010572 Ga0501080_0010572_1678_1971 97
669 3300049743 Ga0501081_0549433 Ga0501081_0549433_238_534 97
670 3300049744 Ga0501083_0059117 Ga0501083_0059117_1518_1811 97
671 3300049824 Ga0501045_0648123 Ga0501045_0648123_40_336 97
672 3300050490 nmdc:mga03n38_46532_c1 nmdc:mga03n38_46532_c1_1179_1472 97
673 3300050490 nmdc:mga03n38_74187_c1 nmdc:mga03n38_74187_c1_711_1004 97
674 3300050491 nmdc:mga00v17_277105_c1 nmdc:mga00v17_277105_c1_90_383 97
675 3300050491 nmdc:mga00v17_293610_c1 nmdc:mga00v17_293610_c1_370_663 97
676 3300050491 nmdc:mga00v17_794267_c1 nmdc:mga00v17_794267_c1_117_410 97
677 3300050492 nmdc:mga0yw44_1227_c1 nmdc:mga0yw44_1227_c1_6537_6833 97
678 3300050494 nmdc:mga06z11_426041_c1 nmdc:mga06z11_426041_c1_472_768 97
679 3300050494 nmdc:mga06z11_470878_c1 nmdc:mga06z11_470878_c1_57_350 97
680 3300050495 nmdc:mga04h51_66654_c1 nmdc:mga04h51_66654_c1_793_1086 97
681 3300050507 nmdc:mga05p37_1389666_c1 nmdc:mga05p37_1389666_c1_216_512 97
682 3300050507 nmdc:mga05p37_242619_c1 nmdc:mga05p37_242619_c1_236_532 97
683 3300050507 nmdc:mga05p37_343611_c1 nmdc:mga05p37_343611_c1_738_1034 97
684 3300050507 nmdc:mga05p37_526288_c1 nmdc:mga05p37_526288_c1_198_494 97
685 3300050507 nmdc:mga05p37_780875_c1 nmdc:mga05p37_780875_c1_104_400 97
686 3300050510 nmdc:mga06r32_133354_c1 nmdc:mga06r32_133354_c1_1476_1772 97
687 3300050511 nmdc:mga08y16_279757_c1 nmdc:mga08y16_279757_c1_798_1094 97
688 3300050511 nmdc:mga08y16_69250_c1 nmdc:mga08y16_69250_c1_1059_1355 97
689 3300050512 nmdc:mga0n895_221072_c1 nmdc:mga0n895_221072_c1_555_851 97
690 3300050512 nmdc:mga0n895_304789_c1 nmdc:mga0n895_304789_c1_977_1273 97
691 3300050513 nmdc:mga0rr50_352212_c1 nmdc:mga0rr50_352212_c1_765_1061 97
692 3300050513 nmdc:mga0rr50_607137_c1 nmdc:mga0rr50_607137_c1_144_440 97
693 3300050515 nmdc:mga0a205_391337_c1 nmdc:mga0a205_391337_c1_901_1197 97
694 3300050515 nmdc:mga0a205_483808_c1 nmdc:mga0a205_483808_c1_360_656 97
695 3300050515 nmdc:mga0a205_76480_c1 nmdc:mga0a205_76480_c1_83_379 97
696 3300050515 nmdc:mga0a205_787049_c1 nmdc:mga0a205_787049_c1_19_315 97
697 3300053077 Ga0495601_0000065 Ga0495601_0000065_7835_8128 97
698 3300053077 Ga0495601_0615364 Ga0495601_0615364_260_553 97
699 3300053078 Ga0495612_0004181 Ga0495612_0004181_1434_1727 97
700 3300053078 Ga0495612_0127430 Ga0495612_0127430_74_367 97
701 3300053083 Ga0495655_0001612 Ga0495655_0001612_2849_3142 97
702 3300053094 Ga0500566_0001523 Ga0500566_0001523_9690_9983 97
703 3300053096 Ga0500641_0001013 Ga0500641_0001013_7233_7526 97
704 3300059491 Ga0587070_237860 Ga0587070_237860_82_381 97
705 3300059504 Ga0587082_172648 Ga0587082_172648_160_459 97
706 3300059505 Ga0587083_0170895 Ga0587083_0170895_106_405 97
707 3300059508 Ga0587088_157147 Ga0587088_157147_90_389 97
708 3300059630 Ga0587128_131078 Ga0587128_131078_106_402 97
709 3300059639 Ga0587062_142422 Ga0587062_142422_112_411 97
710 3300059644 Ga0587075_131115 Ga0587075_131115_117_416 97
711 3300059652 Ga0587107_110780 Ga0587107_110780_63_362 97
712 3300061734 Ga0530510_0442489 Ga0530510_0442489_295_591 97

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

7

93

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9439 3 83
7nhm-assembly1.cif.gz_W 70s ribosome from staphylococcus aureus 0.9397 2 87
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9383 2 88
4v5d-assembly1.cif.gz_BX structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. 0.9368 3 93
6ppf-assembly1.cif.gz_T bacterial 45srbga ribosomal particle class b 0.9356 2 87
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9321 2 87 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8944 3 88 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8929 2 87 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8891 3 88 3.30.70.330
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8891 3 93 3.30.70.330
ID Description Score Start End GO Terms
AF-Q4A8H3-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9828 1 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q2NIV6-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9818 3 89 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q4AAE2-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9814 1 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-C4K2H7-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.98 3 88 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A537WDZ1-F1-model_v4 Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL4; Large ribosomal subunit protein uL23] 0.9796 3 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
89.79 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map