F476830
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 712 | 416 | 688 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10498037|Ga0111539_104980372 |
| Length | 291 |
| Sequence | VYDHPEKRPPVFGEDHAQKLEMTFSLGPKAISAGYGLAAFDRTGSTNAEAMSRARDGERGPMWFVTTEQTAGRGRRQRAWIAPRGNLASSVLEVTDVSPGVAATLGFAAGLSLERAVQKLSIEANLRRAGAAPLKYALKWPNDVMAERQKLTGILLEAESVAGNRLAVVVGIGTNVVAAPEGTPTPATSLAALGVDAGAEELFAALSDAWVEFRGIWDDGRGFSEIRRLWLERAFGLGEAVAIQTGTETVKGVFDTIDETGCLIVRTAEGKRIPIAAGEVYFGAAASVGAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 5 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 6 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 7 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 8 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 9 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 10 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 11 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 12 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 13 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 14 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 15 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 16 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 17 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 18 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 19 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 20 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 21 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 22 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 27 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 92 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 93 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 120 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 121 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 122 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 123 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 124 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 180 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 324 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 325 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 326 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 327 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 328 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 329 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 330 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 331 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 332 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 333 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 334 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 335 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 376 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 379 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 380 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 381 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 382 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 383 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 384 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 385 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 386 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 387 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 389 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 390 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 391 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 393 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 394 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 396 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 397 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 398 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 399 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 402 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 403 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 404 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 405 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 406 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 408 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 409 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 415 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 416 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.63 |
| Metatranscriptomes | 0 |
| Isolates | 3.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.39 |
| Nodule | 3.37 |
| Rhizoplane | 6.74 |
| Rhizosphere | 72.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10026422 | 3300002077 | Bacteria | 1127 |
| 2 | JGI25406J46586_10006594 | 3300003203 | Bacteria | 5335 |
| 3 | JGI25165J46597_1010528 | 3300003214 | Bacteria | 1345 |
| 4 | JGI25153J46596_10000870 | 3300003215 | Bacteria | 18404 |
| 5 | JGI25153J46596_10001131 | 3300003215 | Bacteria | 16133 |
| 6 | JGI25153J46596_10003138 | 3300003215 | Bacteria | 9318 |
| 7 | JGI25404J52841_10001014 | 3300003659 | Bacteria | 4634 |
| 8 | Ga0055542_1020317 | 3300003762 | Bacteria | 976 |
| 9 | Ga0070658_10422555 | 3300005327 | Bacteria | 1146 |
| 10 | Ga0070683_100232580 | 3300005329 | Bacteria | 1752 |
| 11 | Ga0070670_100338230 | 3300005331 | Bacteria | 1321 |
| 12 | Ga0070677_10078631 | 3300005333 | Bacteria | 1406 |
| 13 | Ga0068868_100245516 | 3300005338 | Bacteria | 1505 |
| 14 | Ga0068868_100303033 | 3300005338 | Bacteria | 1357 |
| 15 | Ga0070689_100142918 | 3300005340 | Bacteria | 1925 |
| 16 | Ga0070661_100090598 | 3300005344 | Bacteria | 2265 |
| 17 | Ga0070661_100464194 | 3300005344 | Bacteria | 1009 |
| 18 | Ga0070668_100120301 | 3300005347 | Bacteria | 2098 |
| 19 | Ga0070669_100338473 | 3300005353 | Bacteria | 1219 |
| 20 | Ga0070675_100561624 | 3300005354 | Bacteria | 1033 |
| 21 | Ga0070671_100012940 | 3300005355 | Bacteria | 6723 |
| 22 | Ga0070674_100091070 | 3300005356 | Bacteria | 2201 |
| 23 | Ga0070674_100219985 | 3300005356 | Bacteria | 1477 |
| 24 | Ga0070674_100412518 | 3300005356 | Bacteria | 1106 |
| 25 | Ga0070673_100472480 | 3300005364 | Bacteria | 1131 |
| 26 | Ga0070667_100633627 | 3300005367 | Bacteria | 986 |
| 27 | Ga0070714_100147670 | 3300005435 | Bacteria | 2116 |
| 28 | Ga0070714_100244577 | 3300005435 | Bacteria | 1657 |
| 29 | Ga0070714_100331599 | 3300005435 | Bacteria | 1425 |
| 30 | Ga0070713_100031831 | 3300005436 | Bacteria | 4206 |
| 31 | Ga0070713_100289943 | 3300005436 | Bacteria | 1504 |
| 32 | Ga0070710_10179813 | 3300005437 | Bacteria | 1323 |
| 33 | Ga0070711_100021744 | 3300005439 | Bacteria | 4151 |
| 34 | Ga0070700_100264702 | 3300005441 | Bacteria | 1239 |
| 35 | Ga0070708_100092489 | 3300005445 | Bacteria | 2755 |
| 36 | Ga0070663_100009662 | 3300005455 | Bacteria | 5983 |
| 37 | Ga0070663_100351404 | 3300005455 | Bacteria | 1194 |
| 38 | Ga0070678_100031872 | 3300005456 | Bacteria | 3641 |
| 39 | Ga0070678_100032274 | 3300005456 | Bacteria | 3623 |
| 40 | Ga0070678_100212265 | 3300005456 | Bacteria | 1604 |
| 41 | Ga0070662_100060341 | 3300005457 | Bacteria | 2765 |
| 42 | Ga0070681_10013524 | 3300005458 | Bacteria | 8115 |
| 43 | Ga0070681_10042949 | 3300005458 | Bacteria | 4530 |
| 44 | Ga0070681_10045367 | 3300005458 | Bacteria | 4398 |
| 45 | Ga0068867_100043171 | 3300005459 | Bacteria | 3300 |
| 46 | Ga0070679_100022970 | 3300005530 | Bacteria | 6101 |
| 47 | Ga0070679_100119475 | 3300005530 | Bacteria | 2620 |
| 48 | Ga0070679_100204853 | 3300005530 | Bacteria | 1937 |
| 49 | Ga0070679_100253626 | 3300005530 | Bacteria | 1715 |
| 50 | Ga0070684_100062894 | 3300005535 | Bacteria | 3252 |
| 51 | Ga0070684_100356662 | 3300005535 | Bacteria | 1345 |
| 52 | Ga0070697_100085658 | 3300005536 | Bacteria | 2600 |
| 53 | Ga0068853_100059725 | 3300005539 | Bacteria | 3294 |
| 54 | Ga0068853_100375994 | 3300005539 | Bacteria | 1326 |
| 55 | Ga0070672_100339222 | 3300005543 | Bacteria | 1280 |
| 56 | Ga0070693_100102779 | 3300005547 | Bacteria | 1744 |
| 57 | Ga0070665_100289150 | 3300005548 | Bacteria | 1641 |
| 58 | Ga0070665_100468949 | 3300005548 | Bacteria | 1269 |
| 59 | Ga0068857_100016728 | 3300005577 | Bacteria | 6425 |
| 60 | Ga0068857_100341675 | 3300005577 | Bacteria | 1385 |
| 61 | Ga0068854_100111165 | 3300005578 | Bacteria | 2067 |
| 62 | Ga0068856_100000206 | 3300005614 | Bacteria | 63167 |
| 63 | Ga0068856_100218071 | 3300005614 | Bacteria | 1923 |
| 64 | Ga0068852_100007921 | 3300005616 | Bacteria | 7783 |
| 65 | Ga0068852_100300907 | 3300005616 | Bacteria | 1552 |
| 66 | Ga0068864_100282528 | 3300005618 | Bacteria | 1550 |
| 67 | Ga0068864_100769137 | 3300005618 | Bacteria | 945 |
| 68 | Ga0068866_10105496 | 3300005718 | Bacteria | 1562 |
| 69 | Ga0068861_100433763 | 3300005719 | Bacteria | 1173 |
| 70 | Ga0068861_100734095 | 3300005719 | Bacteria | 921 |
| 71 | Ga0068870_10040915 | 3300005840 | Bacteria | 2406 |
| 72 | Ga0068863_100503013 | 3300005841 | Bacteria | 1193 |
| 73 | Ga0068858_100456698 | 3300005842 | Bacteria | 1231 |
| 74 | Ga0068858_100628728 | 3300005842 | Bacteria | 1042 |
| 75 | Ga0068860_100659509 | 3300005843 | Bacteria | 1054 |
| 76 | Ga0068860_100847537 | 3300005843 | Bacteria | 929 |
| 77 | Ga0068862_100355350 | 3300005844 | Bacteria | 1360 |
| 78 | Ga0081455_10005298 | 3300005937 | Bacteria | 14164 |
| 79 | Ga0081455_10009281 | 3300005937 | Bacteria | 10131 |
| 80 | Ga0081455_10102194 | 3300005937 | Bacteria | 2299 |
| 81 | Ga0081455_10231458 | 3300005937 | Bacteria | 1364 |
| 82 | Ga0081455_10330185 | 3300005937 | Bacteria | 1083 |
| 83 | Ga0081540_1000108 | 3300005983 | Bacteria | 88825 |
| 84 | Ga0081540_1004850 | 3300005983 | Bacteria | 10136 |
| 85 | Ga0081540_1004926 | 3300005983 | Bacteria | 10050 |
| 86 | Ga0081540_1005440 | 3300005983 | Bacteria | 9503 |
| 87 | Ga0081540_1019388 | 3300005983 | Bacteria | 4136 |
| 88 | Ga0081540_1020116 | 3300005983 | Bacteria | 4027 |
| 89 | Ga0081540_1036959 | 3300005983 | Bacteria | 2596 |
| 90 | Ga0081540_1038145 | 3300005983 | Bacteria | 2536 |
| 91 | Ga0081540_1112148 | 3300005983 | Bacteria | 1150 |
| 92 | Ga0081539_10000250 | 3300005985 | Bacteria | 125352 |
| 93 | Ga0081539_10000269 | 3300005985 | Bacteria | 119082 |
| 94 | Ga0070717_10021905 | 3300006028 | Bacteria | 5042 |
| 95 | Ga0070717_10088638 | 3300006028 | Bacteria | 2608 |
| 96 | Ga0075365_10185348 | 3300006038 | Bacteria | 1456 |
| 97 | Ga0075363_100063158 | 3300006048 | Bacteria | 1998 |
| 98 | Ga0075363_100080357 | 3300006048 | Bacteria | 1783 |
| 99 | Ga0075364_10045107 | 3300006051 | Bacteria | 2869 |
| 100 | Ga0070715_10030241 | 3300006163 | Bacteria | 2188 |
| 101 | Ga0070716_100006338 | 3300006173 | Bacteria | 5775 |
| 102 | Ga0070712_100064204 | 3300006175 | Bacteria | 2603 |
| 103 | Ga0070712_100082169 | 3300006175 | Bacteria | 2336 |
| 104 | Ga0070712_100134549 | 3300006175 | Bacteria | 1878 |
| 105 | Ga0075362_10030502 | 3300006177 | Bacteria | 2328 |
| 106 | Ga0075367_10041416 | 3300006178 | Bacteria | 2692 |
| 107 | Ga0075369_10075759 | 3300006186 | Bacteria | 1486 |
| 108 | Ga0075369_10209205 | 3300006186 | Bacteria | 901 |
| 109 | Ga0075366_10066636 | 3300006195 | Bacteria | 2142 |
| 110 | Ga0097621_100267301 | 3300006237 | Bacteria | 1502 |
| 111 | Ga0068871_100233285 | 3300006358 | Bacteria | 1598 |
| 112 | Ga0075434_100177961 | 3300006871 | Bacteria | 2147 |
| 113 | Ga0068865_100182900 | 3300006881 | Bacteria | 1615 |
| 114 | Ga0075436_100074743 | 3300006914 | Bacteria | 2346 |
| 115 | Ga0099825_1031832 | 3300006941 | Bacteria | 2196 |
| 116 | Ga0099824_1017629 | 3300006942 | Bacteria | 6121 |
| 117 | Ga0099822_1006195 | 3300006943 | Bacteria | 15605 |
| 118 | Ga0075435_100329214 | 3300007076 | Bacteria | 1308 |
| 119 | Ga0099794_10028147 | 3300007265 | Bacteria | 2612 |
| 120 | Ga0099794_10067426 | 3300007265 | Bacteria | 1748 |
| 121 | Ga0099794_10100747 | 3300007265 | Bacteria | 1442 |
| 122 | Ga0099795_10005059 | 3300007788 | Bacteria | 3471 |
| 123 | Ga0099795_10005742 | 3300007788 | Bacteria | 3329 |
| 124 | Ga0099795_10008603 | 3300007788 | Bacteria | 2919 |
| 125 | Ga0099795_10012866 | 3300007788 | Bacteria | 2551 |
| 126 | Ga0099795_10064591 | 3300007788 | Bacteria | 1367 |
| 127 | Ga0105240_10022725 | 3300009093 | Bacteria | 8308 |
| 128 | Ga0105240_10061772 | 3300009093 | Bacteria | 4668 |
| 129 | Ga0105240_10100146 | 3300009093 | Bacteria | 3526 |
| 130 | Ga0111539_10210993 | 3300009094 | Bacteria | 2263 |
| 131 | Ga0111539_10498037 | 3300009094 | Bacteria | 1419 |
| 132 | Ga0105245_10017389 | 3300009098 | Bacteria | 6272 |
| 133 | Ga0105245_10129672 | 3300009098 | Bacteria | 2364 |
| 134 | Ga0114129_10342189 | 3300009147 | Bacteria | 1983 |
| 135 | Ga0105248_10336667 | 3300009177 | Bacteria | 1699 |
| 136 | Ga0105248_10510680 | 3300009177 | Bacteria | 1355 |
| 137 | Ga0105248_10948326 | 3300009177 | Bacteria | 972 |
| 138 | Ga0105238_10196907 | 3300009551 | Bacteria | 1991 |
| 139 | Ga0105249_10224408 | 3300009553 | Bacteria | 1850 |
| 140 | Ga0099796_10007333 | 3300010159 | Bacteria | 2878 |
| 141 | Ga0099796_10072149 | 3300010159 | Bacteria | 1249 |
| 142 | Ga0099796_10096478 | 3300010159 | Bacteria | 1106 |
| 143 | Ga0105239_10128310 | 3300010375 | Bacteria | 2820 |
| 144 | Ga0105239_10165829 | 3300010375 | Bacteria | 2470 |
| 145 | Ga0105239_10182892 | 3300010375 | Bacteria | 2345 |
| 146 | Ga0157371_10010876 | 3300013102 | Bacteria | 7059 |
| 147 | Ga0157370_10060342 | 3300013104 | Bacteria | 3601 |
| 148 | Ga0157370_10066309 | 3300013104 | Bacteria | 3414 |
| 149 | Ga0157370_10125512 | 3300013104 | Bacteria | 2395 |
| 150 | Ga0157370_10168763 | 3300013104 | Bacteria | 2034 |
| 151 | Ga0157369_10117143 | 3300013105 | Bacteria | 2828 |
| 152 | Ga0157369_10390811 | 3300013105 | Bacteria | 1443 |
| 153 | Ga0157374_10088521 | 3300013296 | Bacteria | 2949 |
| 154 | Ga0157378_10095751 | 3300013297 | Bacteria | 2704 |
| 155 | Ga0163162_10028745 | 3300013306 | Bacteria | 5503 |
| 156 | Ga0163162_10096319 | 3300013306 | Bacteria | 3047 |
| 157 | Ga0163162_10399189 | 3300013306 | Bacteria | 1508 |
| 158 | Ga0157372_10045680 | 3300013307 | Bacteria | 4860 |
| 159 | Ga0157372_10693974 | 3300013307 | Bacteria | 1185 |
| 160 | Ga0157375_10023492 | 3300013308 | Bacteria | 5691 |
| 161 | Ga0157375_10047623 | 3300013308 | Bacteria | 4189 |
| 162 | Ga0157375_10433954 | 3300013308 | Bacteria | 1479 |
| 163 | Ga0163163_10099810 | 3300014325 | Bacteria | 2925 |
| 164 | Ga0157380_10346036 | 3300014326 | Bacteria | 1389 |
| 165 | Ga0157380_10475674 | 3300014326 | Bacteria | 1207 |
| 166 | Ga0157379_10246663 | 3300014968 | Bacteria | 1620 |
| 167 | Ga0157376_10058973 | 3300014969 | Bacteria | 3217 |
| 168 | Ga0157376_10218607 | 3300014969 | Bacteria | 1763 |
| 169 | Ga0163161_10149395 | 3300017792 | Bacteria | 1775 |
| 170 | Ga0213873_10009910 | 3300021358 | Bacteria | 1993 |
| 171 | Ga0213874_10008901 | 3300021377 | Bacteria | 2464 |
| 172 | Ga0213876_10041745 | 3300021384 | Bacteria | 2423 |
| 173 | Ga0213876_10214933 | 3300021384 | Bacteria | 1022 |
| 174 | Ga0213875_10037553 | 3300021388 | Bacteria | 2282 |
| 175 | Ga0213871_10002249 | 3300021441 | Bacteria | 3517 |
| 176 | Ga0209233_1000803 | 3300025261 | Bacteria | 14041 |
| 177 | Ga0209564_1010235 | 3300025295 | Bacteria | 4348 |
| 178 | Ga0209758_1016882 | 3300025297 | Bacteria | 3677 |
| 179 | Ga0207697_10015805 | 3300025315 | Bacteria | 3114 |
| 180 | Ga0207682_10099816 | 3300025893 | Bacteria | 1268 |
| 181 | Ga0207692_10100128 | 3300025898 | Bacteria | 1589 |
| 182 | Ga0207642_10103737 | 3300025899 | Bacteria | 1433 |
| 183 | Ga0207688_10111989 | 3300025901 | Bacteria | 1585 |
| 184 | Ga0207685_10018988 | 3300025905 | Bacteria | 2256 |
| 185 | Ga0207705_10167519 | 3300025909 | Bacteria | 1653 |
| 186 | Ga0207684_10237043 | 3300025910 | Bacteria | 1574 |
| 187 | Ga0207707_10000811 | 3300025912 | Bacteria | 30594 |
| 188 | Ga0207707_10066644 | 3300025912 | Bacteria | 3136 |
| 189 | Ga0207707_10076994 | 3300025912 | Bacteria | 2911 |
| 190 | Ga0207707_10116750 | 3300025912 | Bacteria | 2332 |
| 191 | Ga0207695_10100673 | 3300025913 | Bacteria | 2885 |
| 192 | Ga0207671_10044022 | 3300025914 | Bacteria | 3301 |
| 193 | Ga0207693_10028476 | 3300025915 | Bacteria | 4414 |
| 194 | Ga0207693_10055551 | 3300025915 | Bacteria | 3106 |
| 195 | Ga0207693_10061433 | 3300025915 | Bacteria | 2943 |
| 196 | Ga0207693_10148236 | 3300025915 | Bacteria | 1845 |
| 197 | Ga0207663_10008590 | 3300025916 | Bacteria | 5354 |
| 198 | Ga0207660_10075356 | 3300025917 | Bacteria | 2465 |
| 199 | Ga0207662_10102192 | 3300025918 | Bacteria | 1777 |
| 200 | Ga0207657_10003989 | 3300025919 | Bacteria | 15691 |
| 201 | Ga0207657_10012427 | 3300025919 | Bacteria | 8410 |
| 202 | Ga0207657_10508598 | 3300025919 | Bacteria | 943 |
| 203 | Ga0207649_10292622 | 3300025920 | Bacteria | 1188 |
| 204 | Ga0207652_10103108 | 3300025921 | Bacteria | 2522 |
| 205 | Ga0207652_10523306 | 3300025921 | Bacteria | 1067 |
| 206 | Ga0207652_10628779 | 3300025921 | Bacteria | 961 |
| 207 | Ga0207646_10142022 | 3300025922 | Bacteria | 2163 |
| 208 | Ga0207681_10308145 | 3300025923 | Bacteria | 1255 |
| 209 | Ga0207681_10534835 | 3300025923 | Bacteria | 963 |
| 210 | Ga0207650_10436161 | 3300025925 | Bacteria | 1089 |
| 211 | Ga0207687_10114503 | 3300025927 | Bacteria | 2007 |
| 212 | Ga0207687_10330309 | 3300025927 | Bacteria | 1237 |
| 213 | Ga0207700_10002197 | 3300025928 | Bacteria | 11192 |
| 214 | Ga0207700_10028701 | 3300025928 | Bacteria | 3917 |
| 215 | Ga0207700_10151577 | 3300025928 | Bacteria | 1916 |
| 216 | Ga0207664_10007415 | 3300025929 | Bacteria | 7605 |
| 217 | Ga0207664_10172649 | 3300025929 | Bacteria | 1851 |
| 218 | Ga0207664_10281776 | 3300025929 | Bacteria | 1458 |
| 219 | Ga0207644_10109535 | 3300025931 | Bacteria | 2087 |
| 220 | Ga0207706_10030685 | 3300025933 | Bacteria | 4794 |
| 221 | Ga0207686_10299276 | 3300025934 | Bacteria | 1194 |
| 222 | Ga0207709_10043830 | 3300025935 | Bacteria | 2699 |
| 223 | Ga0207670_10173486 | 3300025936 | Bacteria | 1619 |
| 224 | Ga0207669_10006938 | 3300025937 | Bacteria | 5209 |
| 225 | Ga0207669_10310271 | 3300025937 | Bacteria | 1203 |
| 226 | Ga0207665_10011239 | 3300025939 | Bacteria | 5874 |
| 227 | Ga0207691_10172416 | 3300025940 | Bacteria | 1894 |
| 228 | Ga0207661_10013087 | 3300025944 | Bacteria | 6053 |
| 229 | Ga0207661_10135410 | 3300025944 | Bacteria | 2115 |
| 230 | Ga0207667_10280255 | 3300025949 | Bacteria | 1703 |
| 231 | Ga0207667_10698306 | 3300025949 | Bacteria | 1017 |
| 232 | Ga0207712_10234066 | 3300025961 | Bacteria | 1476 |
| 233 | Ga0207712_10268414 | 3300025961 | Bacteria | 1387 |
| 234 | Ga0207668_10409341 | 3300025972 | Bacteria | 1148 |
| 235 | Ga0207640_10146126 | 3300025981 | Bacteria | 1730 |
| 236 | Ga0207640_10467577 | 3300025981 | Bacteria | 1043 |
| 237 | Ga0207677_10088711 | 3300026023 | Bacteria | 2243 |
| 238 | Ga0207703_10468044 | 3300026035 | Bacteria | 1180 |
| 239 | Ga0207639_10005362 | 3300026041 | Bacteria | 8666 |
| 240 | Ga0207639_10113932 | 3300026041 | Bacteria | 2209 |
| 241 | Ga0207678_10024074 | 3300026067 | Bacteria | 5319 |
| 242 | Ga0207678_10094989 | 3300026067 | Bacteria | 2548 |
| 243 | Ga0207678_10224820 | 3300026067 | Bacteria | 1607 |
| 244 | Ga0207678_10288294 | 3300026067 | Bacteria | 1410 |
| 245 | Ga0207678_10357659 | 3300026067 | Bacteria | 1260 |
| 246 | Ga0207708_10185664 | 3300026075 | Bacteria | 1652 |
| 247 | Ga0207702_10081904 | 3300026078 | Bacteria | 2804 |
| 248 | Ga0207702_10445493 | 3300026078 | Bacteria | 1256 |
| 249 | Ga0207641_10516639 | 3300026088 | Bacteria | 1161 |
| 250 | Ga0207648_10068146 | 3300026089 | Bacteria | 3101 |
| 251 | Ga0207676_10516668 | 3300026095 | Bacteria | 1136 |
| 252 | Ga0207674_10024558 | 3300026116 | Bacteria | 6437 |
| 253 | Ga0207674_10362878 | 3300026116 | Bacteria | 1400 |
| 254 | Ga0207675_100434744 | 3300026118 | Bacteria | 1298 |
| 255 | Ga0207683_10056620 | 3300026121 | Bacteria | 3440 |
| 256 | Ga0207683_10088242 | 3300026121 | Bacteria | 2759 |
| 257 | Ga0207683_10588206 | 3300026121 | Bacteria | 1030 |
| 258 | Ga0207698_10165038 | 3300026142 | Bacteria | 1942 |
| 259 | Ga0209589_1000003 | 3300027357 | Bacteria | 629130 |
| 260 | Ga0209489_100003 | 3300027361 | Bacteria | 663105 |
| 261 | Ga0209700_100003 | 3300027363 | Bacteria | 663105 |
| 262 | Ga0209179_1024520 | 3300027512 | Bacteria | 1197 |
| 263 | Ga0209588_1006465 | 3300027671 | Bacteria | 3407 |
| 264 | Ga0209588_1058203 | 3300027671 | Bacteria | 1249 |
| 265 | Ga0268266_10619504 | 3300028379 | Bacteria | 1040 |
| 266 | Ga0268265_10156122 | 3300028380 | Bacteria | 1931 |
| 267 | Ga0268264_10393342 | 3300028381 | Bacteria | 1330 |
| 268 | Ga0268264_10512454 | 3300028381 | Bacteria | 1171 |
| 269 | Ga0307515_10177717 | 3300028794 | Bacteria | 2092 |
| 270 | Ga0265330_10022410 | 3300031235 | Bacteria | 2874 |
| 271 | Ga0265330_10113757 | 3300031235 | Bacteria | 1154 |
| 272 | Ga0265332_10040785 | 3300031238 | Bacteria | 2009 |
| 273 | Ga0265328_10042046 | 3300031239 | Bacteria | 1682 |
| 274 | Ga0265325_10013456 | 3300031241 | Bacteria | 4658 |
| 275 | Ga0265340_10073517 | 3300031247 | Bacteria | 1618 |
| 276 | Ga0265339_10009439 | 3300031249 | Bacteria | 6135 |
| 277 | Ga0265331_10011789 | 3300031250 | Bacteria | 4771 |
| 278 | Ga0265316_10131311 | 3300031344 | Bacteria | 1886 |
| 279 | Ga0307509_10399823 | 3300031507 | Bacteria | 1081 |
| 280 | Ga0265313_10115104 | 3300031595 | Bacteria | 1178 |
| 281 | Ga0307508_10089802 | 3300031616 | Bacteria | 2658 |
| 282 | Ga0307508_10098845 | 3300031616 | Bacteria | 2512 |
| 283 | Ga0265314_10051396 | 3300031711 | Bacteria | 2871 |
| 284 | Ga0307516_10082526 | 3300031730 | Bacteria | 3056 |
| 285 | Ga0307405_10251776 | 3300031731 | Bacteria | 1315 |
| 286 | Ga0307412_10188000 | 3300031911 | Bacteria | 1559 |
| 287 | Ga0307416_100164696 | 3300032002 | Bacteria | 2055 |
| 288 | Ga0307411_10484575 | 3300032005 | Bacteria | 1042 |
| 289 | Ga0307510_10106595 | 3300033180 | Bacteria | 2565 |
| 290 | Ga0307510_10249672 | 3300033180 | Bacteria | 1263 |
| 291 | Ga0373934_0022806 | 3300035086 | Bacteria | 2416 |
| 292 | Ga0373934_0045411 | 3300035086 | Bacteria | 1737 |
| 293 | Ga0373934_0055361 | 3300035086 | Bacteria | 1576 |
| 294 | Ga0373944_0058880 | 3300035089 | Bacteria | 1228 |
| 295 | Ga0373923_0015122 | 3300035111 | Bacteria | 2909 |
| 296 | Ga0373932_0076302 | 3300035112 | Bacteria | 1050 |
| 297 | Ga0373936_0032242 | 3300035113 | Bacteria | 2071 |
| 298 | Ga0373945_0135229 | 3300035116 | Bacteria | 990 |
| 299 | Ga0373953_0000391 | 3300035117 | Bacteria | 11920 |
| 300 | Ga0373954_0000035 | 3300035118 | Bacteria | 51266 |
| 301 | Ga0373954_0049177 | 3300035118 | Bacteria | 1977 |
| 302 | Ga0373956_0000207 | 3300035119 | Bacteria | 22860 |
| 303 | Ga0373957_0000626 | 3300035120 | Bacteria | 9019 |
| 304 | Ga0373943_0011104 | 3300035170 | Bacteria | 4047 |
| 305 | Ga0373943_0085555 | 3300035170 | Bacteria | 1624 |
| 306 | Ga0373946_0014497 | 3300035171 | Bacteria | 2973 |
| 307 | Ga0373946_0106626 | 3300035171 | Bacteria | 1263 |
| 308 | Ga0373955_0001026 | 3300035172 | Bacteria | 11850 |
| 309 | Ga0373955_0003450 | 3300035172 | Bacteria | 6946 |
| 310 | Ga0373955_0132176 | 3300035172 | Bacteria | 1457 |
| 311 | Ga0373924_0005037 | 3300035410 | Bacteria | 4651 |
| 312 | Ga0373924_0020394 | 3300035410 | Bacteria | 2576 |
| 313 | Ga0373924_0021995 | 3300035410 | Bacteria | 2490 |
| 314 | Ga0373931_0053278 | 3300035691 | Bacteria | 2158 |
| 315 | Ga0373935_0000256 | 3300035692 | Bacteria | 26305 |
| 316 | Ga0373927_0006824 | 3300035695 | Bacteria | 7770 |
| 317 | Ga0373927_0009285 | 3300035695 | Bacteria | 6596 |
| 318 | Ga0373927_0010055 | 3300035695 | Bacteria | 6334 |
| 319 | Ga0373927_0222950 | 3300035695 | Bacteria | 1238 |
| 320 | Ga0373927_0277926 | 3300035695 | Bacteria | 1101 |
| 321 | Ga0373933_0000037 | 3300035724 | Bacteria | 81092 |
| 322 | Ga0373933_0000185 | 3300035724 | Bacteria | 41223 |
| 323 | Ga0373933_0080003 | 3300035724 | Bacteria | 2002 |
| 324 | Ga0373933_0350492 | 3300035724 | Bacteria | 959 |
| 325 | Ga0373947_0010599 | 3300035725 | Bacteria | 5288 |
| 326 | Ga0373937_0000118 | 3300036401 | Bacteria | 75902 |
| 327 | Ga0373937_0177342 | 3300036401 | Bacteria | 2000 |
| 328 | Ga0373925_0005982 | 3300037068 | Bacteria | 9008 |
| 329 | Ga0373925_0082388 | 3300037068 | Bacteria | 2448 |
| 330 | Ga0373925_0448880 | 3300037068 | Bacteria | 1056 |
| 331 | Ga0395899_0043949 | 3300037312 | Bacteria | 3329 |
| 332 | Ga0395900_0000502 | 3300037418 | Bacteria | 55040 |
| 333 | Ga0395900_0171077 | 3300037418 | Bacteria | 2212 |
| 334 | Ga0395900_0314832 | 3300037418 | Bacteria | 1547 |
| 335 | Ga0395898_0042989 | 3300037466 | Bacteria | 4454 |
| 336 | Ga0395898_0089251 | 3300037466 | Bacteria | 2967 |
| 337 | Ga0395898_0244168 | 3300037466 | Bacteria | 1713 |
| 338 | Ga0395905_0046632 | 3300037471 | Bacteria | 4064 |
| 339 | Ga0436364_0100822 | 3300037853 | Bacteria | 1314 |
| 340 | Ga0436364_0311161 | 3300037853 | Bacteria | 2400 |
| 341 | Ga0395901_0040290 | 3300038443 | Bacteria | 4838 |
| 342 | Ga0395901_0252272 | 3300038443 | Bacteria | 1838 |
| 343 | Ga0395901_0909836 | 3300038443 | Bacteria | 861 |
| 344 | Ga0436365_0599448 | 3300039437 | Bacteria | 39042 |
| 345 | Ga0436365_1775270 | 3300039437 | Bacteria | 1453 |
| 346 | Ga0436360_0261205 | 3300039438 | Bacteria | 4669 |
| 347 | Ga0436360_1120943 | 3300039438 | Bacteria | 2560 |
| 348 | Ga0436360_1154756 | 3300039438 | Bacteria | 837 |
| 349 | Ga0436361_0350934 | 3300039447 | Bacteria | 2412 |
| 350 | Ga0436361_1031086 | 3300039447 | Bacteria | 1924 |
| 351 | Ga0436363_0258064 | 3300039450 | Bacteria | 2121 |
| 352 | Ga0436362_0322148 | 3300039453 | Bacteria | 4896 |
| 353 | Ga0436362_0342889 | 3300039453 | Bacteria | 2876 |
| 354 | Ga0466969_0092891 | 3300044656 | Bacteria | 1428 |
| 355 | Ga0466966_0014844 | 3300044684 | Bacteria | 5153 |
| 356 | Ga0466961_0000206 | 3300044693 | Bacteria | 39651 |
| 357 | Ga0466961_0073655 | 3300044693 | Bacteria | 2166 |
| 358 | Ga0466963_0192721 | 3300044694 | Bacteria | 1424 |
| 359 | Ga0466968_0145126 | 3300044735 | Bacteria | 1088 |
| 360 | Ga0466957_0119825 | 3300044842 | Bacteria | 1677 |
| 361 | Ga0466957_0263015 | 3300044842 | Bacteria | 1150 |
| 362 | Ga0466959_0014677 | 3300045049 | Bacteria | 5701 |
| 363 | Ga0466959_0027271 | 3300045049 | Bacteria | 4237 |
| 364 | Ga0466967_0039460 | 3300045976 | Bacteria | 4060 |
| 365 | Ga0466967_0079022 | 3300045976 | Bacteria | 2965 |
| 366 | Ga0495592_0000649 | 3300046454 | Bacteria | 24123 |
| 367 | Ga0495592_0013217 | 3300046454 | Bacteria | 6284 |
| 368 | Ga0495592_0064660 | 3300046454 | Bacteria | 2680 |
| 369 | Ga0495603_0000027 | 3300046455 | Bacteria | 61238 |
| 370 | Ga0495603_0014796 | 3300046455 | Bacteria | 4719 |
| 371 | Ga0495629_0000290 | 3300046459 | Bacteria | 43459 |
| 372 | Ga0495629_0001487 | 3300046459 | Bacteria | 18475 |
| 373 | Ga0495638_0012401 | 3300046460 | Bacteria | 5844 |
| 374 | Ga0495651_0000412 | 3300046462 | Bacteria | 33198 |
| 375 | Ga0495651_0111187 | 3300046462 | Bacteria | 2025 |
| 376 | Ga0495651_0233890 | 3300046462 | Bacteria | 1264 |
| 377 | Ga0495653_0000161 | 3300046463 | Bacteria | 55322 |
| 378 | Ga0495653_0263568 | 3300046463 | Bacteria | 1138 |
| 379 | Ga0495580_0000610 | 3300046472 | Bacteria | 30234 |
| 380 | Ga0495582_0000157 | 3300046473 | Bacteria | 36665 |
| 381 | Ga0495582_0045439 | 3300046473 | Bacteria | 2419 |
| 382 | Ga0495639_0000048 | 3300046475 | Bacteria | 53257 |
| 383 | Ga0495662_0004308 | 3300046476 | Bacteria | 7153 |
| 384 | Ga0495664_0010720 | 3300046477 | Bacteria | 5150 |
| 385 | Ga0495664_0107515 | 3300046477 | Bacteria | 1683 |
| 386 | Ga0495594_0000279 | 3300046499 | Bacteria | 25038 |
| 387 | Ga0495607_0034108 | 3300046501 | Bacteria | 3090 |
| 388 | Ga0495606_0004193 | 3300046507 | Bacteria | 14598 |
| 389 | Ga0495606_0037490 | 3300046507 | Bacteria | 3292 |
| 390 | Ga0495608_0000337 | 3300046511 | Bacteria | 33005 |
| 391 | Ga0495610_0034359 | 3300046512 | Bacteria | 2612 |
| 392 | Ga0495616_0085914 | 3300046513 | Bacteria | 1497 |
| 393 | Ga0495618_0061283 | 3300046514 | Bacteria | 2386 |
| 394 | Ga0495618_0134634 | 3300046514 | Bacteria | 1581 |
| 395 | Ga0495618_0252499 | 3300046514 | Bacteria | 1106 |
| 396 | Ga0495620_0036179 | 3300046515 | Bacteria | 2211 |
| 397 | Ga0495628_0002406 | 3300046516 | Bacteria | 16872 |
| 398 | Ga0495628_0071303 | 3300046516 | Bacteria | 2708 |
| 399 | Ga0495630_0000846 | 3300046517 | Bacteria | 21588 |
| 400 | Ga0495631_0030117 | 3300046518 | Bacteria | 2464 |
| 401 | Ga0495632_0197300 | 3300046519 | Bacteria | 918 |
| 402 | Ga0495637_0024705 | 3300046520 | Bacteria | 2718 |
| 403 | Ga0495643_0057511 | 3300046522 | Bacteria | 2072 |
| 404 | Ga0495644_0132675 | 3300046523 | Bacteria | 949 |
| 405 | Ga0495648_0003360 | 3300046524 | Bacteria | 14095 |
| 406 | Ga0495663_0087627 | 3300046525 | Bacteria | 1011 |
| 407 | Ga0495652_0011371 | 3300046529 | Bacteria | 8051 |
| 408 | Ga0495652_0097007 | 3300046529 | Bacteria | 2399 |
| 409 | Ga0495665_0000165 | 3300046531 | Bacteria | 33325 |
| 410 | Ga0495640_0002246 | 3300046533 | Bacteria | 15480 |
| 411 | Ga0495640_0004586 | 3300046533 | Bacteria | 11020 |
| 412 | Ga0495587_0000668 | 3300046536 | Bacteria | 22979 |
| 413 | Ga0495621_0143659 | 3300046539 | Bacteria | 935 |
| 414 | Ga0495645_0004453 | 3300046543 | Bacteria | 9561 |
| 415 | Ga0495645_0042908 | 3300046543 | Bacteria | 3298 |
| 416 | Ga0495622_0002823 | 3300046557 | Bacteria | 8290 |
| 417 | Ga0495633_0123293 | 3300046558 | Bacteria | 1200 |
| 418 | Ga0495633_0129880 | 3300046558 | Bacteria | 1166 |
| 419 | Ga0495633_0160908 | 3300046558 | Bacteria | 1036 |
| 420 | Ga0495667_0000147 | 3300046559 | Bacteria | 47993 |
| 421 | Ga0495667_0022715 | 3300046559 | Bacteria | 4226 |
| 422 | Ga0495656_0028915 | 3300046615 | Bacteria | 2227 |
| 423 | Ga0495656_0039315 | 3300046615 | Bacteria | 1964 |
| 424 | Ga0495668_0067542 | 3300046616 | Bacteria | 1967 |
| 425 | Ga0495634_0001002 | 3300046642 | Bacteria | 26604 |
| 426 | Ga0495634_0002287 | 3300046642 | Bacteria | 16031 |
| 427 | Ga0495634_0022222 | 3300046642 | Bacteria | 4471 |
| 428 | Ga0495611_0083809 | 3300046648 | Bacteria | 1469 |
| 429 | Ga0495625_0293034 | 3300046660 | Bacteria | 1043 |
| 430 | Ga0495635_0000094 | 3300046663 | Bacteria | 52578 |
| 431 | Ga0495635_0004833 | 3300046663 | Bacteria | 9372 |
| 432 | Ga0495588_0043477 | 3300046674 | Bacteria | 2299 |
| 433 | Ga0495588_0077680 | 3300046674 | Bacteria | 1732 |
| 434 | Ga0495657_0001420 | 3300046675 | Bacteria | 20703 |
| 435 | Ga0495657_0038595 | 3300046675 | Bacteria | 3285 |
| 436 | Ga0495599_0000253 | 3300046678 | Bacteria | 33822 |
| 437 | Ga0495599_0039738 | 3300046678 | Bacteria | 2956 |
| 438 | Ga0495599_0074852 | 3300046678 | Bacteria | 2114 |
| 439 | Ga0495599_0080076 | 3300046678 | Bacteria | 2040 |
| 440 | Ga0495623_0000768 | 3300046679 | Bacteria | 21497 |
| 441 | Ga0495623_0234292 | 3300046679 | Bacteria | 1040 |
| 442 | Ga0495646_0025386 | 3300046680 | Bacteria | 3727 |
| 443 | Ga0495647_0001538 | 3300046681 | Bacteria | 7126 |
| 444 | Ga0495658_0006333 | 3300046683 | Bacteria | 5814 |
| 445 | Ga0495658_0060799 | 3300046683 | Bacteria | 2167 |
| 446 | Ga0495613_0007609 | 3300046689 | Bacteria | 8055 |
| 447 | Ga0495613_0040692 | 3300046689 | Bacteria | 3443 |
| 448 | Ga0495624_0000380 | 3300046690 | Bacteria | 35436 |
| 449 | Ga0495624_0169666 | 3300046690 | Bacteria | 1331 |
| 450 | Ga0495671_0131117 | 3300046692 | Bacteria | 1222 |
| 451 | Ga0495649_0177557 | 3300046694 | Bacteria | 1112 |
| 452 | Ga0495589_0073617 | 3300046794 | Bacteria | 1667 |
| 453 | Ga0495600_0001048 | 3300046809 | Bacteria | 14960 |
| 454 | Ga0495581_0000233 | 3300047315 | Bacteria | 26288 |
| 455 | Ga0495581_0189861 | 3300047315 | Bacteria | 1202 |
| 456 | Ga0495604_0000253 | 3300047317 | Bacteria | 47392 |
| 457 | Ga0495604_0058514 | 3300047317 | Bacteria | 2959 |
| 458 | Ga0495604_0299748 | 3300047317 | Bacteria | 1080 |
| 459 | Ga0495636_0088637 | 3300047318 | Bacteria | 1341 |
| 460 | Ga0495674_0007183 | 3300047319 | Bacteria | 10654 |
| 461 | Ga0495674_0015786 | 3300047319 | Bacteria | 7049 |
| 462 | Ga0495680_0000406 | 3300047322 | Bacteria | 48300 |
| 463 | Ga0495675_0000285 | 3300047444 | Bacteria | 36643 |
| 464 | Ga0495677_0062624 | 3300047445 | Bacteria | 1381 |
| 465 | Ga0495684_0000184 | 3300047471 | Bacteria | 47730 |
| 466 | Ga0495593_0000160 | 3300047673 | Bacteria | 34170 |
| 467 | Ga0495593_0030812 | 3300047673 | Bacteria | 2932 |
| 468 | Ga0495593_0149689 | 3300047673 | Bacteria | 1181 |
| 469 | Ga0495602_0001148 | 3300048088 | Bacteria | 25888 |
| 470 | Ga0495602_0102948 | 3300048088 | Bacteria | 2338 |
| 471 | Ga0496100_0061285 | 3300048903 | Bacteria | 2479 |
| 472 | Ga0496100_0108134 | 3300048903 | Bacteria | 1928 |
| 473 | Ga0496100_0142552 | 3300048903 | Bacteria | 1700 |
| 474 | Ga0496100_0179529 | 3300048903 | Bacteria | 1530 |
| 475 | Ga0496101_0037110 | 3300048904 | Bacteria | 3455 |
| 476 | Ga0496101_0096632 | 3300048904 | Bacteria | 2205 |
| 477 | Ga0496101_0164587 | 3300048904 | Bacteria | 1702 |
| 478 | Ga0496101_0378969 | 3300048904 | Bacteria | 1113 |
| 479 | Ga0496102_0018206 | 3300048905 | Bacteria | 6166 |
| 480 | Ga0496102_0042443 | 3300048905 | Bacteria | 4121 |
| 481 | Ga0496102_0379703 | 3300048905 | Bacteria | 1330 |
| 482 | Ga0496103_0091868 | 3300048906 | Bacteria | 1916 |
| 483 | Ga0496104_0165522 | 3300048907 | Bacteria | 2120 |
| 484 | Ga0496104_0221217 | 3300048907 | Bacteria | 1805 |
| 485 | Ga0496105_0160859 | 3300048908 | Bacteria | 1843 |
| 486 | Ga0496105_0238693 | 3300048908 | Bacteria | 1475 |
| 487 | Ga0496106_0004589 | 3300048909 | Bacteria | 10248 |
| 488 | Ga0496106_0064092 | 3300048909 | Bacteria | 2795 |
| 489 | Ga0496106_0140391 | 3300048909 | Bacteria | 1900 |
| 490 | Ga0496107_0004218 | 3300048910 | Bacteria | 9714 |
| 491 | Ga0496107_0063292 | 3300048910 | Bacteria | 2680 |
| 492 | Ga0496107_0379817 | 3300048910 | Bacteria | 1051 |
| 493 | Ga0496108_0000960 | 3300048911 | Bacteria | 22423 |
| 494 | Ga0496108_0194603 | 3300048911 | Bacteria | 1758 |
| 495 | Ga0496108_0394936 | 3300048911 | Bacteria | 1208 |
| 496 | Ga0496109_0000201 | 3300048912 | Bacteria | 59452 |
| 497 | Ga0496109_0027009 | 3300048912 | Bacteria | 5121 |
| 498 | Ga0496109_0366220 | 3300048912 | Bacteria | 1361 |
| 499 | Ga0496110_0021115 | 3300048913 | Bacteria | 5504 |
| 500 | Ga0496110_0096704 | 3300048913 | Bacteria | 2646 |
| 501 | Ga0496110_0426188 | 3300048913 | Bacteria | 1209 |
| 502 | Ga0496111_0029084 | 3300048914 | Bacteria | 3921 |
| 503 | Ga0496111_0104702 | 3300048914 | Bacteria | 2081 |
| 504 | Ga0496111_0108546 | 3300048914 | Bacteria | 2043 |
| 505 | Ga0496112_0001486 | 3300048915 | Bacteria | 18040 |
| 506 | Ga0496112_0003169 | 3300048915 | Bacteria | 13510 |
| 507 | Ga0496113_0049307 | 3300048916 | Bacteria | 3135 |
| 508 | Ga0496113_0115239 | 3300048916 | Bacteria | 2096 |
| 509 | Ga0496113_0206785 | 3300048916 | Bacteria | 1561 |
| 510 | Ga0496114_0189541 | 3300048917 | Bacteria | 1799 |
| 511 | Ga0496114_0312889 | 3300048917 | Bacteria | 1387 |
| 512 | Ga0496114_0365027 | 3300048917 | Bacteria | 1277 |
| 513 | Ga0496115_0006396 | 3300048918 | Bacteria | 8633 |
| 514 | Ga0496115_0126494 | 3300048918 | Bacteria | 2105 |
| 515 | Ga0496115_0227205 | 3300048918 | Bacteria | 1539 |
| 516 | Ga0496115_0371482 | 3300048918 | Bacteria | 1164 |
| 517 | Ga0496115_0418788 | 3300048918 | Bacteria | 1085 |
| 518 | Ga0496117_0034572 | 3300048920 | Bacteria | 3806 |
| 519 | Ga0496117_0080082 | 3300048920 | Bacteria | 2149 |
| 520 | Ga0496117_0181366 | 3300048920 | Bacteria | 1210 |
| 521 | Ga0496117_0232263 | 3300048920 | Bacteria | 1018 |
| 522 | Ga0496118_0020314 | 3300048921 | Bacteria | 5893 |
| 523 | Ga0496118_0186204 | 3300048921 | Bacteria | 1247 |
| 524 | Ga0496119_0068957 | 3300048922 | Bacteria | 2080 |
| 525 | Ga0496120_0016563 | 3300048923 | Bacteria | 4814 |
| 526 | Ga0496121_0001658 | 3300048924 | Bacteria | 36741 |
| 527 | Ga0496121_0006685 | 3300048924 | Bacteria | 14176 |
| 528 | Ga0496121_0009024 | 3300048924 | Bacteria | 11554 |
| 529 | Ga0496121_0078979 | 3300048924 | Bacteria | 2613 |
| 530 | Ga0496121_0088498 | 3300048924 | Bacteria | 2427 |
| 531 | Ga0496121_0271456 | 3300048924 | Bacteria | 1165 |
| 532 | Ga0496122_0033875 | 3300048925 | Bacteria | 4192 |
| 533 | Ga0496123_0018308 | 3300048926 | Bacteria | 5578 |
| 534 | Ga0496124_0080500 | 3300048927 | Bacteria | 2680 |
| 535 | Ga0496124_0143777 | 3300048927 | Bacteria | 1879 |
| 536 | Ga0496125_0001539 | 3300048928 | Bacteria | 32996 |
| 537 | Ga0496125_0003378 | 3300048928 | Bacteria | 19439 |
| 538 | Ga0496125_0006286 | 3300048928 | Bacteria | 12902 |
| 539 | Ga0496125_0223077 | 3300048928 | Bacteria | 1212 |
| 540 | Ga0496126_0003507 | 3300048929 | Bacteria | 19762 |
| 541 | Ga0496126_0017789 | 3300048929 | Bacteria | 7075 |
| 542 | Ga0496126_0036640 | 3300048929 | Bacteria | 4584 |
| 543 | Ga0496126_0045678 | 3300048929 | Bacteria | 4023 |
| 544 | Ga0496126_0074973 | 3300048929 | Bacteria | 3004 |
| 545 | Ga0496126_0097351 | 3300048929 | Bacteria | 2579 |
| 546 | Ga0496126_0106080 | 3300048929 | Bacteria | 2452 |
| 547 | Ga0496126_0309834 | 3300048929 | Bacteria | 1300 |
| 548 | Ga0496126_0384683 | 3300048929 | Bacteria | 1141 |
| 549 | Ga0501031_0000406 | 3300049568 | Bacteria | 24952 |
| 550 | Ga0501031_0064668 | 3300049568 | Bacteria | 2382 |
| 551 | Ga0501032_0000228 | 3300049569 | Bacteria | 46774 |
| 552 | Ga0501032_0044183 | 3300049569 | Bacteria | 3016 |
| 553 | Ga0501032_0319613 | 3300049569 | Bacteria | 1002 |
| 554 | Ga0501033_0000914 | 3300049570 | Bacteria | 26957 |
| 555 | Ga0501033_0002357 | 3300049570 | Bacteria | 16112 |
| 556 | Ga0501034_0000175 | 3300049571 | Bacteria | 119465 |
| 557 | Ga0501034_0333924 | 3300049571 | Bacteria | 1447 |
| 558 | Ga0501034_0643910 | 3300049571 | Bacteria | 962 |
| 559 | Ga0501036_0000158 | 3300049572 | Bacteria | 44516 |
| 560 | Ga0501036_0151018 | 3300049572 | Bacteria | 1959 |
| 561 | Ga0501036_0215438 | 3300049572 | Bacteria | 1613 |
| 562 | Ga0501037_0000126 | 3300049573 | Bacteria | 71116 |
| 563 | Ga0501037_0002783 | 3300049573 | Bacteria | 12666 |
| 564 | Ga0501037_0132038 | 3300049573 | Bacteria | 1790 |
| 565 | Ga0501038_0000034 | 3300049574 | Bacteria | 128854 |
| 566 | Ga0501039_0002654 | 3300049575 | Bacteria | 13354 |
| 567 | Ga0501039_0030639 | 3300049575 | Bacteria | 4148 |
| 568 | Ga0501041_0323146 | 3300049577 | Bacteria | 973 |
| 569 | Ga0501042_0058814 | 3300049578 | Bacteria | 2744 |
| 570 | Ga0501043_0001288 | 3300049579 | Bacteria | 22002 |
| 571 | Ga0501043_0004764 | 3300049579 | Bacteria | 11002 |
| 572 | Ga0501043_0356397 | 3300049579 | Bacteria | 1111 |
| 573 | Ga0501046_0000575 | 3300049580 | Bacteria | 36255 |
| 574 | Ga0501046_0015370 | 3300049580 | Bacteria | 6436 |
| 575 | Ga0501046_0046820 | 3300049580 | Bacteria | 3431 |
| 576 | Ga0501046_0095055 | 3300049580 | Bacteria | 2290 |
| 577 | Ga0501046_0176701 | 3300049580 | Bacteria | 1599 |
| 578 | Ga0501047_0001252 | 3300049581 | Bacteria | 25141 |
| 579 | Ga0501047_0024742 | 3300049581 | Bacteria | 5765 |
| 580 | Ga0501047_0056511 | 3300049581 | Bacteria | 3795 |
| 581 | Ga0501047_0298833 | 3300049581 | Bacteria | 1453 |
| 582 | Ga0501047_0402198 | 3300049581 | Bacteria | 1202 |
| 583 | Ga0501048_0001161 | 3300049582 | Bacteria | 19841 |
| 584 | Ga0501048_0072696 | 3300049582 | Bacteria | 2428 |
| 585 | Ga0501067_0000898 | 3300049583 | Bacteria | 16003 |
| 586 | Ga0501067_0048355 | 3300049583 | Bacteria | 2359 |
| 587 | Ga0501068_0007196 | 3300049584 | Bacteria | 6163 |
| 588 | Ga0501068_0353752 | 3300049584 | Bacteria | 944 |
| 589 | Ga0501069_0121819 | 3300049585 | Bacteria | 1490 |
| 590 | Ga0501070_0019443 | 3300049586 | Bacteria | 5696 |
| 591 | Ga0501070_0090969 | 3300049586 | Bacteria | 2525 |
| 592 | Ga0501070_0336450 | 3300049586 | Bacteria | 1226 |
| 593 | Ga0501071_0036754 | 3300049587 | Bacteria | 3494 |
| 594 | Ga0501071_0199173 | 3300049587 | Bacteria | 1504 |
| 595 | Ga0501072_0002976 | 3300049588 | Bacteria | 12770 |
| 596 | Ga0501073_0000035 | 3300049589 | Bacteria | 94077 |
| 597 | Ga0501073_0163089 | 3300049589 | Bacteria | 1544 |
| 598 | Ga0501073_0257855 | 3300049589 | Bacteria | 1203 |
| 599 | Ga0501074_0000266 | 3300049590 | Bacteria | 29764 |
| 600 | Ga0501077_0180839 | 3300049593 | Bacteria | 1340 |
| 601 | Ga0501079_0014874 | 3300049741 | Bacteria | 5931 |
| 602 | Ga0501079_0113725 | 3300049741 | Bacteria | 2104 |
| 603 | Ga0501080_0006722 | 3300049742 | Bacteria | 10357 |
| 604 | Ga0501080_0029763 | 3300049742 | Bacteria | 5082 |
| 605 | Ga0501080_0163136 | 3300049742 | Bacteria | 2057 |
| 606 | Ga0501081_0215953 | 3300049743 | Bacteria | 1394 |
| 607 | Ga0501083_0014090 | 3300049744 | Bacteria | 5590 |
| 608 | Ga0501035_0000319 | 3300049822 | Bacteria | 55737 |
| 609 | Ga0501035_0054147 | 3300049822 | Bacteria | 3585 |
| 610 | Ga0501035_0097807 | 3300049822 | Bacteria | 2577 |
| 611 | Ga0501044_0000061 | 3300049823 | Bacteria | 133207 |
| 612 | Ga0501044_0024642 | 3300049823 | Bacteria | 6384 |
| 613 | Ga0501044_0080479 | 3300049823 | Bacteria | 3300 |
| 614 | Ga0501044_0147045 | 3300049823 | Bacteria | 2341 |
| 615 | Ga0501044_0481955 | 3300049823 | Bacteria | 1143 |
| 616 | Ga0501045_0020936 | 3300049824 | Bacteria | 4675 |
| 617 | Ga0501045_0172501 | 3300049824 | Bacteria | 1611 |
| 618 | nmdc:mga03n38_55870_c1 | 3300050490 | Bacteria | 1780 |
| 619 | nmdc:mga0yw44_27809_c1 | 3300050492 | Bacteria | 3244 |
| 620 | nmdc:mga05p37_744880_c1 | 3300050507 | Bacteria | 1081 |
| 621 | nmdc:mga09592_175300_c1 | 3300050508 | Bacteria | 1854 |
| 622 | nmdc:mga08y16_341191_c1 | 3300050511 | Bacteria | 1540 |
| 623 | nmdc:mga0n895_177808_c1 | 3300050512 | Bacteria | 2159 |
| 624 | nmdc:mga0rr50_45933_c1 | 3300050513 | Bacteria | 3213 |
| 625 | nmdc:mga0sz30_12031_c1 | 3300050516 | Bacteria | 2737 |
| 626 | Ga0495601_0067861 | 3300053077 | Bacteria | 2272 |
| 627 | Ga0495601_0345674 | 3300053077 | Bacteria | 967 |
| 628 | Ga0500635_0005744 | 3300053080 | Bacteria | 3278 |
| 629 | Ga0500635_0011127 | 3300053080 | Bacteria | 2550 |
| 630 | Ga0495595_0000318 | 3300053084 | Bacteria | 18768 |
| 631 | Ga0495595_0025430 | 3300053084 | Bacteria | 2624 |
| 632 | Ga0495619_0000209 | 3300053085 | Bacteria | 42507 |
| 633 | Ga0495619_0030025 | 3300053085 | Bacteria | 3517 |
| 634 | Ga0495619_0302127 | 3300053085 | Bacteria | 1108 |
| 635 | Ga0500643_042785 | 3300053087 | Bacteria | 1323 |
| 636 | Ga0500651_0000968 | 3300053093 | Bacteria | 14125 |
| 637 | Ga0500566_0000806 | 3300053094 | Bacteria | 17838 |
| 638 | Ga0500566_0006355 | 3300053094 | Bacteria | 7019 |
| 639 | Ga0500566_0012447 | 3300053094 | Bacteria | 5008 |
| 640 | Ga0500641_0026140 | 3300053096 | Bacteria | 2264 |
| 641 | Ga0500648_103834 | 3300053097 | Bacteria | 1577 |
| 642 | Ga0500554_004314 | 3300053102 | Bacteria | 3003 |
| 643 | Ga0500554_051767 | 3300053102 | Bacteria | 1294 |
| 644 | Ga0500555_042354 | 3300053103 | Bacteria | 1265 |
| 645 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 646 | Ga0500569_024094 | 3300053109 | Bacteria | 1643 |
| 647 | Ga0500572_000300 | 3300053111 | Bacteria | 17529 |
| 648 | Ga0500572_002952 | 3300053111 | Bacteria | 3986 |
| 649 | Ga0500595_002428 | 3300053119 | Bacteria | 9286 |
| 650 | Ga0500595_006670 | 3300053119 | Bacteria | 4869 |
| 651 | Ga0500595_080797 | 3300053119 | Bacteria | 951 |
| 652 | Ga0500608_000450 | 3300053122 | Bacteria | 15389 |
| 653 | Ga0500614_000634 | 3300053123 | Bacteria | 8957 |
| 654 | Ga0500618_020987 | 3300053125 | Bacteria | 1597 |
| 655 | Ga0500642_0000058 | 3300053130 | Bacteria | 66200 |
| 656 | Ga0500642_0012595 | 3300053130 | Bacteria | 3075 |
| 657 | Ga0500652_001471 | 3300053131 | Bacteria | 7269 |
| 658 | Ga0500658_0012281 | 3300053134 | Bacteria | 3157 |
| 659 | Ga0500559_0000574 | 3300053136 | Bacteria | 25178 |
| 660 | Ga0500559_0003101 | 3300053136 | Bacteria | 8276 |
| 661 | Ga0500559_0007587 | 3300053136 | Bacteria | 4792 |
| 662 | Ga0500559_0116728 | 3300053136 | Bacteria | 1239 |
| 663 | Ga0500568_0014772 | 3300053139 | Bacteria | 3514 |
| 664 | Ga0500586_001305 | 3300053145 | Bacteria | 5235 |
| 665 | Ga0500590_053230 | 3300053148 | Bacteria | 2053 |
| 666 | Ga0500603_000147 | 3300053150 | Bacteria | 17079 |
| 667 | Ga0500603_002047 | 3300053150 | Bacteria | 4455 |
| 668 | Ga0500603_027421 | 3300053150 | Bacteria | 1447 |
| 669 | Ga0500604_0002670 | 3300053151 | Bacteria | 4849 |
| 670 | Ga0500616_0000045 | 3300053153 | Bacteria | 339292 |
| 671 | Ga0500616_0000069 | 3300053153 | Bacteria | 234334 |
| 672 | Ga0500622_0010112 | 3300053156 | Bacteria | 5195 |
| 673 | Ga0500630_004893 | 3300053159 | Bacteria | 6528 |
| 674 | Ga0500638_001948 | 3300053162 | Bacteria | 6901 |
| 675 | Ga0500639_000430 | 3300053163 | Bacteria | 20905 |
| 676 | Ga0500639_074639 | 3300053163 | Bacteria | 1719 |
| 677 | Ga0500639_091929 | 3300053163 | Bacteria | 1509 |
| 678 | Ga0500636_0003469 | 3300053177 | Bacteria | 8877 |
| 679 | Ga0500636_0135624 | 3300053177 | Bacteria | 1367 |
| 680 | Ga0500637_0000865 | 3300053178 | Bacteria | 12145 |
| 681 | Ga0500637_0028655 | 3300053178 | Bacteria | 3082 |
| 682 | Ga0500637_0030558 | 3300053178 | Bacteria | 2998 |
| 683 | Ga0500576_060746 | 3300053725 | Bacteria | 1654 |
| 684 | Ga0500645_033282 | 3300053730 | Bacteria | 1543 |
| 685 | Ga0500601_001860 | 3300053737 | Bacteria | 2264 |
| 686 | Ga0501084_0004354 | 3300054114 | Bacteria | 11541 |
| 687 | Ga0500661_000626 | 3300055283 | Bacteria | 6587 |
| 688 | Ga0501082_0008155 | 3300060353 | Bacteria | 9037 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2838122688 | 2838126533 | 220 |
| 2 | iso_pu_bacteria | 2841966195 | 2841966949 | 220 |
| 3 | iso_pu_bacteria | 2841983080 | 2841990060 | 220 |
| 4 | 3300039438 | Ga0436360_1154756 | Ga0436360_1154756_125_802 | 225 |
| 5 | iso_pu_bacteria | 2728368998 | 2728753250 | 236 |
| 6 | 3300005458 | Ga0070681_10042949 | Ga0070681_100429494 | 240 |
| 7 | 3300005530 | Ga0070679_100022970 | Ga0070679_1000229701 | 240 |
| 8 | 3300053136 | Ga0500559_0116728 | Ga0500559_0116728_486_1208 | 240 |
| 9 | 3300005436 | Ga0070713_100289943 | Ga0070713_1002899432 | 241 |
| 10 | 3300005456 | Ga0070678_100031872 | Ga0070678_1000318723 | 241 |
| 11 | 3300025928 | Ga0207700_10151577 | Ga0207700_101515772 | 241 |
| 12 | 3300037068 | Ga0373925_0448880 | Ga0373925_0448880_70_795 | 241 |
| 13 | 3300038443 | Ga0395901_0909836 | Ga0395901_0909836_101_826 | 241 |
| 14 | 3300027671 | Ga0209588_1058203 | Ga0209588_10582032 | 251 |
| 15 | 3300053145 | Ga0500586_001305 | Ga0500586_001305_4096_4914 | 251 |
| 16 | 3300005614 | Ga0068856_100000206 | Ga0068856_10000020639 | 252 |
| 17 | 3300026067 | Ga0207678_10094989 | Ga0207678_100949892 | 253 |
| 18 | 3300028794 | Ga0307515_10177717 | Ga0307515_101777171 | 253 |
| 19 | 3300031235 | Ga0265330_10022410 | Ga0265330_100224102 | 253 |
| 20 | 3300031241 | Ga0265325_10013456 | Ga0265325_100134564 | 253 |
| 21 | 3300031250 | Ga0265331_10011789 | Ga0265331_100117894 | 253 |
| 22 | 3300031595 | Ga0265313_10115104 | Ga0265313_101151042 | 253 |
| 23 | 3300046460 | Ga0495638_0012401 | Ga0495638_0012401_1678_2496 | 253 |
| 24 | 3300046501 | Ga0495607_0034108 | Ga0495607_0034108_188_1006 | 253 |
| 25 | 3300046507 | Ga0495606_0037490 | Ga0495606_0037490_1992_2810 | 253 |
| 26 | 3300046512 | Ga0495610_0034359 | Ga0495610_0034359_716_1534 | 253 |
| 27 | 3300046513 | Ga0495616_0085914 | Ga0495616_0085914_311_1129 | 253 |
| 28 | 3300046515 | Ga0495620_0036179 | Ga0495620_0036179_255_1073 | 253 |
| 29 | 3300046518 | Ga0495631_0030117 | Ga0495631_0030117_639_1457 | 253 |
| 30 | 3300046520 | Ga0495637_0024705 | Ga0495637_0024705_1834_2652 | 253 |
| 31 | 3300046522 | Ga0495643_0057511 | Ga0495643_0057511_342_1160 | 253 |
| 32 | 3300046558 | Ga0495633_0129880 | Ga0495633_0129880_145_963 | 253 |
| 33 | 3300046660 | Ga0495625_0293034 | Ga0495625_0293034_137_955 | 253 |
| 34 | 3300046674 | Ga0495588_0077680 | Ga0495588_0077680_684_1502 | 253 |
| 35 | 3300046692 | Ga0495671_0131117 | Ga0495671_0131117_284_1102 | 253 |
| 36 | 3300048920 | Ga0496117_0232263 | Ga0496117_0232263_83_901 | 253 |
| 37 | 3300048921 | Ga0496118_0186204 | Ga0496118_0186204_113_931 | 253 |
| 38 | 3300048923 | Ga0496120_0016563 | Ga0496120_0016563_1269_2087 | 253 |
| 39 | 3300048925 | Ga0496122_0033875 | Ga0496122_0033875_3361_4179 | 253 |
| 40 | 3300048926 | Ga0496123_0018308 | Ga0496123_0018308_1522_2340 | 253 |
| 41 | 3300048928 | Ga0496125_0006286 | Ga0496125_0006286_12038_12856 | 253 |
| 42 | 3300050492 | nmdc:mga0yw44_27809_c1 | nmdc:mga0yw44_27809_c1_2222_3040 | 253 |
| 43 | 3300053087 | Ga0500643_042785 | Ga0500643_042785_97_915 | 253 |
| 44 | 3300053096 | Ga0500641_0026140 | Ga0500641_0026140_67_885 | 253 |
| 45 | 3300053103 | Ga0500555_042354 | Ga0500555_042354_291_1109 | 253 |
| 46 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_581277_582095 | 253 |
| 47 | 3300053109 | Ga0500569_024094 | Ga0500569_024094_286_1104 | 253 |
| 48 | 3300053130 | Ga0500642_0000058 | Ga0500642_0000058_64556_65374 | 253 |
| 49 | 3300053134 | Ga0500658_0012281 | Ga0500658_0012281_626_1444 | 253 |
| 50 | 3300053139 | Ga0500568_0014772 | Ga0500568_0014772_1449_2267 | 253 |
| 51 | 3300053151 | Ga0500604_0002670 | Ga0500604_0002670_2859_3677 | 253 |
| 52 | 3300053153 | Ga0500616_0000069 | Ga0500616_0000069_64437_65255 | 253 |
| 53 | 3300039437 | Ga0436365_0599448 | Ga0436365_0599448_111_917 | 254 |
| 54 | 3300031616 | Ga0307508_10098845 | Ga0307508_100988452 | 256 |
| 55 | 3300048903 | Ga0496100_0108134 | Ga0496100_0108134_1082_1894 | 256 |
| 56 | 3300048904 | Ga0496101_0096632 | Ga0496101_0096632_294_1106 | 256 |
| 57 | 3300048909 | Ga0496106_0004589 | Ga0496106_0004589_511_1323 | 256 |
| 58 | 3300048910 | Ga0496107_0004218 | Ga0496107_0004218_7797_8609 | 256 |
| 59 | 3300048911 | Ga0496108_0000960 | Ga0496108_0000960_15696_16508 | 256 |
| 60 | 3300048912 | Ga0496109_0000201 | Ga0496109_0000201_9483_10295 | 256 |
| 61 | 3300048913 | Ga0496110_0096704 | Ga0496110_0096704_466_1278 | 256 |
| 62 | 3300048915 | Ga0496112_0001486 | Ga0496112_0001486_17059_17871 | 256 |
| 63 | 3300048916 | Ga0496113_0115239 | Ga0496113_0115239_1031_1843 | 256 |
| 64 | 3300031344 | Ga0265316_10131311 | Ga0265316_101313112 | 257 |
| 65 | 3300049823 | Ga0501044_0481955 | Ga0501044_0481955_319_1125 | 257 |
| 66 | 3300005331 | Ga0070670_100338230 | Ga0070670_1003382302 | 258 |
| 67 | 3300005356 | Ga0070674_100219985 | Ga0070674_1002199852 | 258 |
| 68 | 3300005719 | Ga0068861_100734095 | Ga0068861_1007340952 | 258 |
| 69 | 3300006186 | Ga0075369_10209205 | Ga0075369_102092051 | 258 |
| 70 | 3300025893 | Ga0207682_10099816 | Ga0207682_100998162 | 258 |
| 71 | 3300026121 | Ga0207683_10056620 | Ga0207683_100566205 | 258 |
| 72 | 3300048920 | Ga0496117_0080082 | Ga0496117_0080082_950_1768 | 258 |
| 73 | 3300048927 | Ga0496124_0143777 | Ga0496124_0143777_18_836 | 258 |
| 74 | 3300048928 | Ga0496125_0223077 | Ga0496125_0223077_348_1166 | 258 |
| 75 | 3300049571 | Ga0501034_0643910 | Ga0501034_0643910_59_865 | 258 |
| 76 | 3300049822 | Ga0501035_0097807 | Ga0501035_0097807_767_1573 | 258 |
| 77 | 3300050516 | nmdc:mga0sz30_12031_c1 | nmdc:mga0sz30_12031_c1_144_962 | 258 |
| 78 | iso_pu_bacteria | 8019648815 | 8019657527 | 258 |
| 79 | 3300003659 | JGI25404J52841_10001014 | JGI25404J52841_100010142 | 259 |
| 80 | 3300005937 | Ga0081455_10005298 | Ga0081455_100052989 | 259 |
| 81 | 3300005937 | Ga0081455_10102194 | Ga0081455_101021942 | 259 |
| 82 | 3300005937 | Ga0081455_10330185 | Ga0081455_103301852 | 259 |
| 83 | 3300005983 | Ga0081540_1020116 | Ga0081540_10201163 | 259 |
| 84 | 3300005983 | Ga0081540_1036959 | Ga0081540_10369593 | 259 |
| 85 | 3300005983 | Ga0081540_1038145 | Ga0081540_10381452 | 259 |
| 86 | 3300005983 | Ga0081540_1112148 | Ga0081540_11121481 | 259 |
| 87 | 3300006871 | Ga0075434_100177961 | Ga0075434_1001779612 | 259 |
| 88 | 3300050512 | nmdc:mga0n895_177808_c1 | nmdc:mga0n895_177808_c1_1205_2014 | 259 |
| 89 | 3300003203 | JGI25406J46586_10006594 | JGI25406J46586_100065943 | 260 |
| 90 | 3300005577 | Ga0068857_100341675 | Ga0068857_1003416752 | 260 |
| 91 | 3300005937 | Ga0081455_10009281 | Ga0081455_100092814 | 260 |
| 92 | 3300005983 | Ga0081540_1004926 | Ga0081540_10049262 | 260 |
| 93 | 3300005985 | Ga0081539_10000250 | Ga0081539_1000025056 | 260 |
| 94 | 3300006048 | Ga0075363_100080357 | Ga0075363_1000803572 | 260 |
| 95 | 3300013105 | Ga0157369_10390811 | Ga0157369_103908112 | 260 |
| 96 | 3300021358 | Ga0213873_10009910 | Ga0213873_100099102 | 260 |
| 97 | 3300021384 | Ga0213876_10041745 | Ga0213876_100417452 | 260 |
| 98 | 3300021441 | Ga0213871_10002249 | Ga0213871_100022492 | 260 |
| 99 | 3300025297 | Ga0209758_1016882 | Ga0209758_10168822 | 260 |
| 100 | 3300025912 | Ga0207707_10116750 | Ga0207707_101167502 | 260 |
| 101 | 3300025917 | Ga0207660_10075356 | Ga0207660_100753562 | 260 |
| 102 | 3300026116 | Ga0207674_10362878 | Ga0207674_103628782 | 260 |
| 103 | 3300037853 | Ga0436364_0100822 | Ga0436364_0100822_269_1051 | 260 |
| 104 | 3300039438 | Ga0436360_0261205 | Ga0436360_0261205_2656_3465 | 260 |
| 105 | 3300039447 | Ga0436361_0350934 | Ga0436361_0350934_546_1355 | 260 |
| 106 | 3300039453 | Ga0436362_0322148 | Ga0436362_0322148_2862_3668 | 260 |
| 107 | 3300039453 | Ga0436362_0342889 | Ga0436362_0342889_1022_1831 | 260 |
| 108 | 3300050490 | nmdc:mga03n38_55870_c1 | nmdc:mga03n38_55870_c1_469_1275 | 260 |
| 109 | iso_pu_bacteria | 2517093001 | 2517101991 | 260 |
| 110 | iso_pu_bacteria | 2874612657 | 2874612853 | 260 |
| 111 | iso_pu_bacteria | 2906643746 | 2906648778 | 260 |
| 112 | 3300005985 | Ga0081539_10000269 | Ga0081539_1000026974 | 261 |
| 113 | 3300037068 | Ga0373925_0082388 | Ga0373925_0082388_34_846 | 261 |
| 114 | 3300047315 | Ga0495581_0189861 | Ga0495581_0189861_85_897 | 261 |
| 115 | 3300005327 | Ga0070658_10422555 | Ga0070658_104225551 | 262 |
| 116 | 3300005356 | Ga0070674_100412518 | Ga0070674_1004125181 | 262 |
| 117 | 3300013306 | Ga0163162_10399189 | Ga0163162_103991892 | 262 |
| 118 | 3300025898 | Ga0207692_10100128 | Ga0207692_101001282 | 262 |
| 119 | 3300025909 | Ga0207705_10167519 | Ga0207705_101675192 | 262 |
| 120 | 3300025915 | Ga0207693_10061433 | Ga0207693_100614332 | 262 |
| 121 | 3300025916 | Ga0207663_10008590 | Ga0207663_100085904 | 262 |
| 122 | 3300025937 | Ga0207669_10310271 | Ga0207669_103102711 | 262 |
| 123 | 3300048903 | Ga0496100_0061285 | Ga0496100_0061285_1589_2401 | 262 |
| 124 | 3300048905 | Ga0496102_0379703 | Ga0496102_0379703_138_950 | 262 |
| 125 | 3300048918 | Ga0496115_0418788 | Ga0496115_0418788_148_960 | 262 |
| 126 | 3300035170 | Ga0373943_0085555 | Ga0373943_0085555_215_1027 | 263 |
| 127 | 3300035171 | Ga0373946_0106626 | Ga0373946_0106626_118_930 | 263 |
| 128 | 3300035695 | Ga0373927_0010055 | Ga0373927_0010055_436_1248 | 263 |
| 129 | 3300048929 | Ga0496126_0074973 | Ga0496126_0074973_1183_1995 | 263 |
| 130 | 3300003215 | JGI25153J46596_10000870 | JGI25153J46596_100008703 | 264 |
| 131 | 3300003215 | JGI25153J46596_10001131 | JGI25153J46596_100011312 | 264 |
| 132 | 3300003215 | JGI25153J46596_10003138 | JGI25153J46596_1000313810 | 264 |
| 133 | 3300003762 | Ga0055542_1020317 | Ga0055542_10203172 | 264 |
| 134 | 3300005344 | Ga0070661_100464194 | Ga0070661_1004641941 | 264 |
| 135 | 3300005355 | Ga0070671_100012940 | Ga0070671_1000129403 | 264 |
| 136 | 3300006941 | Ga0099825_1031832 | Ga0099825_10318322 | 264 |
| 137 | 3300006942 | Ga0099824_1017629 | Ga0099824_10176292 | 264 |
| 138 | 3300006943 | Ga0099822_1006195 | Ga0099822_10061958 | 264 |
| 139 | 3300009093 | Ga0105240_10022725 | Ga0105240_100227253 | 264 |
| 140 | 3300010375 | Ga0105239_10165829 | Ga0105239_101658292 | 264 |
| 141 | 3300013307 | Ga0157372_10693974 | Ga0157372_106939742 | 264 |
| 142 | 3300014969 | Ga0157376_10218607 | Ga0157376_102186072 | 264 |
| 143 | 3300027357 | Ga0209589_1000003 | Ga0209589_100000326 | 264 |
| 144 | 3300027361 | Ga0209489_100003 | Ga0209489_10000377 | 264 |
| 145 | 3300027363 | Ga0209700_100003 | Ga0209700_10000377 | 264 |
| 146 | 3300037418 | Ga0395900_0000502 | Ga0395900_0000502_27520_28326 | 264 |
| 147 | 3300037466 | Ga0395898_0042989 | Ga0395898_0042989_2683_3489 | 264 |
| 148 | 3300038443 | Ga0395901_0040290 | Ga0395901_0040290_237_1043 | 264 |
| 149 | 3300044684 | Ga0466966_0014844 | Ga0466966_0014844_2119_2925 | 264 |
| 150 | 3300044693 | Ga0466961_0000206 | Ga0466961_0000206_36381_37187 | 264 |
| 151 | 3300045049 | Ga0466959_0027271 | Ga0466959_0027271_1189_1995 | 264 |
| 152 | iso_pu_bacteria | 2643221651 | 2644288350 | 264 |
| 153 | 3300035089 | Ga0373944_0058880 | Ga0373944_0058880_181_993 | 265 |
| 154 | 3300048910 | Ga0496107_0379817 | Ga0496107_0379817_52_849 | 265 |
| 155 | iso_pu_bacteria | 2508501128 | 2509147332 | 265 |
| 156 | iso_pu_bacteria | 2513237141 | 2513895014 | 265 |
| 157 | 3300044842 | Ga0466957_0119825 | Ga0466957_0119825_642_1445 | 266 |
| 158 | 3300045976 | Ga0466967_0079022 | Ga0466967_0079022_740_1543 | 266 |
| 159 | 3300048924 | Ga0496121_0271456 | Ga0496121_0271456_274_1077 | 266 |
| 160 | 3300048929 | Ga0496126_0384683 | Ga0496126_0384683_212_1021 | 266 |
| 161 | iso_pu_bacteria | 2513237101 | 2513691854 | 266 |
| 162 | iso_pu_bacteria | 2524023210 | 2524466933 | 266 |
| 163 | iso_pu_bacteria | 2602042107 | 2603858883 | 266 |
| 164 | iso_pu_bacteria | 2721755755 | 2723845746 | 266 |
| 165 | iso_pu_bacteria | 2874604998 | 2874609636 | 266 |
| 166 | iso_pu_bacteria | 2876808645 | 2876809496 | 266 |
| 167 | iso_pu_bacteria | 2879110137 | 2879118503 | 266 |
| 168 | iso_pu_bacteria | 2889033259 | 2889040561 | 266 |
| 169 | iso_pu_bacteria | 2893066018 | 2893068429 | 266 |
| 170 | iso_pu_bacteria | 2922361189 | 2922367689 | 266 |
| 171 | iso_pu_bacteria | 2922386360 | 2922392415 | 266 |
| 172 | iso_pu_bacteria | 8006964411 | 8006967387 | 266 |
| 173 | iso_pu_bacteria | 8006994254 | 8006997702 | 266 |
| 174 | 3300003214 | JGI25165J46597_1010528 | JGI25165J46597_10105282 | 267 |
| 175 | 3300005458 | Ga0070681_10013524 | Ga0070681_100135247 | 267 |
| 176 | 3300005539 | Ga0068853_100375994 | Ga0068853_1003759942 | 267 |
| 177 | 3300005547 | Ga0070693_100102779 | Ga0070693_1001027792 | 267 |
| 178 | 3300005578 | Ga0068854_100111165 | Ga0068854_1001111652 | 267 |
| 179 | 3300005614 | Ga0068856_100218071 | Ga0068856_1002180712 | 267 |
| 180 | 3300005983 | Ga0081540_1005440 | Ga0081540_10054404 | 267 |
| 181 | 3300007788 | Ga0099795_10005059 | Ga0099795_100050593 | 267 |
| 182 | 3300021384 | Ga0213876_10214933 | Ga0213876_102149332 | 267 |
| 183 | 3300025261 | Ga0209233_1000803 | Ga0209233_10008038 | 267 |
| 184 | 3300025912 | Ga0207707_10000811 | Ga0207707_100008119 | 267 |
| 185 | 3300025921 | Ga0207652_10628779 | Ga0207652_106287791 | 267 |
| 186 | 3300025949 | Ga0207667_10280255 | Ga0207667_102802552 | 267 |
| 187 | 3300025981 | Ga0207640_10146126 | Ga0207640_101461262 | 267 |
| 188 | 3300026041 | Ga0207639_10113932 | Ga0207639_101139322 | 267 |
| 189 | 3300035086 | Ga0373934_0045411 | Ga0373934_0045411_82_888 | 267 |
| 190 | 3300035172 | Ga0373955_0132176 | Ga0373955_0132176_64_870 | 267 |
| 191 | 3300035410 | Ga0373924_0020394 | Ga0373924_0020394_159_965 | 267 |
| 192 | 3300039437 | Ga0436365_1775270 | Ga0436365_1775270_167_973 | 267 |
| 193 | 3300044842 | Ga0466957_0263015 | Ga0466957_0263015_184_990 | 267 |
| 194 | 3300046514 | Ga0495618_0252499 | Ga0495618_0252499_234_1040 | 267 |
| 195 | 3300046683 | Ga0495658_0060799 | Ga0495658_0060799_611_1417 | 267 |
| 196 | 3300048920 | Ga0496117_0181366 | Ga0496117_0181366_217_1023 | 267 |
| 197 | 3300048921 | Ga0496118_0020314 | Ga0496118_0020314_2583_3389 | 267 |
| 198 | 3300048922 | Ga0496119_0068957 | Ga0496119_0068957_395_1201 | 267 |
| 199 | 3300048924 | Ga0496121_0088498 | Ga0496121_0088498_1448_2254 | 267 |
| 200 | 3300048929 | Ga0496126_0097351 | Ga0496126_0097351_165_971 | 267 |
| 201 | 3300053177 | Ga0500636_0003469 | Ga0500636_0003469_7435_8241 | 267 |
| 202 | 3300053177 | Ga0500636_0135624 | Ga0500636_0135624_101_907 | 267 |
| 203 | 3300005435 | Ga0070714_100331599 | Ga0070714_1003315992 | 268 |
| 204 | 3300005539 | Ga0068853_100059725 | Ga0068853_1000597252 | 268 |
| 205 | 3300005937 | Ga0081455_10231458 | Ga0081455_102314582 | 268 |
| 206 | 3300005983 | Ga0081540_1019388 | Ga0081540_10193882 | 268 |
| 207 | 3300013104 | Ga0157370_10125512 | Ga0157370_101255122 | 268 |
| 208 | 3300025919 | Ga0207657_10012427 | Ga0207657_100124273 | 268 |
| 209 | 3300037312 | Ga0395899_0043949 | Ga0395899_0043949_306_1112 | 268 |
| 210 | 3300037418 | Ga0395900_0171077 | Ga0395900_0171077_1337_2143 | 268 |
| 211 | 3300037466 | Ga0395898_0244168 | Ga0395898_0244168_477_1283 | 268 |
| 212 | 3300038443 | Ga0395901_0252272 | Ga0395901_0252272_994_1800 | 268 |
| 213 | 3300046543 | Ga0495645_0004453 | Ga0495645_0004453_663_1469 | 268 |
| 214 | 3300046678 | Ga0495599_0039738 | Ga0495599_0039738_1210_2016 | 268 |
| 215 | 3300049571 | Ga0501034_0333924 | Ga0501034_0333924_165_974 | 268 |
| 216 | 3300049572 | Ga0501036_0215438 | Ga0501036_0215438_686_1495 | 268 |
| 217 | 3300049573 | Ga0501037_0132038 | Ga0501037_0132038_493_1299 | 268 |
| 218 | 3300049579 | Ga0501043_0356397 | Ga0501043_0356397_18_827 | 268 |
| 219 | 3300049580 | Ga0501046_0095055 | Ga0501046_0095055_1380_2186 | 268 |
| 220 | 3300049580 | Ga0501046_0176701 | Ga0501046_0176701_589_1395 | 268 |
| 221 | 3300049581 | Ga0501047_0056511 | Ga0501047_0056511_589_1398 | 268 |
| 222 | 3300049582 | Ga0501048_0072696 | Ga0501048_0072696_1501_2307 | 268 |
| 223 | 3300049583 | Ga0501067_0048355 | Ga0501067_0048355_1067_1873 | 268 |
| 224 | 3300049587 | Ga0501071_0199173 | Ga0501071_0199173_26_832 | 268 |
| 225 | 3300049589 | Ga0501073_0163089 | Ga0501073_0163089_127_933 | 268 |
| 226 | 3300049742 | Ga0501080_0163136 | Ga0501080_0163136_1132_1938 | 268 |
| 227 | 3300049823 | Ga0501044_0080479 | Ga0501044_0080479_2044_2853 | 268 |
| 228 | 3300053077 | Ga0495601_0067861 | Ga0495601_0067861_169_975 | 268 |
| 229 | 3300053111 | Ga0500572_002952 | Ga0500572_002952_634_1443 | 268 |
| 230 | 3300053136 | Ga0500559_0007587 | Ga0500559_0007587_1906_2715 | 268 |
| 231 | 3300053153 | Ga0500616_0000045 | Ga0500616_0000045_40613_41422 | 268 |
| 232 | 3300053163 | Ga0500639_074639 | Ga0500639_074639_435_1244 | 268 |
| 233 | 3300053725 | Ga0500576_060746 | Ga0500576_060746_179_988 | 268 |
| 234 | 3300005329 | Ga0070683_100232580 | Ga0070683_1002325802 | 269 |
| 235 | 3300005458 | Ga0070681_10045367 | Ga0070681_100453676 | 269 |
| 236 | 3300005530 | Ga0070679_100119475 | Ga0070679_1001194752 | 269 |
| 237 | 3300005535 | Ga0070684_100062894 | Ga0070684_1000628942 | 269 |
| 238 | 3300006914 | Ga0075436_100074743 | Ga0075436_1000747432 | 269 |
| 239 | 3300007076 | Ga0075435_100329214 | Ga0075435_1003292142 | 269 |
| 240 | 3300007788 | Ga0099795_10008603 | Ga0099795_100086033 | 269 |
| 241 | 3300009093 | Ga0105240_10100146 | Ga0105240_101001462 | 269 |
| 242 | 3300010159 | Ga0099796_10096478 | Ga0099796_100964782 | 269 |
| 243 | 3300013104 | Ga0157370_10060342 | Ga0157370_100603422 | 269 |
| 244 | 3300021377 | Ga0213874_10008901 | Ga0213874_100089012 | 269 |
| 245 | 3300021388 | Ga0213875_10037553 | Ga0213875_100375532 | 269 |
| 246 | 3300025912 | Ga0207707_10066644 | Ga0207707_100666443 | 269 |
| 247 | 3300025912 | Ga0207707_10076994 | Ga0207707_100769942 | 269 |
| 248 | 3300025921 | Ga0207652_10103108 | Ga0207652_101031082 | 269 |
| 249 | 3300025944 | Ga0207661_10013087 | Ga0207661_100130872 | 269 |
| 250 | 3300026078 | Ga0207702_10081904 | Ga0207702_100819042 | 269 |
| 251 | 3300031247 | Ga0265340_10073517 | Ga0265340_100735172 | 269 |
| 252 | 3300031249 | Ga0265339_10009439 | Ga0265339_100094392 | 269 |
| 253 | 3300031711 | Ga0265314_10051396 | Ga0265314_100513962 | 269 |
| 254 | 3300031730 | Ga0307516_10082526 | Ga0307516_100825263 | 269 |
| 255 | 3300035113 | Ga0373936_0032242 | Ga0373936_0032242_1231_2043 | 269 |
| 256 | 3300035695 | Ga0373927_0277926 | Ga0373927_0277926_58_867 | 269 |
| 257 | 3300037853 | Ga0436364_0311161 | Ga0436364_0311161_166_975 | 269 |
| 258 | 3300039447 | Ga0436361_1031086 | Ga0436361_1031086_349_1158 | 269 |
| 259 | 3300039450 | Ga0436363_0258064 | Ga0436363_0258064_808_1617 | 269 |
| 260 | 3300044656 | Ga0466969_0092891 | Ga0466969_0092891_485_1294 | 269 |
| 261 | 3300044693 | Ga0466961_0073655 | Ga0466961_0073655_1089_1898 | 269 |
| 262 | 3300044735 | Ga0466968_0145126 | Ga0466968_0145126_144_953 | 269 |
| 263 | 3300045049 | Ga0466959_0014677 | Ga0466959_0014677_387_1196 | 269 |
| 264 | 3300046473 | Ga0495582_0045439 | Ga0495582_0045439_458_1267 | 269 |
| 265 | 3300046507 | Ga0495606_0004193 | Ga0495606_0004193_11971_12780 | 269 |
| 266 | 3300048928 | Ga0496125_0001539 | Ga0496125_0001539_27811_28620 | 269 |
| 267 | 3300048928 | Ga0496125_0003378 | Ga0496125_0003378_1552_2361 | 269 |
| 268 | 3300049569 | Ga0501032_0319613 | Ga0501032_0319613_80_889 | 269 |
| 269 | 3300049580 | Ga0501046_0046820 | Ga0501046_0046820_1264_2073 | 269 |
| 270 | 3300049581 | Ga0501047_0024742 | Ga0501047_0024742_1177_1986 | 269 |
| 271 | 3300049586 | Ga0501070_0019443 | Ga0501070_0019443_3975_4784 | 269 |
| 272 | 3300049742 | Ga0501080_0006722 | Ga0501080_0006722_6919_7728 | 269 |
| 273 | 3300049823 | Ga0501044_0147045 | Ga0501044_0147045_736_1545 | 269 |
| 274 | 3300050513 | nmdc:mga0rr50_45933_c1 | nmdc:mga0rr50_45933_c1_273_1082 | 269 |
| 275 | 3300053080 | Ga0500635_0005744 | Ga0500635_0005744_2135_2947 | 269 |
| 276 | 3300053084 | Ga0495595_0025430 | Ga0495595_0025430_129_938 | 269 |
| 277 | 3300053085 | Ga0495619_0030025 | Ga0495619_0030025_2170_2979 | 269 |
| 278 | 3300053093 | Ga0500651_0000968 | Ga0500651_0000968_338_1147 | 269 |
| 279 | 3300053094 | Ga0500566_0000806 | Ga0500566_0000806_12490_13302 | 269 |
| 280 | 3300053094 | Ga0500566_0012447 | Ga0500566_0012447_2284_3093 | 269 |
| 281 | 3300053097 | Ga0500648_103834 | Ga0500648_103834_18_830 | 269 |
| 282 | 3300053102 | Ga0500554_004314 | Ga0500554_004314_1983_2792 | 269 |
| 283 | 3300053111 | Ga0500572_000300 | Ga0500572_000300_10522_11334 | 269 |
| 284 | 3300053119 | Ga0500595_002428 | Ga0500595_002428_2256_3065 | 269 |
| 285 | 3300053123 | Ga0500614_000634 | Ga0500614_000634_7163_7975 | 269 |
| 286 | 3300053130 | Ga0500642_0012595 | Ga0500642_0012595_1029_1838 | 269 |
| 287 | 3300053136 | Ga0500559_0003101 | Ga0500559_0003101_2165_2977 | 269 |
| 288 | 3300053150 | Ga0500603_000147 | Ga0500603_000147_2426_3238 | 269 |
| 289 | 3300053150 | Ga0500603_027421 | Ga0500603_027421_53_862 | 269 |
| 290 | 3300053159 | Ga0500630_004893 | Ga0500630_004893_3740_4552 | 269 |
| 291 | 3300053162 | Ga0500638_001948 | Ga0500638_001948_1831_2640 | 269 |
| 292 | 3300053163 | Ga0500639_000430 | Ga0500639_000430_6196_7008 | 269 |
| 293 | 3300053163 | Ga0500639_091929 | Ga0500639_091929_582_1394 | 269 |
| 294 | 3300053178 | Ga0500637_0000865 | Ga0500637_0000865_1036_1845 | 269 |
| 295 | 3300053178 | Ga0500637_0028655 | Ga0500637_0028655_149_961 | 269 |
| 296 | 3300053737 | Ga0500601_001860 | Ga0500601_001860_985_1797 | 269 |
| 297 | 3300055283 | Ga0500661_000626 | Ga0500661_000626_2099_2908 | 269 |
| 298 | 3300002077 | JGI24744J21845_10026422 | JGI24744J21845_100264222 | 270 |
| 299 | 3300005333 | Ga0070677_10078631 | Ga0070677_100786312 | 270 |
| 300 | 3300005338 | Ga0068868_100245516 | Ga0068868_1002455161 | 270 |
| 301 | 3300005338 | Ga0068868_100303033 | Ga0068868_1003030332 | 270 |
| 302 | 3300005340 | Ga0070689_100142918 | Ga0070689_1001429182 | 270 |
| 303 | 3300005344 | Ga0070661_100090598 | Ga0070661_1000905982 | 270 |
| 304 | 3300005347 | Ga0070668_100120301 | Ga0070668_1001203012 | 270 |
| 305 | 3300005353 | Ga0070669_100338473 | Ga0070669_1003384732 | 270 |
| 306 | 3300005354 | Ga0070675_100561624 | Ga0070675_1005616241 | 270 |
| 307 | 3300005356 | Ga0070674_100091070 | Ga0070674_1000910702 | 270 |
| 308 | 3300005364 | Ga0070673_100472480 | Ga0070673_1004724802 | 270 |
| 309 | 3300005367 | Ga0070667_100633627 | Ga0070667_1006336271 | 270 |
| 310 | 3300005435 | Ga0070714_100147670 | Ga0070714_1001476702 | 270 |
| 311 | 3300005435 | Ga0070714_100244577 | Ga0070714_1002445771 | 270 |
| 312 | 3300005436 | Ga0070713_100031831 | Ga0070713_1000318312 | 270 |
| 313 | 3300005437 | Ga0070710_10179813 | Ga0070710_101798131 | 270 |
| 314 | 3300005439 | Ga0070711_100021744 | Ga0070711_1000217442 | 270 |
| 315 | 3300005441 | Ga0070700_100264702 | Ga0070700_1002647021 | 270 |
| 316 | 3300005445 | Ga0070708_100092489 | Ga0070708_1000924892 | 270 |
| 317 | 3300005455 | Ga0070663_100009662 | Ga0070663_1000096622 | 270 |
| 318 | 3300005455 | Ga0070663_100351404 | Ga0070663_1003514041 | 270 |
| 319 | 3300005456 | Ga0070678_100032274 | Ga0070678_1000322745 | 270 |
| 320 | 3300005456 | Ga0070678_100212265 | Ga0070678_1002122652 | 270 |
| 321 | 3300005457 | Ga0070662_100060341 | Ga0070662_1000603412 | 270 |
| 322 | 3300005459 | Ga0068867_100043171 | Ga0068867_1000431711 | 270 |
| 323 | 3300005530 | Ga0070679_100204853 | Ga0070679_1002048532 | 270 |
| 324 | 3300005530 | Ga0070679_100253626 | Ga0070679_1002536262 | 270 |
| 325 | 3300005535 | Ga0070684_100356662 | Ga0070684_1003566621 | 270 |
| 326 | 3300005536 | Ga0070697_100085658 | Ga0070697_1000856582 | 270 |
| 327 | 3300005543 | Ga0070672_100339222 | Ga0070672_1003392222 | 270 |
| 328 | 3300005548 | Ga0070665_100289150 | Ga0070665_1002891502 | 270 |
| 329 | 3300005548 | Ga0070665_100468949 | Ga0070665_1004689492 | 270 |
| 330 | 3300005577 | Ga0068857_100016728 | Ga0068857_1000167288 | 270 |
| 331 | 3300005616 | Ga0068852_100007921 | Ga0068852_1000079211 | 270 |
| 332 | 3300005616 | Ga0068852_100300907 | Ga0068852_1003009072 | 270 |
| 333 | 3300005618 | Ga0068864_100282528 | Ga0068864_1002825282 | 270 |
| 334 | 3300005618 | Ga0068864_100769137 | Ga0068864_1007691371 | 270 |
| 335 | 3300005718 | Ga0068866_10105496 | Ga0068866_101054962 | 270 |
| 336 | 3300005719 | Ga0068861_100433763 | Ga0068861_1004337632 | 270 |
| 337 | 3300005840 | Ga0068870_10040915 | Ga0068870_100409151 | 270 |
| 338 | 3300005841 | Ga0068863_100503013 | Ga0068863_1005030131 | 270 |
| 339 | 3300005842 | Ga0068858_100456698 | Ga0068858_1004566982 | 270 |
| 340 | 3300005842 | Ga0068858_100628728 | Ga0068858_1006287282 | 270 |
| 341 | 3300005843 | Ga0068860_100659509 | Ga0068860_1006595092 | 270 |
| 342 | 3300005843 | Ga0068860_100847537 | Ga0068860_1008475372 | 270 |
| 343 | 3300005844 | Ga0068862_100355350 | Ga0068862_1003553502 | 270 |
| 344 | 3300005983 | Ga0081540_1000108 | Ga0081540_10001082 | 270 |
| 345 | 3300005983 | Ga0081540_1004850 | Ga0081540_10048503 | 270 |
| 346 | 3300006028 | Ga0070717_10021905 | Ga0070717_100219055 | 270 |
| 347 | 3300006028 | Ga0070717_10088638 | Ga0070717_100886382 | 270 |
| 348 | 3300006038 | Ga0075365_10185348 | Ga0075365_101853482 | 270 |
| 349 | 3300006048 | Ga0075363_100063158 | Ga0075363_1000631582 | 270 |
| 350 | 3300006051 | Ga0075364_10045107 | Ga0075364_100451072 | 270 |
| 351 | 3300006163 | Ga0070715_10030241 | Ga0070715_100302412 | 270 |
| 352 | 3300006173 | Ga0070716_100006338 | Ga0070716_1000063382 | 270 |
| 353 | 3300006175 | Ga0070712_100064204 | Ga0070712_1000642042 | 270 |
| 354 | 3300006175 | Ga0070712_100082169 | Ga0070712_1000821692 | 270 |
| 355 | 3300006175 | Ga0070712_100134549 | Ga0070712_1001345492 | 270 |
| 356 | 3300006177 | Ga0075362_10030502 | Ga0075362_100305022 | 270 |
| 357 | 3300006178 | Ga0075367_10041416 | Ga0075367_100414162 | 270 |
| 358 | 3300006186 | Ga0075369_10075759 | Ga0075369_100757592 | 270 |
| 359 | 3300006195 | Ga0075366_10066636 | Ga0075366_100666362 | 270 |
| 360 | 3300006237 | Ga0097621_100267301 | Ga0097621_1002673012 | 270 |
| 361 | 3300006358 | Ga0068871_100233285 | Ga0068871_1002332852 | 270 |
| 362 | 3300006881 | Ga0068865_100182900 | Ga0068865_1001829002 | 270 |
| 363 | 3300007265 | Ga0099794_10028147 | Ga0099794_100281472 | 270 |
| 364 | 3300007265 | Ga0099794_10067426 | Ga0099794_100674262 | 270 |
| 365 | 3300007265 | Ga0099794_10100747 | Ga0099794_101007472 | 270 |
| 366 | 3300007788 | Ga0099795_10005742 | Ga0099795_100057422 | 270 |
| 367 | 3300007788 | Ga0099795_10012866 | Ga0099795_100128662 | 270 |
| 368 | 3300007788 | Ga0099795_10064591 | Ga0099795_100645912 | 270 |
| 369 | 3300009093 | Ga0105240_10061772 | Ga0105240_100617722 | 270 |
| 370 | 3300009094 | Ga0111539_10210993 | Ga0111539_102109932 | 270 |
| 371 | 3300009094 | Ga0111539_10498037 | Ga0111539_104980372 | 270 |
| 372 | 3300009098 | Ga0105245_10017389 | Ga0105245_100173892 | 270 |
| 373 | 3300009098 | Ga0105245_10129672 | Ga0105245_101296722 | 270 |
| 374 | 3300009147 | Ga0114129_10342189 | Ga0114129_103421892 | 270 |
| 375 | 3300009177 | Ga0105248_10336667 | Ga0105248_103366672 | 270 |
| 376 | 3300009177 | Ga0105248_10510680 | Ga0105248_105106802 | 270 |
| 377 | 3300009177 | Ga0105248_10948326 | Ga0105248_109483262 | 270 |
| 378 | 3300009551 | Ga0105238_10196907 | Ga0105238_101969072 | 270 |
| 379 | 3300009553 | Ga0105249_10224408 | Ga0105249_102244082 | 270 |
| 380 | 3300010159 | Ga0099796_10007333 | Ga0099796_100073332 | 270 |
| 381 | 3300010159 | Ga0099796_10072149 | Ga0099796_100721491 | 270 |
| 382 | 3300010375 | Ga0105239_10128310 | Ga0105239_101283102 | 270 |
| 383 | 3300010375 | Ga0105239_10182892 | Ga0105239_101828922 | 270 |
| 384 | 3300013102 | Ga0157371_10010876 | Ga0157371_100108769 | 270 |
| 385 | 3300013104 | Ga0157370_10066309 | Ga0157370_100663093 | 270 |
| 386 | 3300013104 | Ga0157370_10168763 | Ga0157370_101687632 | 270 |
| 387 | 3300013105 | Ga0157369_10117143 | Ga0157369_101171433 | 270 |
| 388 | 3300013296 | Ga0157374_10088521 | Ga0157374_100885212 | 270 |
| 389 | 3300013297 | Ga0157378_10095751 | Ga0157378_100957512 | 270 |
| 390 | 3300013306 | Ga0163162_10028745 | Ga0163162_100287452 | 270 |
| 391 | 3300013306 | Ga0163162_10096319 | Ga0163162_100963192 | 270 |
| 392 | 3300013307 | Ga0157372_10045680 | Ga0157372_100456803 | 270 |
| 393 | 3300013308 | Ga0157375_10023492 | Ga0157375_100234922 | 270 |
| 394 | 3300013308 | Ga0157375_10047623 | Ga0157375_100476232 | 270 |
| 395 | 3300013308 | Ga0157375_10433954 | Ga0157375_104339541 | 270 |
| 396 | 3300014325 | Ga0163163_10099810 | Ga0163163_100998101 | 270 |
| 397 | 3300014326 | Ga0157380_10346036 | Ga0157380_103460362 | 270 |
| 398 | 3300014326 | Ga0157380_10475674 | Ga0157380_104756742 | 270 |
| 399 | 3300014968 | Ga0157379_10246663 | Ga0157379_102466632 | 270 |
| 400 | 3300014969 | Ga0157376_10058973 | Ga0157376_100589732 | 270 |
| 401 | 3300017792 | Ga0163161_10149395 | Ga0163161_101493952 | 270 |
| 402 | 3300025295 | Ga0209564_1010235 | Ga0209564_10102354 | 270 |
| 403 | 3300025315 | Ga0207697_10015805 | Ga0207697_100158052 | 270 |
| 404 | 3300025899 | Ga0207642_10103737 | Ga0207642_101037372 | 270 |
| 405 | 3300025901 | Ga0207688_10111989 | Ga0207688_101119892 | 270 |
| 406 | 3300025905 | Ga0207685_10018988 | Ga0207685_100189882 | 270 |
| 407 | 3300025910 | Ga0207684_10237043 | Ga0207684_102370432 | 270 |
| 408 | 3300025913 | Ga0207695_10100673 | Ga0207695_101006732 | 270 |
| 409 | 3300025914 | Ga0207671_10044022 | Ga0207671_100440222 | 270 |
| 410 | 3300025915 | Ga0207693_10028476 | Ga0207693_100284762 | 270 |
| 411 | 3300025915 | Ga0207693_10055551 | Ga0207693_100555514 | 270 |
| 412 | 3300025915 | Ga0207693_10148236 | Ga0207693_101482362 | 270 |
| 413 | 3300025918 | Ga0207662_10102192 | Ga0207662_101021922 | 270 |
| 414 | 3300025919 | Ga0207657_10003989 | Ga0207657_100039893 | 270 |
| 415 | 3300025919 | Ga0207657_10508598 | Ga0207657_105085982 | 270 |
| 416 | 3300025920 | Ga0207649_10292622 | Ga0207649_102926221 | 270 |
| 417 | 3300025921 | Ga0207652_10523306 | Ga0207652_105233062 | 270 |
| 418 | 3300025922 | Ga0207646_10142022 | Ga0207646_101420222 | 270 |
| 419 | 3300025923 | Ga0207681_10308145 | Ga0207681_103081452 | 270 |
| 420 | 3300025923 | Ga0207681_10534835 | Ga0207681_105348351 | 270 |
| 421 | 3300025925 | Ga0207650_10436161 | Ga0207650_104361612 | 270 |
| 422 | 3300025927 | Ga0207687_10114503 | Ga0207687_101145032 | 270 |
| 423 | 3300025927 | Ga0207687_10330309 | Ga0207687_103303092 | 270 |
| 424 | 3300025928 | Ga0207700_10002197 | Ga0207700_1000219710 | 270 |
| 425 | 3300025928 | Ga0207700_10028701 | Ga0207700_100287013 | 270 |
| 426 | 3300025929 | Ga0207664_10007415 | Ga0207664_100074154 | 270 |
| 427 | 3300025929 | Ga0207664_10172649 | Ga0207664_101726492 | 270 |
| 428 | 3300025929 | Ga0207664_10281776 | Ga0207664_102817762 | 270 |
| 429 | 3300025931 | Ga0207644_10109535 | Ga0207644_101095352 | 270 |
| 430 | 3300025933 | Ga0207706_10030685 | Ga0207706_100306853 | 270 |
| 431 | 3300025934 | Ga0207686_10299276 | Ga0207686_102992762 | 270 |
| 432 | 3300025935 | Ga0207709_10043830 | Ga0207709_100438303 | 270 |
| 433 | 3300025936 | Ga0207670_10173486 | Ga0207670_101734862 | 270 |
| 434 | 3300025937 | Ga0207669_10006938 | Ga0207669_100069382 | 270 |
| 435 | 3300025939 | Ga0207665_10011239 | Ga0207665_100112397 | 270 |
| 436 | 3300025940 | Ga0207691_10172416 | Ga0207691_101724162 | 270 |
| 437 | 3300025944 | Ga0207661_10135410 | Ga0207661_101354102 | 270 |
| 438 | 3300025949 | Ga0207667_10698306 | Ga0207667_106983062 | 270 |
| 439 | 3300025961 | Ga0207712_10234066 | Ga0207712_102340662 | 270 |
| 440 | 3300025961 | Ga0207712_10268414 | Ga0207712_102684142 | 270 |
| 441 | 3300025972 | Ga0207668_10409341 | Ga0207668_104093411 | 270 |
| 442 | 3300025981 | Ga0207640_10467577 | Ga0207640_104675771 | 270 |
| 443 | 3300026023 | Ga0207677_10088711 | Ga0207677_100887112 | 270 |
| 444 | 3300026035 | Ga0207703_10468044 | Ga0207703_104680441 | 270 |
| 445 | 3300026041 | Ga0207639_10005362 | Ga0207639_1000536210 | 270 |
| 446 | 3300026067 | Ga0207678_10024074 | Ga0207678_100240745 | 270 |
| 447 | 3300026067 | Ga0207678_10224820 | Ga0207678_102248202 | 270 |
| 448 | 3300026067 | Ga0207678_10288294 | Ga0207678_102882942 | 270 |
| 449 | 3300026067 | Ga0207678_10357659 | Ga0207678_103576592 | 270 |
| 450 | 3300026075 | Ga0207708_10185664 | Ga0207708_101856642 | 270 |
| 451 | 3300026078 | Ga0207702_10445493 | Ga0207702_104454932 | 270 |
| 452 | 3300026088 | Ga0207641_10516639 | Ga0207641_105166392 | 270 |
| 453 | 3300026089 | Ga0207648_10068146 | Ga0207648_100681461 | 270 |
| 454 | 3300026095 | Ga0207676_10516668 | Ga0207676_105166682 | 270 |
| 455 | 3300026116 | Ga0207674_10024558 | Ga0207674_100245582 | 270 |
| 456 | 3300026118 | Ga0207675_100434744 | Ga0207675_1004347442 | 270 |
| 457 | 3300026121 | Ga0207683_10088242 | Ga0207683_100882422 | 270 |
| 458 | 3300026121 | Ga0207683_10588206 | Ga0207683_105882061 | 270 |
| 459 | 3300026142 | Ga0207698_10165038 | Ga0207698_101650382 | 270 |
| 460 | 3300027512 | Ga0209179_1024520 | Ga0209179_10245202 | 270 |
| 461 | 3300027671 | Ga0209588_1006465 | Ga0209588_10064653 | 270 |
| 462 | 3300028379 | Ga0268266_10619504 | Ga0268266_106195041 | 270 |
| 463 | 3300028380 | Ga0268265_10156122 | Ga0268265_101561222 | 270 |
| 464 | 3300028381 | Ga0268264_10393342 | Ga0268264_103933422 | 270 |
| 465 | 3300028381 | Ga0268264_10512454 | Ga0268264_105124542 | 270 |
| 466 | 3300031235 | Ga0265330_10113757 | Ga0265330_101137572 | 270 |
| 467 | 3300031238 | Ga0265332_10040785 | Ga0265332_100407852 | 270 |
| 468 | 3300031239 | Ga0265328_10042046 | Ga0265328_100420462 | 270 |
| 469 | 3300031507 | Ga0307509_10399823 | Ga0307509_103998231 | 270 |
| 470 | 3300031616 | Ga0307508_10089802 | Ga0307508_100898022 | 270 |
| 471 | 3300031731 | Ga0307405_10251776 | Ga0307405_102517762 | 270 |
| 472 | 3300031911 | Ga0307412_10188000 | Ga0307412_101880002 | 270 |
| 473 | 3300032002 | Ga0307416_100164696 | Ga0307416_1001646962 | 270 |
| 474 | 3300032005 | Ga0307411_10484575 | Ga0307411_104845752 | 270 |
| 475 | 3300033180 | Ga0307510_10106595 | Ga0307510_101065952 | 270 |
| 476 | 3300033180 | Ga0307510_10249672 | Ga0307510_102496722 | 270 |
| 477 | 3300035086 | Ga0373934_0022806 | Ga0373934_0022806_663_1475 | 270 |
| 478 | 3300035086 | Ga0373934_0055361 | Ga0373934_0055361_476_1288 | 270 |
| 479 | 3300035111 | Ga0373923_0015122 | Ga0373923_0015122_758_1573 | 270 |
| 480 | 3300035112 | Ga0373932_0076302 | Ga0373932_0076302_162_974 | 270 |
| 481 | 3300035116 | Ga0373945_0135229 | Ga0373945_0135229_130_942 | 270 |
| 482 | 3300035117 | Ga0373953_0000391 | Ga0373953_0000391_9753_10568 | 270 |
| 483 | 3300035118 | Ga0373954_0000035 | Ga0373954_0000035_14385_15200 | 270 |
| 484 | 3300035118 | Ga0373954_0049177 | Ga0373954_0049177_846_1658 | 270 |
| 485 | 3300035119 | Ga0373956_0000207 | Ga0373956_0000207_20487_21302 | 270 |
| 486 | 3300035120 | Ga0373957_0000626 | Ga0373957_0000626_445_1260 | 270 |
| 487 | 3300035170 | Ga0373943_0011104 | Ga0373943_0011104_2753_3565 | 270 |
| 488 | 3300035171 | Ga0373946_0014497 | Ga0373946_0014497_1283_2095 | 270 |
| 489 | 3300035172 | Ga0373955_0001026 | Ga0373955_0001026_2725_3540 | 270 |
| 490 | 3300035172 | Ga0373955_0003450 | Ga0373955_0003450_2665_3477 | 270 |
| 491 | 3300035410 | Ga0373924_0005037 | Ga0373924_0005037_1535_2350 | 270 |
| 492 | 3300035410 | Ga0373924_0021995 | Ga0373924_0021995_1093_1905 | 270 |
| 493 | 3300035691 | Ga0373931_0053278 | Ga0373931_0053278_54_866 | 270 |
| 494 | 3300035692 | Ga0373935_0000256 | Ga0373935_0000256_22793_23605 | 270 |
| 495 | 3300035695 | Ga0373927_0006824 | Ga0373927_0006824_3199_4011 | 270 |
| 496 | 3300035695 | Ga0373927_0009285 | Ga0373927_0009285_3146_3958 | 270 |
| 497 | 3300035695 | Ga0373927_0222950 | Ga0373927_0222950_304_1116 | 270 |
| 498 | 3300035724 | Ga0373933_0000037 | Ga0373933_0000037_38749_39564 | 270 |
| 499 | 3300035724 | Ga0373933_0000185 | Ga0373933_0000185_4932_5744 | 270 |
| 500 | 3300035724 | Ga0373933_0080003 | Ga0373933_0080003_800_1612 | 270 |
| 501 | 3300035724 | Ga0373933_0350492 | Ga0373933_0350492_44_856 | 270 |
| 502 | 3300035725 | Ga0373947_0010599 | Ga0373947_0010599_2855_3667 | 270 |
| 503 | 3300036401 | Ga0373937_0000118 | Ga0373937_0000118_28205_29020 | 270 |
| 504 | 3300036401 | Ga0373937_0177342 | Ga0373937_0177342_74_886 | 270 |
| 505 | 3300037068 | Ga0373925_0005982 | Ga0373925_0005982_5032_5844 | 270 |
| 506 | 3300037418 | Ga0395900_0314832 | Ga0395900_0314832_362_1174 | 270 |
| 507 | 3300037466 | Ga0395898_0089251 | Ga0395898_0089251_223_1035 | 270 |
| 508 | 3300037471 | Ga0395905_0046632 | Ga0395905_0046632_1282_2094 | 270 |
| 509 | 3300039438 | Ga0436360_1120943 | Ga0436360_1120943_1004_1816 | 270 |
| 510 | 3300044694 | Ga0466963_0192721 | Ga0466963_0192721_452_1267 | 270 |
| 511 | 3300045976 | Ga0466967_0039460 | Ga0466967_0039460_505_1320 | 270 |
| 512 | 3300046454 | Ga0495592_0000649 | Ga0495592_0000649_9549_10364 | 270 |
| 513 | 3300046454 | Ga0495592_0013217 | Ga0495592_0013217_3424_4236 | 270 |
| 514 | 3300046454 | Ga0495592_0064660 | Ga0495592_0064660_1598_2410 | 270 |
| 515 | 3300046455 | Ga0495603_0000027 | Ga0495603_0000027_27944_28756 | 270 |
| 516 | 3300046455 | Ga0495603_0014796 | Ga0495603_0014796_2444_3256 | 270 |
| 517 | 3300046459 | Ga0495629_0000290 | Ga0495629_0000290_19795_20607 | 270 |
| 518 | 3300046459 | Ga0495629_0001487 | Ga0495629_0001487_8299_9114 | 270 |
| 519 | 3300046462 | Ga0495651_0000412 | Ga0495651_0000412_13761_14576 | 270 |
| 520 | 3300046462 | Ga0495651_0111187 | Ga0495651_0111187_1044_1856 | 270 |
| 521 | 3300046462 | Ga0495651_0233890 | Ga0495651_0233890_371_1183 | 270 |
| 522 | 3300046463 | Ga0495653_0000161 | Ga0495653_0000161_23345_24160 | 270 |
| 523 | 3300046463 | Ga0495653_0263568 | Ga0495653_0263568_171_983 | 270 |
| 524 | 3300046472 | Ga0495580_0000610 | Ga0495580_0000610_6605_7417 | 270 |
| 525 | 3300046473 | Ga0495582_0000157 | Ga0495582_0000157_29251_30063 | 270 |
| 526 | 3300046475 | Ga0495639_0000048 | Ga0495639_0000048_22790_23602 | 270 |
| 527 | 3300046476 | Ga0495662_0004308 | Ga0495662_0004308_1915_2727 | 270 |
| 528 | 3300046477 | Ga0495664_0010720 | Ga0495664_0010720_1615_2427 | 270 |
| 529 | 3300046477 | Ga0495664_0107515 | Ga0495664_0107515_71_883 | 270 |
| 530 | 3300046499 | Ga0495594_0000279 | Ga0495594_0000279_20819_21631 | 270 |
| 531 | 3300046511 | Ga0495608_0000337 | Ga0495608_0000337_8857_9672 | 270 |
| 532 | 3300046514 | Ga0495618_0061283 | Ga0495618_0061283_725_1540 | 270 |
| 533 | 3300046514 | Ga0495618_0134634 | Ga0495618_0134634_161_973 | 270 |
| 534 | 3300046516 | Ga0495628_0002406 | Ga0495628_0002406_13511_14326 | 270 |
| 535 | 3300046516 | Ga0495628_0071303 | Ga0495628_0071303_72_884 | 270 |
| 536 | 3300046517 | Ga0495630_0000846 | Ga0495630_0000846_14152_14964 | 270 |
| 537 | 3300046519 | Ga0495632_0197300 | Ga0495632_0197300_82_894 | 270 |
| 538 | 3300046523 | Ga0495644_0132675 | Ga0495644_0132675_37_849 | 270 |
| 539 | 3300046524 | Ga0495648_0003360 | Ga0495648_0003360_11771_12583 | 270 |
| 540 | 3300046525 | Ga0495663_0087627 | Ga0495663_0087627_82_894 | 270 |
| 541 | 3300046529 | Ga0495652_0011371 | Ga0495652_0011371_6728_7543 | 270 |
| 542 | 3300046529 | Ga0495652_0097007 | Ga0495652_0097007_404_1216 | 270 |
| 543 | 3300046531 | Ga0495665_0000165 | Ga0495665_0000165_2558_3370 | 270 |
| 544 | 3300046533 | Ga0495640_0002246 | Ga0495640_0002246_527_1339 | 270 |
| 545 | 3300046533 | Ga0495640_0004586 | Ga0495640_0004586_936_1751 | 270 |
| 546 | 3300046536 | Ga0495587_0000668 | Ga0495587_0000668_18971_19786 | 270 |
| 547 | 3300046539 | Ga0495621_0143659 | Ga0495621_0143659_29_841 | 270 |
| 548 | 3300046543 | Ga0495645_0042908 | Ga0495645_0042908_1336_2148 | 270 |
| 549 | 3300046557 | Ga0495622_0002823 | Ga0495622_0002823_3110_3922 | 270 |
| 550 | 3300046558 | Ga0495633_0123293 | Ga0495633_0123293_54_866 | 270 |
| 551 | 3300046558 | Ga0495633_0160908 | Ga0495633_0160908_134_946 | 270 |
| 552 | 3300046559 | Ga0495667_0000147 | Ga0495667_0000147_23083_23898 | 270 |
| 553 | 3300046559 | Ga0495667_0022715 | Ga0495667_0022715_893_1705 | 270 |
| 554 | 3300046615 | Ga0495656_0028915 | Ga0495656_0028915_1363_2175 | 270 |
| 555 | 3300046615 | Ga0495656_0039315 | Ga0495656_0039315_110_922 | 270 |
| 556 | 3300046616 | Ga0495668_0067542 | Ga0495668_0067542_1089_1901 | 270 |
| 557 | 3300046642 | Ga0495634_0001002 | Ga0495634_0001002_7378_8190 | 270 |
| 558 | 3300046642 | Ga0495634_0002287 | Ga0495634_0002287_13557_14372 | 270 |
| 559 | 3300046642 | Ga0495634_0022222 | Ga0495634_0022222_3502_4314 | 270 |
| 560 | 3300046648 | Ga0495611_0083809 | Ga0495611_0083809_576_1388 | 270 |
| 561 | 3300046663 | Ga0495635_0000094 | Ga0495635_0000094_3194_4009 | 270 |
| 562 | 3300046663 | Ga0495635_0004833 | Ga0495635_0004833_6433_7245 | 270 |
| 563 | 3300046674 | Ga0495588_0043477 | Ga0495588_0043477_1393_2205 | 270 |
| 564 | 3300046675 | Ga0495657_0001420 | Ga0495657_0001420_16695_17510 | 270 |
| 565 | 3300046675 | Ga0495657_0038595 | Ga0495657_0038595_74_886 | 270 |
| 566 | 3300046678 | Ga0495599_0000253 | Ga0495599_0000253_24551_25366 | 270 |
| 567 | 3300046678 | Ga0495599_0074852 | Ga0495599_0074852_735_1547 | 270 |
| 568 | 3300046678 | Ga0495599_0080076 | Ga0495599_0080076_742_1554 | 270 |
| 569 | 3300046679 | Ga0495623_0000768 | Ga0495623_0000768_3194_4009 | 270 |
| 570 | 3300046679 | Ga0495623_0234292 | Ga0495623_0234292_20_832 | 270 |
| 571 | 3300046680 | Ga0495646_0025386 | Ga0495646_0025386_2083_2898 | 270 |
| 572 | 3300046681 | Ga0495647_0001538 | Ga0495647_0001538_3262_4074 | 270 |
| 573 | 3300046683 | Ga0495658_0006333 | Ga0495658_0006333_115_927 | 270 |
| 574 | 3300046689 | Ga0495613_0007609 | Ga0495613_0007609_4813_5625 | 270 |
| 575 | 3300046689 | Ga0495613_0040692 | Ga0495613_0040692_715_1530 | 270 |
| 576 | 3300046690 | Ga0495624_0000380 | Ga0495624_0000380_19687_20499 | 270 |
| 577 | 3300046690 | Ga0495624_0169666 | Ga0495624_0169666_25_837 | 270 |
| 578 | 3300046694 | Ga0495649_0177557 | Ga0495649_0177557_145_957 | 270 |
| 579 | 3300046794 | Ga0495589_0073617 | Ga0495589_0073617_801_1613 | 270 |
| 580 | 3300046809 | Ga0495600_0001048 | Ga0495600_0001048_5835_6650 | 270 |
| 581 | 3300047315 | Ga0495581_0000233 | Ga0495581_0000233_7563_8375 | 270 |
| 582 | 3300047317 | Ga0495604_0000253 | Ga0495604_0000253_23495_24310 | 270 |
| 583 | 3300047317 | Ga0495604_0058514 | Ga0495604_0058514_1034_1846 | 270 |
| 584 | 3300047317 | Ga0495604_0299748 | Ga0495604_0299748_51_863 | 270 |
| 585 | 3300047318 | Ga0495636_0088637 | Ga0495636_0088637_287_1099 | 270 |
| 586 | 3300047319 | Ga0495674_0007183 | Ga0495674_0007183_3692_4507 | 270 |
| 587 | 3300047319 | Ga0495674_0015786 | Ga0495674_0015786_4312_5124 | 270 |
| 588 | 3300047322 | Ga0495680_0000406 | Ga0495680_0000406_23329_24144 | 270 |
| 589 | 3300047444 | Ga0495675_0000285 | Ga0495675_0000285_12360_13175 | 270 |
| 590 | 3300047445 | Ga0495677_0062624 | Ga0495677_0062624_313_1125 | 270 |
| 591 | 3300047471 | Ga0495684_0000184 | Ga0495684_0000184_20394_21209 | 270 |
| 592 | 3300047673 | Ga0495593_0000160 | Ga0495593_0000160_10511_11323 | 270 |
| 593 | 3300047673 | Ga0495593_0030812 | Ga0495593_0030812_1787_2602 | 270 |
| 594 | 3300047673 | Ga0495593_0149689 | Ga0495593_0149689_279_1091 | 270 |
| 595 | 3300048088 | Ga0495602_0001148 | Ga0495602_0001148_8507_9322 | 270 |
| 596 | 3300048088 | Ga0495602_0102948 | Ga0495602_0102948_218_1030 | 270 |
| 597 | 3300048903 | Ga0496100_0142552 | Ga0496100_0142552_422_1234 | 270 |
| 598 | 3300048903 | Ga0496100_0179529 | Ga0496100_0179529_85_897 | 270 |
| 599 | 3300048904 | Ga0496101_0037110 | Ga0496101_0037110_899_1711 | 270 |
| 600 | 3300048904 | Ga0496101_0164587 | Ga0496101_0164587_349_1161 | 270 |
| 601 | 3300048904 | Ga0496101_0378969 | Ga0496101_0378969_32_844 | 270 |
| 602 | 3300048905 | Ga0496102_0018206 | Ga0496102_0018206_891_1703 | 270 |
| 603 | 3300048905 | Ga0496102_0042443 | Ga0496102_0042443_1411_2223 | 270 |
| 604 | 3300048906 | Ga0496103_0091868 | Ga0496103_0091868_1037_1849 | 270 |
| 605 | 3300048907 | Ga0496104_0165522 | Ga0496104_0165522_1038_1850 | 270 |
| 606 | 3300048907 | Ga0496104_0221217 | Ga0496104_0221217_482_1294 | 270 |
| 607 | 3300048908 | Ga0496105_0160859 | Ga0496105_0160859_393_1205 | 270 |
| 608 | 3300048908 | Ga0496105_0238693 | Ga0496105_0238693_647_1459 | 270 |
| 609 | 3300048909 | Ga0496106_0064092 | Ga0496106_0064092_1297_2109 | 270 |
| 610 | 3300048909 | Ga0496106_0140391 | Ga0496106_0140391_134_946 | 270 |
| 611 | 3300048910 | Ga0496107_0063292 | Ga0496107_0063292_595_1407 | 270 |
| 612 | 3300048911 | Ga0496108_0194603 | Ga0496108_0194603_920_1732 | 270 |
| 613 | 3300048911 | Ga0496108_0394936 | Ga0496108_0394936_222_1034 | 270 |
| 614 | 3300048912 | Ga0496109_0027009 | Ga0496109_0027009_3956_4768 | 270 |
| 615 | 3300048912 | Ga0496109_0366220 | Ga0496109_0366220_66_878 | 270 |
| 616 | 3300048913 | Ga0496110_0021115 | Ga0496110_0021115_3505_4317 | 270 |
| 617 | 3300048913 | Ga0496110_0426188 | Ga0496110_0426188_337_1149 | 270 |
| 618 | 3300048914 | Ga0496111_0029084 | Ga0496111_0029084_1040_1852 | 270 |
| 619 | 3300048914 | Ga0496111_0104702 | Ga0496111_0104702_903_1715 | 270 |
| 620 | 3300048914 | Ga0496111_0108546 | Ga0496111_0108546_930_1805 | 270 |
| 621 | 3300048915 | Ga0496112_0003169 | Ga0496112_0003169_96_908 | 270 |
| 622 | 3300048916 | Ga0496113_0049307 | Ga0496113_0049307_2097_2909 | 270 |
| 623 | 3300048916 | Ga0496113_0206785 | Ga0496113_0206785_485_1297 | 270 |
| 624 | 3300048917 | Ga0496114_0189541 | Ga0496114_0189541_962_1774 | 270 |
| 625 | 3300048917 | Ga0496114_0312889 | Ga0496114_0312889_77_889 | 270 |
| 626 | 3300048917 | Ga0496114_0365027 | Ga0496114_0365027_95_907 | 270 |
| 627 | 3300048918 | Ga0496115_0006396 | Ga0496115_0006396_45_920 | 270 |
| 628 | 3300048918 | Ga0496115_0126494 | Ga0496115_0126494_571_1383 | 270 |
| 629 | 3300048918 | Ga0496115_0227205 | Ga0496115_0227205_79_891 | 270 |
| 630 | 3300048918 | Ga0496115_0371482 | Ga0496115_0371482_303_1115 | 270 |
| 631 | 3300048920 | Ga0496117_0034572 | Ga0496117_0034572_2395_3207 | 270 |
| 632 | 3300048924 | Ga0496121_0001658 | Ga0496121_0001658_6974_7786 | 270 |
| 633 | 3300048924 | Ga0496121_0006685 | Ga0496121_0006685_733_1545 | 270 |
| 634 | 3300048924 | Ga0496121_0009024 | Ga0496121_0009024_3055_3867 | 270 |
| 635 | 3300048924 | Ga0496121_0078979 | Ga0496121_0078979_77_895 | 270 |
| 636 | 3300048927 | Ga0496124_0080500 | Ga0496124_0080500_1846_2658 | 270 |
| 637 | 3300048929 | Ga0496126_0003507 | Ga0496126_0003507_14415_15227 | 270 |
| 638 | 3300048929 | Ga0496126_0017789 | Ga0496126_0017789_1263_2075 | 270 |
| 639 | 3300048929 | Ga0496126_0036640 | Ga0496126_0036640_3586_4398 | 270 |
| 640 | 3300048929 | Ga0496126_0045678 | Ga0496126_0045678_477_1289 | 270 |
| 641 | 3300048929 | Ga0496126_0106080 | Ga0496126_0106080_750_1562 | 270 |
| 642 | 3300048929 | Ga0496126_0309834 | Ga0496126_0309834_379_1191 | 270 |
| 643 | 3300049568 | Ga0501031_0000406 | Ga0501031_0000406_5630_6442 | 270 |
| 644 | 3300049568 | Ga0501031_0064668 | Ga0501031_0064668_521_1333 | 270 |
| 645 | 3300049569 | Ga0501032_0000228 | Ga0501032_0000228_5517_6329 | 270 |
| 646 | 3300049569 | Ga0501032_0044183 | Ga0501032_0044183_1080_1892 | 270 |
| 647 | 3300049570 | Ga0501033_0000914 | Ga0501033_0000914_2874_3686 | 270 |
| 648 | 3300049570 | Ga0501033_0002357 | Ga0501033_0002357_4729_5541 | 270 |
| 649 | 3300049571 | Ga0501034_0000175 | Ga0501034_0000175_63066_63878 | 270 |
| 650 | 3300049572 | Ga0501036_0000158 | Ga0501036_0000158_14938_15750 | 270 |
| 651 | 3300049572 | Ga0501036_0151018 | Ga0501036_0151018_712_1524 | 270 |
| 652 | 3300049573 | Ga0501037_0000126 | Ga0501037_0000126_32345_33157 | 270 |
| 653 | 3300049573 | Ga0501037_0002783 | Ga0501037_0002783_8931_9743 | 270 |
| 654 | 3300049574 | Ga0501038_0000034 | Ga0501038_0000034_1154_1966 | 270 |
| 655 | 3300049575 | Ga0501039_0002654 | Ga0501039_0002654_3214_4026 | 270 |
| 656 | 3300049575 | Ga0501039_0030639 | Ga0501039_0030639_496_1308 | 270 |
| 657 | 3300049577 | Ga0501041_0323146 | Ga0501041_0323146_133_945 | 270 |
| 658 | 3300049578 | Ga0501042_0058814 | Ga0501042_0058814_1903_2715 | 270 |
| 659 | 3300049579 | Ga0501043_0001288 | Ga0501043_0001288_19949_20761 | 270 |
| 660 | 3300049579 | Ga0501043_0004764 | Ga0501043_0004764_9318_10130 | 270 |
| 661 | 3300049580 | Ga0501046_0000575 | Ga0501046_0000575_18838_19650 | 270 |
| 662 | 3300049580 | Ga0501046_0015370 | Ga0501046_0015370_4079_4891 | 270 |
| 663 | 3300049581 | Ga0501047_0001252 | Ga0501047_0001252_15001_15813 | 270 |
| 664 | 3300049581 | Ga0501047_0298833 | Ga0501047_0298833_97_909 | 270 |
| 665 | 3300049581 | Ga0501047_0402198 | Ga0501047_0402198_152_964 | 270 |
| 666 | 3300049582 | Ga0501048_0001161 | Ga0501048_0001161_15985_16797 | 270 |
| 667 | 3300049583 | Ga0501067_0000898 | Ga0501067_0000898_2494_3306 | 270 |
| 668 | 3300049584 | Ga0501068_0007196 | Ga0501068_0007196_3055_3867 | 270 |
| 669 | 3300049584 | Ga0501068_0353752 | Ga0501068_0353752_78_890 | 270 |
| 670 | 3300049585 | Ga0501069_0121819 | Ga0501069_0121819_534_1346 | 270 |
| 671 | 3300049586 | Ga0501070_0090969 | Ga0501070_0090969_1408_2220 | 270 |
| 672 | 3300049586 | Ga0501070_0336450 | Ga0501070_0336450_109_921 | 270 |
| 673 | 3300049587 | Ga0501071_0036754 | Ga0501071_0036754_208_1020 | 270 |
| 674 | 3300049588 | Ga0501072_0002976 | Ga0501072_0002976_2700_3512 | 270 |
| 675 | 3300049589 | Ga0501073_0000035 | Ga0501073_0000035_18765_19577 | 270 |
| 676 | 3300049589 | Ga0501073_0257855 | Ga0501073_0257855_58_870 | 270 |
| 677 | 3300049590 | Ga0501074_0000266 | Ga0501074_0000266_16699_17511 | 270 |
| 678 | 3300049593 | Ga0501077_0180839 | Ga0501077_0180839_332_1144 | 270 |
| 679 | 3300049741 | Ga0501079_0014874 | Ga0501079_0014874_1958_2770 | 270 |
| 680 | 3300049741 | Ga0501079_0113725 | Ga0501079_0113725_894_1706 | 270 |
| 681 | 3300049742 | Ga0501080_0029763 | Ga0501080_0029763_2270_3082 | 270 |
| 682 | 3300049743 | Ga0501081_0215953 | Ga0501081_0215953_114_926 | 270 |
| 683 | 3300049744 | Ga0501083_0014090 | Ga0501083_0014090_3472_4284 | 270 |
| 684 | 3300049822 | Ga0501035_0000319 | Ga0501035_0000319_42661_43473 | 270 |
| 685 | 3300049822 | Ga0501035_0054147 | Ga0501035_0054147_2278_3090 | 270 |
| 686 | 3300049823 | Ga0501044_0000061 | Ga0501044_0000061_22852_23664 | 270 |
| 687 | 3300049823 | Ga0501044_0024642 | Ga0501044_0024642_4546_5358 | 270 |
| 688 | 3300049824 | Ga0501045_0020936 | Ga0501045_0020936_1759_2571 | 270 |
| 689 | 3300049824 | Ga0501045_0172501 | Ga0501045_0172501_729_1541 | 270 |
| 690 | 3300050507 | nmdc:mga05p37_744880_c1 | nmdc:mga05p37_744880_c1_155_967 | 270 |
| 691 | 3300050508 | nmdc:mga09592_175300_c1 | nmdc:mga09592_175300_c1_389_1201 | 270 |
| 692 | 3300050511 | nmdc:mga08y16_341191_c1 | nmdc:mga08y16_341191_c1_192_1004 | 270 |
| 693 | 3300053077 | Ga0495601_0345674 | Ga0495601_0345674_73_885 | 270 |
| 694 | 3300053080 | Ga0500635_0011127 | Ga0500635_0011127_1556_2368 | 270 |
| 695 | 3300053084 | Ga0495595_0000318 | Ga0495595_0000318_3893_4708 | 270 |
| 696 | 3300053085 | Ga0495619_0000209 | Ga0495619_0000209_18370_19185 | 270 |
| 697 | 3300053085 | Ga0495619_0302127 | Ga0495619_0302127_59_871 | 270 |
| 698 | 3300053094 | Ga0500566_0006355 | Ga0500566_0006355_887_1705 | 270 |
| 699 | 3300053102 | Ga0500554_051767 | Ga0500554_051767_296_1114 | 270 |
| 700 | 3300053119 | Ga0500595_006670 | Ga0500595_006670_1083_1895 | 270 |
| 701 | 3300053119 | Ga0500595_080797 | Ga0500595_080797_31_843 | 270 |
| 702 | 3300053122 | Ga0500608_000450 | Ga0500608_000450_14548_15366 | 270 |
| 703 | 3300053125 | Ga0500618_020987 | Ga0500618_020987_593_1411 | 270 |
| 704 | 3300053131 | Ga0500652_001471 | Ga0500652_001471_831_1649 | 270 |
| 705 | 3300053136 | Ga0500559_0000574 | Ga0500559_0000574_18170_18988 | 270 |
| 706 | 3300053148 | Ga0500590_053230 | Ga0500590_053230_1020_1838 | 270 |
| 707 | 3300053150 | Ga0500603_002047 | Ga0500603_002047_2588_3400 | 270 |
| 708 | 3300053156 | Ga0500622_0010112 | Ga0500622_0010112_3135_3953 | 270 |
| 709 | 3300053178 | Ga0500637_0030558 | Ga0500637_0030558_1674_2486 | 270 |
| 710 | 3300053730 | Ga0500645_033282 | Ga0500645_033282_453_1265 | 270 |
| 711 | 3300054114 | Ga0501084_0004354 | Ga0501084_0004354_255_1067 | 270 |
| 712 | 3300060353 | Ga0501082_0008155 | Ga0501082_0008155_3787_4599 | 270 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4op0-assembly2.cif.gz_B | crystal structure of biotin protein ligase (rv3279c) of mycobacterium tuberculosis, complexed with biotinyl-5'-amp | 0.8823 | 15 | 257 |
| 4xtw-assembly1.cif.gz_A | mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 46 with azide in place of 2'oh | 0.8814 | 15 | 254 |
| 4xu3-assembly1.cif.gz_A | mycobacterium tuberculosis biotin ligase complexed with bisubstrate inhibitor 90 that has an acyclic ether in place of the ribose | 0.8799 | 15 | 254 |
| 2deq-assembly1.cif.gz_A | crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, k111g mutation | 0.8724 | 1 | 258 |
| 2dkg-assembly1.cif.gz_A | crystal structure of biotin protein ligase from pyrococcus horikoshii ot3 in complex with biotinyl-5'-amp, pyrophosphate and mg(2+) | 0.8702 | 1 | 258 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ejfB02 | Mainly Beta;Roll;SH3 type barrels.; | 0.9528 | 230 | 255 | 2.30.30.100 |
| 2e65B02 | Mainly Beta;Roll;SH3 type barrels.; | 0.8945 | 216 | 254 | 2.30.30.100 |
| 4xu1B02 | Mainly Beta;Roll;SH3 type barrels.; | 0.8605 | 217 | 257 | 2.30.30.100 |
| 2e65B01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8365 | 1 | 214 | 3.30.930.10 |
| 3l1aB01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.835 | 15 | 214 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849E6C6-F1-model_v4 | Biotin--[acetyl-CoA-carboxylase] ligase (EC 6.3.4.15) | 0.9511 | 15 | 254 |
GO:0004077
GO:0005737 GO:0036211 |
| AF-A0A7V9PKU2-F1-model_v4 | deleted | 0.9425 | 11 | 256 |
|
| AF-A0A447CVK1-F1-model_v4 | biotin--[biotin carboxyl-carrier protein] ligase (EC 6.3.4.15) | 0.9386 | 2 | 256 |
GO:0004077
GO:0005737 GO:0036211 |
| AF-A0A0D7E8C1-F1-model_v4 | biotin--[biotin carboxyl-carrier protein] ligase (EC 6.3.4.15) | 0.9365 | 1 | 266 |
GO:0004077
GO:0005737 GO:0036211 |
| AF-A0A327JZY1-F1-model_v4 | biotin--[biotin carboxyl-carrier protein] ligase (EC 6.3.4.15) | 0.9344 | 11 | 261 |
GO:0004077
GO:0005737 GO:0036211 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar