F476755

General Info

Members Datasets Scaffolds Average Seq Length
711 363 1422 361

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10069314|Ga0070681_100693143
Length 349
Sequence MLYLLLYPWADQFQAFNLFRYITFRSGGAVVTALLISFVFGPQIIAWLKSKQGEGQPIRTDGPQSHLVRKKGTPTMGGFLILLALSVSTLLWADLADPYVWIVLFVTVAFGLIGFFDDYRKLTRRSHHGISARGKLLAYVMRQPLANSIAVPFLKNVLLNLGWFFLPFGVLVIAGASNAVNLTDGLDGLAIGPAMIAAGCFAFIAYVVGRADFSNYLQLHHVAGAGELAVFCAAMVGSGLGFLWFNAPPASVFMGDTGSLSIGAALGAIAIVTKHELVLAIVGGLFVLEAISVIVQVVSFKTTGQRVFRMAPLHHHFEQKGWGEAQIVIRFWIIAAILAIAGLATLKLR

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
123 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
198 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
211 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
215 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
244 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
247 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
268 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
315 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
322 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
337 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
338 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
339 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
342 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
343 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
344 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
345 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
346 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
351 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
352 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
353 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
354 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
355 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
356 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
357 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
358 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
359 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
360 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
361 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
362 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
363 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 0.14
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 0.14
Rhizoplane 3.38
Rhizosphere 86.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10069314 3300005458 Bacteria 3493
2 JGI24750J21931_1000838 3300002070 Bacteria 4250
3 JGI25159J45721_1016009 3300002987 Bacteria 1618
4 JGI25151J46595_10000322 3300003187 Bacteria 51965
5 rootH2_10010650 3300003320 Bacteria 8405
6 rootH2_10112849 3300003320 Bacteria 6824
7 Ga0070658_10008981 3300005327 Bacteria 8034
8 Ga0070676_10015589 3300005328 Bacteria 4195
9 Ga0070690_100000545 3300005330 Bacteria 18860
10 Ga0068869_100006528 3300005334 Bacteria 7405
11 Ga0068869_100008839 3300005334 Bacteria 6518
12 Ga0070666_10006691 3300005335 Bacteria 7092
13 Ga0070680_100001616 3300005336 Bacteria 16482
14 Ga0070680_100013279 3300005336 Bacteria 6414
15 Ga0070680_100021600 3300005336 Bacteria 5118
16 Ga0070680_100042301 3300005336 Bacteria 3696
17 Ga0070680_100102652 3300005336 Bacteria 2375
18 Ga0070682_100025901 3300005337 Bacteria 3504
19 Ga0068868_100005849 3300005338 Bacteria 8670
20 Ga0070660_100001055 3300005339 Bacteria 18546
21 Ga0070660_100045376 3300005339 Bacteria 3364
22 Ga0070689_100001025 3300005340 Bacteria 17546
23 Ga0070691_10000109 3300005341 Bacteria 24574
24 Ga0070691_10000961 3300005341 Bacteria 11764
25 Ga0070687_100002739 3300005343 Bacteria 6682
26 Ga0070661_100006555 3300005344 Bacteria 8028
27 Ga0070692_10001523 3300005345 Bacteria 8492
28 Ga0070668_100000323 3300005347 Bacteria 31536
29 Ga0070669_100023518 3300005353 Bacteria 4411
30 Ga0070675_100051976 3300005354 Bacteria 3368
31 Ga0070671_100001054 3300005355 Bacteria 20321
32 Ga0070671_100042353 3300005355 Bacteria 3784
33 Ga0070674_100001030 3300005356 Bacteria 14566
34 Ga0070673_100001383 3300005364 Bacteria 14186
35 Ga0070688_100000138 3300005365 Bacteria 39542
36 Ga0070659_100000915 3300005366 Bacteria 21598
37 Ga0070659_100043396 3300005366 Bacteria 3517
38 Ga0070667_100002638 3300005367 Bacteria 15527
39 Ga0070703_10000738 3300005406 Bacteria 10919
40 Ga0070709_10000884 3300005434 Bacteria 16793
41 Ga0070709_10033679 3300005434 Bacteria 3100
42 Ga0070709_10088251 3300005434 Bacteria 2040
43 Ga0070714_100011691 3300005435 Bacteria 6971
44 Ga0070714_100013118 3300005435 Bacteria 6633
45 Ga0070714_100172541 3300005435 Bacteria 1963
46 Ga0070714_100180187 3300005435 Bacteria 1922
47 Ga0070713_100005717 3300005436 Bacteria 8539
48 Ga0070713_100092305 3300005436 Bacteria 2606
49 Ga0070713_100111360 3300005436 Bacteria 2387
50 Ga0070710_10006960 3300005437 Bacteria 5454
51 Ga0070710_10010173 3300005437 Bacteria 4614
52 Ga0070710_10166391 3300005437 Bacteria 1371
53 Ga0070701_10003317 3300005438 Bacteria 6350
54 Ga0070711_100005929 3300005439 Bacteria 7334
55 Ga0070711_100011564 3300005439 Bacteria 5488
56 Ga0070711_100027625 3300005439 Bacteria 3727
57 Ga0070711_100037756 3300005439 Bacteria 3242
58 Ga0070711_100318118 3300005439 Bacteria 1242
59 Ga0070705_100000774 3300005440 Bacteria 18085
60 Ga0070705_100001100 3300005440 Bacteria 14961
61 Ga0070700_100001594 3300005441 Bacteria 11315
62 Ga0070694_100000159 3300005444 Bacteria 34656
63 Ga0070694_100007145 3300005444 Bacteria 6798
64 Ga0070708_100265586 3300005445 Bacteria 1614
65 Ga0070663_100001241 3300005455 Bacteria 14017
66 Ga0070663_100060792 3300005455 Bacteria 2719
67 Ga0070678_100001723 3300005456 Bacteria 11744
68 Ga0070662_100019876 3300005457 Bacteria 4568
69 Ga0070681_10009920 3300005458 Bacteria 9386
70 Ga0070681_10016572 3300005458 Bacteria 7358
71 Ga0070681_10042284 3300005458 Bacteria 4567
72 Ga0070681_10125853 3300005458 Bacteria 2495
73 Ga0070681_10297928 3300005458 Bacteria 1523
74 Ga0070685_10026736 3300005466 Bacteria 3182
75 Ga0070706_100047764 3300005467 Bacteria 3951
76 Ga0070707_100015032 3300005468 Bacteria 7263
77 Ga0070698_100001477 3300005471 Bacteria 26108
78 Ga0070698_100043566 3300005471 Bacteria 4600
79 Ga0070698_100165789 3300005471 Bacteria 2152
80 Ga0070698_100333946 3300005471 Bacteria 1447
81 Ga0070699_100001258 3300005518 Bacteria 23358
82 Ga0070699_100014379 3300005518 Bacteria 6804
83 Ga0070699_100065810 3300005518 Bacteria 3146
84 Ga0070679_100012896 3300005530 Bacteria 8002
85 Ga0070679_100017530 3300005530 Bacteria 6930
86 Ga0070679_100154298 3300005530 Bacteria 2272
87 Ga0070679_100192635 3300005530 Bacteria 2007
88 Ga0070679_100274030 3300005530 Bacteria 1641
89 Ga0070679_100293304 3300005530 Bacteria 1578
90 Ga0070684_100006001 3300005535 Bacteria 9359
91 Ga0070684_100326129 3300005535 Bacteria 1411
92 Ga0070697_100005090 3300005536 Bacteria 10098
93 Ga0070697_100144271 3300005536 Bacteria 2003
94 Ga0068853_100000477 3300005539 Bacteria 27292
95 Ga0070672_100003489 3300005543 Bacteria 10191
96 Ga0070695_100001335 3300005545 Bacteria 13660
97 Ga0070695_100001605 3300005545 Bacteria 12655
98 Ga0070696_100000649 3300005546 Bacteria 22225
99 Ga0070696_100001417 3300005546 Bacteria 15660
100 Ga0070693_100000188 3300005547 Bacteria 28560
101 Ga0070693_100140879 3300005547 Bacteria 1518
102 Ga0070665_100017657 3300005548 Bacteria 7165
103 Ga0070665_100041621 3300005548 Bacteria 4619
104 Ga0070665_100455566 3300005548 Bacteria 1289
105 Ga0070704_100017707 3300005549 Bacteria 4539
106 Ga0070704_100032102 3300005549 Bacteria 3538
107 Ga0070704_100035700 3300005549 Bacteria 3382
108 Ga0070704_100177580 3300005549 Bacteria 1700
109 Ga0068855_100002324 3300005563 Bacteria 23491
110 Ga0068855_100313265 3300005563 Bacteria 1736
111 Ga0070664_100001729 3300005564 Bacteria 17471
112 Ga0070664_100216931 3300005564 Bacteria 1711
113 Ga0068857_100003178 3300005577 Bacteria 13624
114 Ga0068857_100073594 3300005577 Bacteria 3044
115 Ga0068857_100161434 3300005577 Bacteria 2034
116 Ga0068857_100350473 3300005577 Bacteria 1367
117 Ga0068854_100001073 3300005578 Bacteria 16459
118 Ga0068854_100092724 3300005578 Bacteria 2250
119 Ga0068856_100001302 3300005614 Bacteria 26252
120 Ga0068856_100085810 3300005614 Bacteria 3128
121 Ga0070702_100000205 3300005615 Bacteria 19426
122 Ga0068852_100006477 3300005616 Bacteria 8461
123 Ga0068859_100025733 3300005617 Bacteria 5901
124 Ga0068859_100033872 3300005617 Bacteria 5128
125 Ga0068866_10003307 3300005718 Bacteria 6621
126 Ga0068861_100000196 3300005719 Bacteria 32472
127 Ga0068861_100046006 3300005719 Bacteria 3289
128 Ga0068863_100023321 3300005841 Bacteria 5912
129 Ga0068863_100043839 3300005841 Bacteria 4247
130 Ga0068858_100001779 3300005842 Bacteria 21986
131 Ga0068860_100000872 3300005843 Bacteria 33488
132 Ga0068860_100006253 3300005843 Bacteria 11962
133 Ga0068862_100002619 3300005844 Bacteria 15837
134 Ga0068862_100015087 3300005844 Bacteria 6419
135 Ga0081455_10000028 3300005937 Bacteria 155778
136 Ga0081455_10001989 3300005937 Bacteria 24409
137 Ga0081455_10002009 3300005937 Bacteria 24312
138 Ga0081455_10075662 3300005937 Bacteria 2776
139 Ga0081538_10032566 3300005981 Bacteria 3490
140 Ga0081540_1000060 3300005983 Bacteria 119707
141 Ga0081540_1003639 3300005983 Bacteria 12090
142 Ga0081540_1005968 3300005983 Bacteria 8971
143 Ga0070717_10000560 3300006028 Bacteria 23650
144 Ga0070717_10041974 3300006028 Bacteria 3731
145 Ga0070717_10095327 3300006028 Bacteria 2519
146 Ga0075365_10010665 3300006038 Bacteria 5366
147 Ga0075368_10028284 3300006042 Bacteria 2165
148 Ga0075363_100010173 3300006048 Bacteria 4450
149 Ga0075364_10001857 3300006051 Bacteria 11717
150 Ga0070715_10000455 3300006163 Bacteria 10572
151 Ga0070716_100001528 3300006173 Bacteria 10356
152 Ga0070712_100011256 3300006175 Bacteria 5666
153 Ga0070712_100016855 3300006175 Bacteria 4724
154 Ga0070712_100075587 3300006175 Bacteria 2423
155 Ga0075367_10001325 3300006178 Bacteria 10500
156 Ga0075367_10011745 3300006178 Bacteria 4647
157 Ga0068871_100009843 3300006358 Bacteria 6940
158 Ga0068871_100067054 3300006358 Bacteria 2943
159 Ga0075428_100008023 3300006844 Bacteria 11716
160 Ga0075428_100056280 3300006844 Bacteria 4308
161 Ga0075430_100130844 3300006846 Bacteria 2091
162 Ga0075431_100004173 3300006847 Bacteria 14131
163 Ga0075431_100026694 3300006847 Bacteria 5923
164 Ga0075431_100031095 3300006847 Bacteria 5498
165 Ga0075431_100073702 3300006847 Bacteria 3522
166 Ga0075433_10008265 3300006852 Bacteria 8293
167 Ga0075433_10022191 3300006852 Bacteria 5328
168 Ga0075434_100001646 3300006871 Bacteria 19020
169 Ga0075434_100049658 3300006871 Bacteria 4166
170 Ga0075434_100382652 3300006871 Bacteria 1428
171 Ga0075429_100020985 3300006880 Bacteria 5667
172 Ga0075429_100022660 3300006880 Bacteria 5445
173 Ga0075429_100052570 3300006880 Bacteria 3545
174 Ga0068865_100001326 3300006881 Bacteria 14415
175 Ga0075436_100019703 3300006914 Bacteria 4625
176 Ga0075436_100027136 3300006914 Bacteria 3942
177 Ga0097620_100025734 3300006931 Bacteria 5901
178 Ga0097620_100033870 3300006931 Bacteria 5128
179 Ga0075435_100026374 3300007076 Bacteria 4532
180 Ga0075435_100106976 3300007076 Bacteria 2323
181 Ga0105240_10056163 3300009093 Bacteria 4927
182 Ga0105240_10269194 3300009093 Bacteria 1962
183 Ga0111539_10015556 3300009094 Bacteria 9458
184 Ga0111539_10048481 3300009094 Bacteria 5071
185 Ga0111539_10058017 3300009094 Bacteria 4594
186 Ga0111539_10162510 3300009094 Bacteria 2611
187 Ga0105247_10002044 3300009101 Bacteria 13970
188 Ga0105247_10029304 3300009101 Bacteria 3334
189 Ga0105247_10030975 3300009101 Bacteria 3244
190 Ga0114129_10005905 3300009147 Bacteria 17321
191 Ga0114129_10088933 3300009147 Bacteria 4282
192 Ga0114129_10143068 3300009147 Bacteria 3277
193 Ga0114129_10241304 3300009147 Bacteria 2429
194 Ga0114129_10773022 3300009147 Bacteria 1227
195 Ga0105243_10002388 3300009148 Bacteria 15736
196 Ga0105241_10006277 3300009174 Bacteria 8763
197 Ga0105242_10001841 3300009176 Bacteria 16658
198 Ga0105237_10002959 3300009545 Bacteria 20556
199 Ga0105238_10016025 3300009551 Bacteria 7581
200 Ga0105238_10022211 3300009551 Bacteria 6469
201 Ga0105249_10005201 3300009553 Bacteria 11228
202 Ga0105249_10005964 3300009553 Bacteria 10558
203 Ga0105028_100214 3300009993 Bacteria 6306
204 Ga0099796_10047668 3300010159 Bacteria 1475
205 Ga0105239_10014169 3300010375 Bacteria 8846
206 Ga0105239_10114434 3300010375 Bacteria 2992
207 Ga0157371_10005468 3300013102 Bacteria 10709
208 Ga0157370_10004490 3300013104 Bacteria 15991
209 Ga0157370_10004646 3300013104 Bacteria 15692
210 Ga0157370_10068142 3300013104 Bacteria 3363
211 Ga0157369_10013096 3300013105 Bacteria 9386
212 Ga0157369_10020301 3300013105 Bacteria 7425
213 Ga0157369_10058245 3300013105 Bacteria 4167
214 Ga0157378_10002206 3300013297 Bacteria 17281
215 Ga0163162_10002752 3300013306 Bacteria 16697
216 Ga0157372_10003944 3300013307 Bacteria 15940
217 Ga0157372_10004421 3300013307 Bacteria 14988
218 Ga0157372_10005907 3300013307 Bacteria 13032
219 Ga0157372_10017772 3300013307 Bacteria 7634
220 Ga0157372_10019499 3300013307 Bacteria 7313
221 Ga0157372_10046507 3300013307 Bacteria 4818
222 Ga0157375_10046242 3300013308 Bacteria 4241
223 Ga0157380_10114829 3300014326 Bacteria 2270
224 Ga0157380_10214665 3300014326 Bacteria 1717
225 Ga0157379_10010073 3300014968 Bacteria 8239
226 Ga0157376_10000823 3300014969 Bacteria 20317
227 Ga0163161_10002941 3300017792 Bacteria 12068
228 Ga0163161_10166518 3300017792 Bacteria 1683
229 Ga0213872_10000522 3300021361 Bacteria 30024
230 Ga0213872_10010762 3300021361 Bacteria 4344
231 Ga0213872_10012233 3300021361 Bacteria 4043
232 Ga0213872_10042325 3300021361 Bacteria 2077
233 Ga0213872_10042412 3300021361 Bacteria 2075
234 Ga0213876_10001035 3300021384 Bacteria 17965
235 Ga0213875_10000364 3300021388 Bacteria 42225
236 Ga0213875_10000568 3300021388 Bacteria 30109
237 Ga0213871_10010104 3300021441 Bacteria 2132
238 Ga0213871_10013160 3300021441 Bacteria 1938
239 Ga0209148_1001047 3300025254 Bacteria 17118
240 Ga0209455_1000278 3300025272 Bacteria 56010
241 Ga0209130_1001314 3300025284 Bacteria 16988
242 Ga0209025_1001048 3300025294 Bacteria 40501
243 Ga0209564_1033334 3300025295 Bacteria 1534
244 Ga0209758_1000118 3300025297 Bacteria 195889
245 Ga0209758_1004898 3300025297 Bacteria 10766
246 Ga0209758_1008576 3300025297 Bacteria 6580
247 Ga0207426_1000256 3300025302 Bacteria 115405
248 Ga0207426_1019907 3300025302 Bacteria 2340
249 Ga0209257_1001036 3300025304 Bacteria 37117
250 Ga0207653_10046254 3300025885 Bacteria 1438
251 Ga0207692_10024990 3300025898 Bacteria 2785
252 Ga0207692_10033094 3300025898 Bacteria 2490
253 Ga0207692_10141969 3300025898 Bacteria 1367
254 Ga0207710_10001172 3300025900 Bacteria 13328
255 Ga0207710_10035892 3300025900 Bacteria 2183
256 Ga0207688_10002512 3300025901 Bacteria 9888
257 Ga0207680_10090152 3300025903 Bacteria 1948
258 Ga0207647_10008374 3300025904 Bacteria 7419
259 Ga0207699_10001135 3300025906 Bacteria 12602
260 Ga0207699_10005261 3300025906 Bacteria 6194
261 Ga0207699_10043721 3300025906 Bacteria 2604
262 Ga0207645_10005698 3300025907 Bacteria 8999
263 Ga0207705_10000611 3300025909 Bacteria 29892
264 Ga0207705_10050274 3300025909 Bacteria 3001
265 Ga0207654_10009164 3300025911 Bacteria 5018
266 Ga0207707_10001384 3300025912 Bacteria 22525
267 Ga0207707_10009542 3300025912 Bacteria 8418
268 Ga0207707_10056261 3300025912 Bacteria 3422
269 Ga0207707_10115572 3300025912 Bacteria 2345
270 Ga0207707_10150641 3300025912 Bacteria 2034
271 Ga0207707_10246541 3300025912 Bacteria 1552
272 Ga0207707_10374957 3300025912 Bacteria 1224
273 Ga0207695_10011770 3300025913 Bacteria 10570
274 Ga0207695_10042772 3300025913 Bacteria 4833
275 Ga0207695_10193658 3300025913 Bacteria 1950
276 Ga0207693_10000313 3300025915 Bacteria 45228
277 Ga0207693_10003314 3300025915 Bacteria 13780
278 Ga0207693_10096675 3300025915 Bacteria 2315
279 Ga0207663_10000796 3300025916 Bacteria 14148
280 Ga0207663_10027755 3300025916 Bacteria 3304
281 Ga0207663_10100610 3300025916 Bacteria 1940
282 Ga0207663_10100699 3300025916 Bacteria 1940
283 Ga0207663_10162572 3300025916 Bacteria 1578
284 Ga0207660_10042548 3300025917 Bacteria 3189
285 Ga0207660_10042581 3300025917 Bacteria 3188
286 Ga0207660_10050840 3300025917 Bacteria 2944
287 Ga0207662_10001471 3300025918 Bacteria 11439
288 Ga0207657_10000112 3300025919 Bacteria 79849
289 Ga0207657_10000815 3300025919 Bacteria 32909
290 Ga0207649_10002140 3300025920 Bacteria 11182
291 Ga0207649_10012726 3300025920 Bacteria 4677
292 Ga0207652_10002462 3300025921 Bacteria 15598
293 Ga0207652_10017420 3300025921 Bacteria 5879
294 Ga0207652_10064208 3300025921 Bacteria 3177
295 Ga0207652_10143941 3300025921 Bacteria 2132
296 Ga0207652_10237183 3300025921 Bacteria 1644
297 Ga0207646_10006025 3300025922 Bacteria 12630
298 Ga0207646_10025801 3300025922 Bacteria 5373
299 Ga0207694_10011426 3300025924 Bacteria 6700
300 Ga0207694_10030218 3300025924 Bacteria 4137
301 Ga0207650_10075996 3300025925 Bacteria 2537
302 Ga0207659_10010504 3300025926 Bacteria 5820
303 Ga0207687_10004074 3300025927 Bacteria 9796
304 Ga0207700_10017076 3300025928 Bacteria 4836
305 Ga0207700_10078563 3300025928 Bacteria 2567
306 Ga0207700_10115108 3300025928 Bacteria 2171
307 Ga0207700_10232702 3300025928 Bacteria 1567
308 Ga0207664_10027840 3300025929 Bacteria 4290
309 Ga0207664_10091478 3300025929 Bacteria 2495
310 Ga0207664_10203149 3300025929 Bacteria 1711
311 Ga0207644_10078146 3300025931 Bacteria 2438
312 Ga0207690_10002166 3300025932 Bacteria 12002
313 Ga0207690_10027815 3300025932 Bacteria 3577
314 Ga0207690_10063786 3300025932 Bacteria 2513
315 Ga0207690_10283266 3300025932 Bacteria 1291
316 Ga0207706_10000831 3300025933 Bacteria 32015
317 Ga0207686_10008320 3300025934 Bacteria 5596
318 Ga0207670_10010280 3300025936 Bacteria 5382
319 Ga0207669_10040421 3300025937 Bacteria 2705
320 Ga0207665_10000565 3300025939 Bacteria 24973
321 Ga0207665_10123515 3300025939 Bacteria 1831
322 Ga0207691_10000623 3300025940 Bacteria 35146
323 Ga0207711_10047762 3300025941 Bacteria 3661
324 Ga0207689_10024023 3300025942 Bacteria 5113
325 Ga0207689_10033128 3300025942 Bacteria 4293
326 Ga0207661_10065820 3300025944 Bacteria 2943
327 Ga0207679_10272539 3300025945 Bacteria 1448
328 Ga0207667_10027474 3300025949 Bacteria 6193
329 Ga0207651_10003894 3300025960 Bacteria 7408
330 Ga0207712_10005840 3300025961 Bacteria 7758
331 Ga0207712_10006060 3300025961 Bacteria 7628
332 Ga0207668_10004522 3300025972 Bacteria 8179
333 Ga0207668_10335772 3300025972 Bacteria 1259
334 Ga0207640_10004889 3300025981 Bacteria 7282
335 Ga0207658_10006904 3300025986 Bacteria 7731
336 Ga0207658_10081453 3300025986 Bacteria 2482
337 Ga0207677_10038570 3300026023 Bacteria 3134
338 Ga0207703_10015180 3300026035 Bacteria 6010
339 Ga0207639_10005657 3300026041 Bacteria 8459
340 Ga0207639_10184842 3300026041 Bacteria 1776
341 Ga0207678_10000086 3300026067 Bacteria 76696
342 Ga0207708_10002960 3300026075 Bacteria 12517
343 Ga0207702_10013420 3300026078 Bacteria 6811
344 Ga0207702_10084239 3300026078 Bacteria 2768
345 Ga0207641_10008810 3300026088 Bacteria 8333
346 Ga0207641_10033633 3300026088 Bacteria 4259
347 Ga0207648_10068154 3300026089 Bacteria 3100
348 Ga0207676_10023761 3300026095 Bacteria 4528
349 Ga0207676_10158426 3300026095 Bacteria 1959
350 Ga0207674_10003298 3300026116 Bacteria 19855
351 Ga0207675_100000111 3300026118 Bacteria 66086
352 Ga0207683_10000120 3300026121 Bacteria 64461
353 Ga0207698_10035109 3300026142 Bacteria 3664
354 Ga0209813_10002716 3300027866 Bacteria 4076
355 Ga0209813_10062136 3300027866 Bacteria 1194
356 Ga0207428_10109023 3300027907 Bacteria 2132
357 Ga0268266_10002921 3300028379 Bacteria 17677
358 Ga0268266_10069557 3300028379 Bacteria 3050
359 Ga0268265_10161166 3300028380 Bacteria 1905
360 Ga0268264_10010894 3300028381 Bacteria 7512
361 Ga0265337_1003396 3300028556 Bacteria 6915
362 Ga0265318_10007334 3300028577 Bacteria 4992
363 Ga0265338_10007502 3300028800 Bacteria 13509
364 Ga0265338_10013718 3300028800 Bacteria 9114
365 Ga0265324_10002634 3300029957 Bacteria 8991
366 Ga0265330_10085312 3300031235 Bacteria 1358
367 Ga0265332_10006311 3300031238 Bacteria 5389
368 Ga0265332_10016725 3300031238 Bacteria 3237
369 Ga0265328_10001788 3300031239 Bacteria 9801
370 Ga0265320_10003600 3300031240 Bacteria 10356
371 Ga0265320_10032282 3300031240 Bacteria 2683
372 Ga0265325_10022538 3300031241 Bacteria 3449
373 Ga0265340_10000319 3300031247 Bacteria 25435
374 Ga0265340_10003799 3300031247 Bacteria 8509
375 Ga0265331_10000156 3300031250 Bacteria 87128
376 Ga0265331_10002640 3300031250 Bacteria 12017
377 Ga0265331_10002733 3300031250 Bacteria 11750
378 Ga0265331_10002902 3300031250 Bacteria 11329
379 Ga0265327_10000297 3300031251 Bacteria 96213
380 Ga0265327_10000543 3300031251 Bacteria 64532
381 Ga0265327_10020336 3300031251 Bacteria 4049
382 Ga0265316_10052395 3300031344 Bacteria 3202
383 Ga0265316_10061570 3300031344 Bacteria 2914
384 Ga0307513_10048697 3300031456 Bacteria 4597
385 Ga0265313_10000913 3300031595 Bacteria 29513
386 Ga0265313_10001440 3300031595 Bacteria 22235
387 Ga0265313_10001587 3300031595 Bacteria 21094
388 Ga0265313_10006326 3300031595 Bacteria 8425
389 Ga0265313_10039421 3300031595 Bacteria 2343
390 Ga0265314_10003764 3300031711 Bacteria 14507
391 Ga0265314_10007122 3300031711 Bacteria 9747
392 Ga0265314_10007521 3300031711 Bacteria 9441
393 Ga0265314_10105106 3300031711 Bacteria 1806
394 Ga0265342_10018018 3300031712 Bacteria 4583
395 Ga0316576_10182422 3300031727 Bacteria 1583
396 Ga0316578_10097282 3300031728 Bacteria 1763
397 Ga0307405_10340446 3300031731 Bacteria 1153
398 Ga0373934_0023656 3300035086 Bacteria 2374
399 Ga0373940_0039470 3300035088 Bacteria 1292
400 Ga0373949_0001990 3300035090 Bacteria 5461
401 Ga0373932_0008825 3300035112 Bacteria 2413
402 Ga0373939_0000816 3300035114 Bacteria 7695
403 Ga0373941_0006433 3300035115 Bacteria 2831
404 Ga0373941_0016386 3300035115 Bacteria 2013
405 Ga0373953_0006842 3300035117 Bacteria 3783
406 Ga0373953_0045262 3300035117 Bacteria 1763
407 Ga0373954_0033397 3300035118 Bacteria 2381
408 Ga0373956_0080342 3300035119 Bacteria 1496
409 Ga0373960_0001630 3300035121 Bacteria 5014
410 Ga0373943_0029155 3300035170 Bacteria 2606
411 Ga0373955_0114047 3300035172 Bacteria 1565
412 Ga0373962_0007067 3300035242 Bacteria 2742
413 Ga0316574_0036442 3300035398 Bacteria 3011
414 Ga0373931_0004913 3300035691 Bacteria 6147
415 Ga0373931_0020651 3300035691 Bacteria 3297
416 Ga0373931_0255950 3300035691 Bacteria 1066
417 Ga0373935_0012331 3300035692 Bacteria 5143
418 Ga0373933_0031028 3300035724 Bacteria 3098
419 Ga0373947_0005812 3300035725 Bacteria 7193
420 Ga0373947_0015921 3300035725 Bacteria 4320
421 Ga0373937_0000540 3300036401 Bacteria 33623
422 Ga0373937_0009309 3300036401 Bacteria 8528
423 Ga0373937_0009654 3300036401 Bacteria 8403
424 Ga0373937_0066603 3300036401 Bacteria 3317
425 Ga0373937_0499738 3300036401 Bacteria 1155
426 Ga0316584_0021379 3300036712 Bacteria 4702
427 Ga0316584_0099391 3300036712 Bacteria 2179
428 Ga0373925_0002418 3300037068 Bacteria 14974
429 Ga0395899_0039525 3300037312 Bacteria 3531
430 Ga0395900_0015652 3300037418 Bacteria 7732
431 Ga0395900_0113947 3300037418 Bacteria 2775
432 Ga0395898_0300389 3300037466 Bacteria 1532
433 Ga0395905_0002147 3300037471 Bacteria 22373
434 Ga0395905_0175560 3300037471 Bacteria 2012
435 Ga0436364_0067731 3300037853 Bacteria 42277
436 Ga0436364_0639582 3300037853 Bacteria 14262
437 Ga0395901_0008188 3300038443 Bacteria 10567
438 Ga0400483_055840 3300039062 Bacteria 4269
439 Ga0400483_110392 3300039062 Bacteria 37401
440 Ga0400483_151200 3300039062 Bacteria 17559
441 Ga0400483_184879 3300039062 Bacteria 6517
442 Ga0400483_198838 3300039062 Bacteria 2660
443 Ga0436365_0229005 3300039437 Bacteria 20037
444 Ga0436365_0457441 3300039437 Bacteria 3699
445 Ga0436365_1325603 3300039437 Bacteria 1670
446 Ga0436365_1712708 3300039437 Bacteria 68148
447 Ga0436365_1888495 3300039437 Bacteria 1202
448 Ga0436360_0040490 3300039438 Bacteria 5741
449 Ga0436361_0064010 3300039447 Bacteria 1867
450 Ga0436361_0199013 3300039447 Bacteria 2151
451 Ga0436361_0351574 3300039447 Bacteria 5016
452 Ga0436361_0358253 3300039447 Bacteria 1994
453 Ga0436361_0814479 3300039447 Bacteria 4151
454 Ga0436361_1182689 3300039447 Bacteria 35500
455 Ga0436363_0082910 3300039450 Bacteria 4465
456 Ga0436363_0912598 3300039450 Bacteria 1904
457 Ga0436362_0291175 3300039453 Bacteria 2572
458 Ga0436362_0473767 3300039453 Bacteria 2629
459 Ga0436362_1067723 3300039453 Bacteria 7427
460 Ga0436362_1083403 3300039453 Bacteria 2315
461 Ga0436362_1095303 3300039453 Bacteria 2458
462 Ga0439448_0041596 3300042005 Bacteria 1488
463 Ga0439440_0013740 3300042993 Bacteria 1741
464 Ga0453683_0017308 3300044673 Bacteria 4643
465 Ga0453684_0000062 3300044712 Bacteria 487590
466 Ga0453684_0000071 3300044712 Bacteria 448904
467 Ga0453684_0028882 3300044712 Bacteria 7894
468 Ga0453684_0039359 3300044712 Bacteria 6445
469 Ga0453684_0081616 3300044712 Bacteria 4032
470 Ga0466960_0070512 3300044901 Bacteria 1739
471 Ga0451576_0005756 3300045051 Bacteria 15432
472 Ga0451576_0014949 3300045051 Bacteria 8620
473 Ga0451576_0047602 3300045051 Bacteria 4507
474 Ga0451576_0053851 3300045051 Bacteria 4213
475 Ga0466958_0000103 3300045836 Bacteria 26961
476 Ga0495603_0000690 3300046455 Bacteria 19141
477 Ga0495603_0158632 3300046455 Bacteria 1312
478 Ga0495629_0019650 3300046459 Bacteria 4823
479 Ga0495629_0248872 3300046459 Bacteria 1223
480 Ga0495641_0017633 3300046461 Bacteria 3713
481 Ga0495639_0004560 3300046475 Bacteria 5939
482 Ga0495610_0048438 3300046512 Bacteria 2086
483 Ga0495652_0074354 3300046529 Bacteria 2826
484 Ga0495665_0025230 3300046531 Bacteria 3193
485 Ga0495640_0069595 3300046533 Bacteria 2367
486 Ga0495586_0002921 3300046535 Bacteria 9221
487 Ga0495587_0084592 3300046536 Bacteria 1837
488 Ga0495622_0005959 3300046557 Bacteria 5664
489 Ga0495667_0106891 3300046559 Bacteria 1808
490 Ga0495634_0014400 3300046642 Bacteria 5704
491 Ga0495635_0045185 3300046663 Bacteria 3039
492 Ga0495588_0000969 3300046674 Bacteria 12540
493 Ga0495657_0109608 3300046675 Bacteria 1751
494 Ga0495658_0000923 3300046683 Bacteria 15683
495 Ga0495676_0034205 3300047321 Bacteria 4267
496 Ga0495593_0003109 3300047673 Bacteria 9989
497 Ga0496100_0009697 3300048903 Bacteria 5417
498 Ga0496100_0299803 3300048903 Bacteria 1203
499 Ga0496102_0011444 3300048905 Bacteria 7650
500 Ga0496104_0003861 3300048907 Bacteria 12964
501 Ga0496104_0010979 3300048907 Bacteria 8103
502 Ga0496105_0019762 3300048908 Bacteria 5435
503 Ga0496105_0069631 3300048908 Bacteria 2907
504 Ga0496106_0002044 3300048909 Bacteria 15165
505 Ga0496106_0077617 3300048909 Bacteria 2547
506 Ga0496107_0018779 3300048910 Bacteria 4872
507 Ga0496108_0001756 3300048911 Bacteria 17236
508 Ga0496108_0193563 3300048911 Bacteria 1763
509 Ga0496109_0027625 3300048912 Bacteria 5069
510 Ga0496109_0032755 3300048912 Bacteria 4674
511 Ga0496109_0172163 3300048912 Bacteria 2031
512 Ga0496110_0010414 3300048913 Bacteria 7559
513 Ga0496111_0020287 3300048914 Bacteria 4625
514 Ga0496112_0004975 3300048915 Bacteria 11392
515 Ga0496112_0257853 3300048915 Bacteria 1694
516 Ga0496113_0015848 3300048916 Bacteria 5194
517 Ga0496113_0018386 3300048916 Bacteria 4867
518 Ga0496113_0090010 3300048916 Bacteria 2363
519 Ga0496114_0011862 3300048917 Bacteria 6973
520 Ga0496115_0049764 3300048918 Bacteria 3355
521 Ga0496120_0099444 3300048923 Bacteria 1540
522 Ga0496122_0071515 3300048925 Bacteria 2472
523 Ga0501031_0017066 3300049568 Bacteria 4716
524 Ga0501031_0033529 3300049568 Bacteria 3350
525 Ga0501031_0072612 3300049568 Bacteria 2240
526 Ga0501031_0088173 3300049568 Bacteria 2023
527 Ga0501032_0000002 3300049569 Bacteria 335417
528 Ga0501032_0004236 3300049569 Bacteria 10846
529 Ga0501034_0000001 3300049571 Bacteria 2184493
530 Ga0501034_0372268 3300049571 Bacteria 1354
531 Ga0501036_0008719 3300049572 Bacteria 8320
532 Ga0501036_0039766 3300049572 Bacteria 3979
533 Ga0501036_0061894 3300049572 Bacteria 3170
534 Ga0501036_0104350 3300049572 Bacteria 2397
535 Ga0501036_0166448 3300049572 Bacteria 1858
536 Ga0501038_0000011 3300049574 Bacteria 181217
537 Ga0501038_0041508 3300049574 Bacteria 4012
538 Ga0501038_0049012 3300049574 Bacteria 3653
539 Ga0501039_0000006 3300049575 Bacteria 278135
540 Ga0501039_0013493 3300049575 Bacteria 6248
541 Ga0501039_0059289 3300049575 Bacteria 2965
542 Ga0501040_0003946 3300049576 Bacteria 9630
543 Ga0501040_0004178 3300049576 Bacteria 9394
544 Ga0501040_0082631 3300049576 Bacteria 2227
545 Ga0501040_0199374 3300049576 Bacteria 1421
546 Ga0501040_0283372 3300049576 Bacteria 1184
547 Ga0501041_0005041 3300049577 Bacteria 7689
548 Ga0501041_0030948 3300049577 Bacteria 3230
549 Ga0501041_0090708 3300049577 Bacteria 1887
550 Ga0501041_0097666 3300049577 Bacteria 1816
551 Ga0501041_0144658 3300049577 Bacteria 1483
552 Ga0501042_0146531 3300049578 Bacteria 1702
553 Ga0501043_0001441 3300049579 Bacteria 20804
554 Ga0501043_0272250 3300049579 Bacteria 1300
555 Ga0501046_0000246 3300049580 Bacteria 55453
556 Ga0501046_0038092 3300049580 Bacteria 3861
557 Ga0501046_0288842 3300049580 Bacteria 1200
558 Ga0501047_0009299 3300049581 Bacteria 9282
559 Ga0501047_0052314 3300049581 Bacteria 3947
560 Ga0501048_0006578 3300049582 Bacteria 8834
561 Ga0501048_0074692 3300049582 Bacteria 2392
562 Ga0501048_0100460 3300049582 Bacteria 2041
563 Ga0501048_0153520 3300049582 Bacteria 1629
564 Ga0501067_0017826 3300049583 Bacteria 3931
565 Ga0501067_0098794 3300049583 Bacteria 1621
566 Ga0501068_0018602 3300049584 Bacteria 4023
567 Ga0501068_0158464 3300049584 Bacteria 1426
568 Ga0501069_0019612 3300049585 Bacteria 3658
569 Ga0501069_0063131 3300049585 Bacteria 2069
570 Ga0501070_0000031 3300049586 Bacteria 138137
571 Ga0501070_0000540 3300049586 Bacteria 34697
572 Ga0501070_0041326 3300049586 Bacteria 3842
573 Ga0501070_0065393 3300049586 Bacteria 3011
574 Ga0501070_0127387 3300049586 Bacteria 2104
575 Ga0501071_0040237 3300049587 Bacteria 3345
576 Ga0501071_0068569 3300049587 Bacteria 2581
577 Ga0501071_0113875 3300049587 Bacteria 2000
578 Ga0501072_0002691 3300049588 Bacteria 13336
579 Ga0501072_0024741 3300049588 Bacteria 4673
580 Ga0501072_0106659 3300049588 Bacteria 2228
581 Ga0501073_0005304 3300049589 Bacteria 9668
582 Ga0501073_0034322 3300049589 Bacteria 3611
583 Ga0501073_0101348 3300049589 Bacteria 1999
584 Ga0501074_0022854 3300049590 Bacteria 4547
585 Ga0501074_0036465 3300049590 Bacteria 3562
586 Ga0501074_0080025 3300049590 Bacteria 2345
587 Ga0501075_0005490 3300049591 Bacteria 8676
588 Ga0501075_0024067 3300049591 Bacteria 4459
589 Ga0501075_0087915 3300049591 Bacteria 2355
590 Ga0501076_0011183 3300049592 Bacteria 6679
591 Ga0501076_0031005 3300049592 Bacteria 4167
592 Ga0501076_0037448 3300049592 Bacteria 3804
593 Ga0501076_0057399 3300049592 Bacteria 3091
594 Ga0501076_0064657 3300049592 Bacteria 2916
595 Ga0501077_0003004 3300049593 Bacteria 10116
596 Ga0501077_0007974 3300049593 Bacteria 6545
597 Ga0501077_0009385 3300049593 Bacteria 6079
598 Ga0501077_0011442 3300049593 Bacteria 5542
599 Ga0501077_0024163 3300049593 Bacteria 3858
600 Ga0501079_0061874 3300049741 Bacteria 2887
601 Ga0501079_0070704 3300049741 Bacteria 2695
602 Ga0501079_0091873 3300049741 Bacteria 2352
603 Ga0501079_0095708 3300049741 Bacteria 2301
604 Ga0501079_0135921 3300049741 Bacteria 1914
605 Ga0501080_0027989 3300049742 Bacteria 5241
606 Ga0501080_0033719 3300049742 Bacteria 4780
607 Ga0501080_0063844 3300049742 Bacteria 3426
608 Ga0501080_0200345 3300049742 Bacteria 1833
609 Ga0501080_0203088 3300049742 Bacteria 1819
610 Ga0501080_0259918 3300049742 Bacteria 1582
611 Ga0501080_0266840 3300049742 Bacteria 1559
612 Ga0501081_0005212 3300049743 Bacteria 8371
613 Ga0501081_0012541 3300049743 Bacteria 5573
614 Ga0501081_0014229 3300049743 Bacteria 5246
615 Ga0501081_0057742 3300049743 Bacteria 2684
616 Ga0501083_0010030 3300049744 Bacteria 6682
617 Ga0501083_0010058 3300049744 Bacteria 6670
618 Ga0501083_0015131 3300049744 Bacteria 5401
619 Ga0501083_0031936 3300049744 Bacteria 3612
620 Ga0501083_0044898 3300049744 Bacteria 2991
621 Ga0501083_0229074 3300049744 Bacteria 1210
622 Ga0501035_0024295 3300049822 Bacteria 5558
623 Ga0501035_0065866 3300049822 Bacteria 3216
624 Ga0501044_0004918 3300049823 Bacteria 14936
625 Ga0501044_0010458 3300049823 Bacteria 10071
626 Ga0501044_0013991 3300049823 Bacteria 8667
627 Ga0501044_0031163 3300049823 Bacteria 5614
628 Ga0501044_0033244 3300049823 Bacteria 5421
629 Ga0501044_0048091 3300049823 Bacteria 4408
630 Ga0501044_0201516 3300049823 Bacteria 1948
631 Ga0501045_0003999 3300049824 Bacteria 10152
632 Ga0501045_0011608 3300049824 Bacteria 6186
633 Ga0501045_0096220 3300049824 Bacteria 2191
634 Ga0501045_0172435 3300049824 Bacteria 1611
635 nmdc:mga03n38_3206_c1 3300050490 Bacteria 5212
636 nmdc:mga0yw44_24908_c1 3300050492 Bacteria 3394
637 nmdc:mga06z11_22729_c1 3300050494 Bacteria 2934
638 nmdc:mga06z11_43395_c1 3300050494 Bacteria 2262
639 nmdc:mga04h51_6493_c1 3300050495 Bacteria 3035
640 nmdc:mga05p37_269707_c1 3300050507 Bacteria 2034
641 nmdc:mga05p37_310591_c1 3300050507 Bacteria 1869
642 nmdc:mga05p37_336861_c1 3300050507 Bacteria 1780
643 nmdc:mga09592_27224_c1 3300050508 Bacteria 4744
644 nmdc:mga0qj67_363851_c1 3300050509 Bacteria 1169
645 nmdc:mga06r32_136447_c1 3300050510 Bacteria 2428
646 nmdc:mga06r32_96940_c1 3300050510 Bacteria 2889
647 nmdc:mga08y16_292236_c1 3300050511 Bacteria 1680
648 nmdc:mga08y16_295319_c1 3300050511 Bacteria 1671
649 nmdc:mga08y16_50457_c1 3300050511 Bacteria 4354
650 nmdc:mga08y16_83016_c1 3300050511 Bacteria 3340
651 nmdc:mga0n895_104034_c1 3300050512 Bacteria 2851
652 nmdc:mga0n895_34632_c1 3300050512 Bacteria 4863
653 nmdc:mga0n895_83649_c1 3300050512 Bacteria 3184
654 nmdc:mga0rr50_27699_c1 3300050513 Bacteria 3973
655 nmdc:mga08x19_250750_c1 3300050514 Bacteria 1222
656 nmdc:mga08x19_8007_c1 3300050514 Bacteria 6280
657 nmdc:mga08x19_85249_c1 3300050514 Bacteria 2079
658 nmdc:mga0a205_2329_c1 3300050515 Bacteria 16759
659 Ga0495601_0021555 3300053077 Bacteria 3947
660 Ga0495601_0025847 3300053077 Bacteria 3622
661 Ga0495612_0028965 3300053078 Bacteria 2229
662 Ga0495595_0011852 3300053084 Bacteria 3655
663 Ga0495619_0000737 3300053085 Bacteria 21356
664 Ga0495619_0031973 3300053085 Bacteria 3412
665 Ga0495619_0089592 3300053085 Bacteria 2081
666 Ga0500651_0012206 3300053093 Bacteria 5205
667 Ga0500555_031749 3300053103 Bacteria 1495
668 Ga0500556_0000427 3300053104 Bacteria 30287
669 Ga0500594_0038888 3300053118 Bacteria 1291
670 Ga0500595_011938 3300053119 Bacteria 3378
671 Ga0500595_033222 3300053119 Bacteria 1713
672 Ga0500642_0001673 3300053130 Bacteria 6401
673 Ga0500658_0007005 3300053134 Bacteria 4171
674 Ga0500568_0025146 3300053139 Bacteria 2516
675 Ga0500588_0004817 3300053146 Bacteria 2947
676 Ga0500616_0000548 3300053153 Bacteria 46717
677 Ga0500616_0015133 3300053153 Bacteria 4418
678 Ga0500616_0018717 3300053153 Bacteria 3913
679 Ga0500645_025159 3300053730 Bacteria 1817
680 Ga0501084_0000658 3300054114 Bacteria 26356
681 Ga0501084_0006920 3300054114 Bacteria 9335
682 Ga0501084_0015177 3300054114 Bacteria 6385
683 Ga0501084_0022794 3300054114 Bacteria 5226
684 Ga0501084_0024755 3300054114 Bacteria 5009
685 Ga0501084_0038055 3300054114 Bacteria 4021
686 Ga0501084_0039332 3300054114 Bacteria 3956
687 Ga0501084_0135754 3300054114 Bacteria 2071
688 Ga0501084_0247083 3300054114 Bacteria 1506
689 Ga0587111_0019506 3300060346 Bacteria 1287
690 Ga0501082_0004559 3300060353 Bacteria 12095
691 Ga0501082_0051106 3300060353 Bacteria 3563
692 Ga0501082_0061771 3300060353 Bacteria 3225
693 Ga0501082_0088115 3300060353 Bacteria 2678
694 Ga0530510_0010850 3300061734 Bacteria 6391
695 Ga0530510_0014376 3300061734 Bacteria 5581
696 Ga0530510_0017882 3300061734 Bacteria 5027
697 Ga0530510_0024825 3300061734 Bacteria 4283
698 Ga0530510_0092650 3300061734 Bacteria 2205
699 2512033911 2511231221 Bacteria 6846400
700 2523106899 2522572158 Bacteria 6514390
701 2524610456 2524023250 Bacteria 5457705
702 2599103501 2597490356 Bacteria 7030811
703 2821444496 2821443989 Bacteria 7658172
704 2842336289 2842333319 Bacteria 8899485
705 2844538575 2844533157 Bacteria 7517899
706 2846953388 2846952575 Bacteria 6587527
707 2848858862 2848858292 Bacteria 7391279
708 2883293017 2883291878 Bacteria 5894118
709 2883356010 2883354860 Bacteria 5865246
710 2897803633 2897803580 Bacteria 7000062
711 8054004603 8054002106 Bacteria 7987183
712 Ga0070681_10069314
713 JGI24750J21931_1000838
714 JGI25159J45721_1016009
715 JGI25151J46595_10000322
716 rootH2_10010650
717 rootH2_10112849
718 Ga0070658_10008981
719 Ga0070676_10015589
720 Ga0070690_100000545
721 Ga0068869_100006528
722 Ga0068869_100008839
723 Ga0070666_10006691
724 Ga0070680_100001616
725 Ga0070680_100013279
726 Ga0070680_100021600
727 Ga0070680_100042301
728 Ga0070680_100102652
729 Ga0070682_100025901
730 Ga0068868_100005849
731 Ga0070660_100001055
732 Ga0070660_100045376
733 Ga0070689_100001025
734 Ga0070691_10000109
735 Ga0070691_10000961
736 Ga0070687_100002739
737 Ga0070661_100006555
738 Ga0070692_10001523
739 Ga0070668_100000323
740 Ga0070669_100023518
741 Ga0070675_100051976
742 Ga0070671_100001054
743 Ga0070671_100042353
744 Ga0070674_100001030
745 Ga0070673_100001383
746 Ga0070688_100000138
747 Ga0070659_100000915
748 Ga0070659_100043396
749 Ga0070667_100002638
750 Ga0070703_10000738
751 Ga0070709_10000884
752 Ga0070709_10033679
753 Ga0070709_10088251
754 Ga0070714_100011691
755 Ga0070714_100013118
756 Ga0070714_100172541
757 Ga0070714_100180187
758 Ga0070713_100005717
759 Ga0070713_100092305
760 Ga0070713_100111360
761 Ga0070710_10006960
762 Ga0070710_10010173
763 Ga0070710_10166391
764 Ga0070701_10003317
765 Ga0070711_100005929
766 Ga0070711_100011564
767 Ga0070711_100027625
768 Ga0070711_100037756
769 Ga0070711_100318118
770 Ga0070705_100000774
771 Ga0070705_100001100
772 Ga0070700_100001594
773 Ga0070694_100000159
774 Ga0070694_100007145
775 Ga0070708_100265586
776 Ga0070663_100001241
777 Ga0070663_100060792
778 Ga0070678_100001723
779 Ga0070662_100019876
780 Ga0070681_10009920
781 Ga0070681_10016572
782 Ga0070681_10042284
783 Ga0070681_10125853
784 Ga0070681_10297928
785 Ga0070685_10026736
786 Ga0070706_100047764
787 Ga0070707_100015032
788 Ga0070698_100001477
789 Ga0070698_100043566
790 Ga0070698_100165789
791 Ga0070698_100333946
792 Ga0070699_100001258
793 Ga0070699_100014379
794 Ga0070699_100065810
795 Ga0070679_100012896
796 Ga0070679_100017530
797 Ga0070679_100154298
798 Ga0070679_100192635
799 Ga0070679_100274030
800 Ga0070679_100293304
801 Ga0070684_100006001
802 Ga0070684_100326129
803 Ga0070697_100005090
804 Ga0070697_100144271
805 Ga0068853_100000477
806 Ga0070672_100003489
807 Ga0070695_100001335
808 Ga0070695_100001605
809 Ga0070696_100000649
810 Ga0070696_100001417
811 Ga0070693_100000188
812 Ga0070693_100140879
813 Ga0070665_100017657
814 Ga0070665_100041621
815 Ga0070665_100455566
816 Ga0070704_100017707
817 Ga0070704_100032102
818 Ga0070704_100035700
819 Ga0070704_100177580
820 Ga0068855_100002324
821 Ga0068855_100313265
822 Ga0070664_100001729
823 Ga0070664_100216931
824 Ga0068857_100003178
825 Ga0068857_100073594
826 Ga0068857_100161434
827 Ga0068857_100350473
828 Ga0068854_100001073
829 Ga0068854_100092724
830 Ga0068856_100001302
831 Ga0068856_100085810
832 Ga0070702_100000205
833 Ga0068852_100006477
834 Ga0068859_100025733
835 Ga0068859_100033872
836 Ga0068866_10003307
837 Ga0068861_100000196
838 Ga0068861_100046006
839 Ga0068863_100023321
840 Ga0068863_100043839
841 Ga0068858_100001779
842 Ga0068860_100000872
843 Ga0068860_100006253
844 Ga0068862_100002619
845 Ga0068862_100015087
846 Ga0081455_10000028
847 Ga0081455_10001989
848 Ga0081455_10002009
849 Ga0081455_10075662
850 Ga0081538_10032566
851 Ga0081540_1000060
852 Ga0081540_1003639
853 Ga0081540_1005968
854 Ga0070717_10000560
855 Ga0070717_10041974
856 Ga0070717_10095327
857 Ga0075365_10010665
858 Ga0075368_10028284
859 Ga0075363_100010173
860 Ga0075364_10001857
861 Ga0070715_10000455
862 Ga0070716_100001528
863 Ga0070712_100011256
864 Ga0070712_100016855
865 Ga0070712_100075587
866 Ga0075367_10001325
867 Ga0075367_10011745
868 Ga0068871_100009843
869 Ga0068871_100067054
870 Ga0075428_100008023
871 Ga0075428_100056280
872 Ga0075430_100130844
873 Ga0075431_100004173
874 Ga0075431_100026694
875 Ga0075431_100031095
876 Ga0075431_100073702
877 Ga0075433_10008265
878 Ga0075433_10022191
879 Ga0075434_100001646
880 Ga0075434_100049658
881 Ga0075434_100382652
882 Ga0075429_100020985
883 Ga0075429_100022660
884 Ga0075429_100052570
885 Ga0068865_100001326
886 Ga0075436_100019703
887 Ga0075436_100027136
888 Ga0097620_100025734
889 Ga0097620_100033870
890 Ga0075435_100026374
891 Ga0075435_100106976
892 Ga0105240_10056163
893 Ga0105240_10269194
894 Ga0111539_10015556
895 Ga0111539_10048481
896 Ga0111539_10058017
897 Ga0111539_10162510
898 Ga0105247_10002044
899 Ga0105247_10029304
900 Ga0105247_10030975
901 Ga0114129_10005905
902 Ga0114129_10088933
903 Ga0114129_10143068
904 Ga0114129_10241304
905 Ga0114129_10773022
906 Ga0105243_10002388
907 Ga0105241_10006277
908 Ga0105242_10001841
909 Ga0105237_10002959
910 Ga0105238_10016025
911 Ga0105238_10022211
912 Ga0105249_10005201
913 Ga0105249_10005964
914 Ga0105028_100214
915 Ga0099796_10047668
916 Ga0105239_10014169
917 Ga0105239_10114434
918 Ga0157371_10005468
919 Ga0157370_10004490
920 Ga0157370_10004646
921 Ga0157370_10068142
922 Ga0157369_10013096
923 Ga0157369_10020301
924 Ga0157369_10058245
925 Ga0157378_10002206
926 Ga0163162_10002752
927 Ga0157372_10003944
928 Ga0157372_10004421
929 Ga0157372_10005907
930 Ga0157372_10017772
931 Ga0157372_10019499
932 Ga0157372_10046507
933 Ga0157375_10046242
934 Ga0157380_10114829
935 Ga0157380_10214665
936 Ga0157379_10010073
937 Ga0157376_10000823
938 Ga0163161_10002941
939 Ga0163161_10166518
940 Ga0213872_10000522
941 Ga0213872_10010762
942 Ga0213872_10012233
943 Ga0213872_10042325
944 Ga0213872_10042412
945 Ga0213876_10001035
946 Ga0213875_10000364
947 Ga0213875_10000568
948 Ga0213871_10010104
949 Ga0213871_10013160
950 Ga0209148_1001047
951 Ga0209455_1000278
952 Ga0209130_1001314
953 Ga0209025_1001048
954 Ga0209564_1033334
955 Ga0209758_1000118
956 Ga0209758_1004898
957 Ga0209758_1008576
958 Ga0207426_1000256
959 Ga0207426_1019907
960 Ga0209257_1001036
961 Ga0207653_10046254
962 Ga0207692_10024990
963 Ga0207692_10033094
964 Ga0207692_10141969
965 Ga0207710_10001172
966 Ga0207710_10035892
967 Ga0207688_10002512
968 Ga0207680_10090152
969 Ga0207647_10008374
970 Ga0207699_10001135
971 Ga0207699_10005261
972 Ga0207699_10043721
973 Ga0207645_10005698
974 Ga0207705_10000611
975 Ga0207705_10050274
976 Ga0207654_10009164
977 Ga0207707_10001384
978 Ga0207707_10009542
979 Ga0207707_10056261
980 Ga0207707_10115572
981 Ga0207707_10150641
982 Ga0207707_10246541
983 Ga0207707_10374957
984 Ga0207695_10011770
985 Ga0207695_10042772
986 Ga0207695_10193658
987 Ga0207693_10000313
988 Ga0207693_10003314
989 Ga0207693_10096675
990 Ga0207663_10000796
991 Ga0207663_10027755
992 Ga0207663_10100610
993 Ga0207663_10100699
994 Ga0207663_10162572
995 Ga0207660_10042548
996 Ga0207660_10042581
997 Ga0207660_10050840
998 Ga0207662_10001471
999 Ga0207657_10000112
1000 Ga0207657_10000815
1001 Ga0207649_10002140
1002 Ga0207649_10012726
1003 Ga0207652_10002462
1004 Ga0207652_10017420
1005 Ga0207652_10064208
1006 Ga0207652_10143941
1007 Ga0207652_10237183
1008 Ga0207646_10006025
1009 Ga0207646_10025801
1010 Ga0207694_10011426
1011 Ga0207694_10030218
1012 Ga0207650_10075996
1013 Ga0207659_10010504
1014 Ga0207687_10004074
1015 Ga0207700_10017076
1016 Ga0207700_10078563
1017 Ga0207700_10115108
1018 Ga0207700_10232702
1019 Ga0207664_10027840
1020 Ga0207664_10091478
1021 Ga0207664_10203149
1022 Ga0207644_10078146
1023 Ga0207690_10002166
1024 Ga0207690_10027815
1025 Ga0207690_10063786
1026 Ga0207690_10283266
1027 Ga0207706_10000831
1028 Ga0207686_10008320
1029 Ga0207670_10010280
1030 Ga0207669_10040421
1031 Ga0207665_10000565
1032 Ga0207665_10123515
1033 Ga0207691_10000623
1034 Ga0207711_10047762
1035 Ga0207689_10024023
1036 Ga0207689_10033128
1037 Ga0207661_10065820
1038 Ga0207679_10272539
1039 Ga0207667_10027474
1040 Ga0207651_10003894
1041 Ga0207712_10005840
1042 Ga0207712_10006060
1043 Ga0207668_10004522
1044 Ga0207668_10335772
1045 Ga0207640_10004889
1046 Ga0207658_10006904
1047 Ga0207658_10081453
1048 Ga0207677_10038570
1049 Ga0207703_10015180
1050 Ga0207639_10005657
1051 Ga0207639_10184842
1052 Ga0207678_10000086
1053 Ga0207708_10002960
1054 Ga0207702_10013420
1055 Ga0207702_10084239
1056 Ga0207641_10008810
1057 Ga0207641_10033633
1058 Ga0207648_10068154
1059 Ga0207676_10023761
1060 Ga0207676_10158426
1061 Ga0207674_10003298
1062 Ga0207675_100000111
1063 Ga0207683_10000120
1064 Ga0207698_10035109
1065 Ga0209813_10002716
1066 Ga0209813_10062136
1067 Ga0207428_10109023
1068 Ga0268266_10002921
1069 Ga0268266_10069557
1070 Ga0268265_10161166
1071 Ga0268264_10010894
1072 Ga0265337_1003396
1073 Ga0265318_10007334
1074 Ga0265338_10007502
1075 Ga0265338_10013718
1076 Ga0265324_10002634
1077 Ga0265330_10085312
1078 Ga0265332_10006311
1079 Ga0265332_10016725
1080 Ga0265328_10001788
1081 Ga0265320_10003600
1082 Ga0265320_10032282
1083 Ga0265325_10022538
1084 Ga0265340_10000319
1085 Ga0265340_10003799
1086 Ga0265331_10000156
1087 Ga0265331_10002640
1088 Ga0265331_10002733
1089 Ga0265331_10002902
1090 Ga0265327_10000297
1091 Ga0265327_10000543
1092 Ga0265327_10020336
1093 Ga0265316_10052395
1094 Ga0265316_10061570
1095 Ga0307513_10048697
1096 Ga0265313_10000913
1097 Ga0265313_10001440
1098 Ga0265313_10001587
1099 Ga0265313_10006326
1100 Ga0265313_10039421
1101 Ga0265314_10003764
1102 Ga0265314_10007122
1103 Ga0265314_10007521
1104 Ga0265314_10105106
1105 Ga0265342_10018018
1106 Ga0316576_10182422
1107 Ga0316578_10097282
1108 Ga0307405_10340446
1109 Ga0373934_0023656
1110 Ga0373940_0039470
1111 Ga0373949_0001990
1112 Ga0373932_0008825
1113 Ga0373939_0000816
1114 Ga0373941_0006433
1115 Ga0373941_0016386
1116 Ga0373953_0006842
1117 Ga0373953_0045262
1118 Ga0373954_0033397
1119 Ga0373956_0080342
1120 Ga0373960_0001630
1121 Ga0373943_0029155
1122 Ga0373955_0114047
1123 Ga0373962_0007067
1124 Ga0316574_0036442
1125 Ga0373931_0004913
1126 Ga0373931_0020651
1127 Ga0373931_0255950
1128 Ga0373935_0012331
1129 Ga0373933_0031028
1130 Ga0373947_0005812
1131 Ga0373947_0015921
1132 Ga0373937_0000540
1133 Ga0373937_0009309
1134 Ga0373937_0009654
1135 Ga0373937_0066603
1136 Ga0373937_0499738
1137 Ga0316584_0021379
1138 Ga0316584_0099391
1139 Ga0373925_0002418
1140 Ga0395899_0039525
1141 Ga0395900_0015652
1142 Ga0395900_0113947
1143 Ga0395898_0300389
1144 Ga0395905_0002147
1145 Ga0395905_0175560
1146 Ga0436364_0067731
1147 Ga0436364_0639582
1148 Ga0395901_0008188
1149 Ga0400483_055840
1150 Ga0400483_110392
1151 Ga0400483_151200
1152 Ga0400483_184879
1153 Ga0400483_198838
1154 Ga0436365_0229005
1155 Ga0436365_0457441
1156 Ga0436365_1325603
1157 Ga0436365_1712708
1158 Ga0436365_1888495
1159 Ga0436360_0040490
1160 Ga0436361_0064010
1161 Ga0436361_0199013
1162 Ga0436361_0351574
1163 Ga0436361_0358253
1164 Ga0436361_0814479
1165 Ga0436361_1182689
1166 Ga0436363_0082910
1167 Ga0436363_0912598
1168 Ga0436362_0291175
1169 Ga0436362_0473767
1170 Ga0436362_1067723
1171 Ga0436362_1083403
1172 Ga0436362_1095303
1173 Ga0439448_0041596
1174 Ga0439440_0013740
1175 Ga0453683_0017308
1176 Ga0453684_0000062
1177 Ga0453684_0000071
1178 Ga0453684_0028882
1179 Ga0453684_0039359
1180 Ga0453684_0081616
1181 Ga0466960_0070512
1182 Ga0451576_0005756
1183 Ga0451576_0014949
1184 Ga0451576_0047602
1185 Ga0451576_0053851
1186 Ga0466958_0000103
1187 Ga0495603_0000690
1188 Ga0495603_0158632
1189 Ga0495629_0019650
1190 Ga0495629_0248872
1191 Ga0495641_0017633
1192 Ga0495639_0004560
1193 Ga0495610_0048438
1194 Ga0495652_0074354
1195 Ga0495665_0025230
1196 Ga0495640_0069595
1197 Ga0495586_0002921
1198 Ga0495587_0084592
1199 Ga0495622_0005959
1200 Ga0495667_0106891
1201 Ga0495634_0014400
1202 Ga0495635_0045185
1203 Ga0495588_0000969
1204 Ga0495657_0109608
1205 Ga0495658_0000923
1206 Ga0495676_0034205
1207 Ga0495593_0003109
1208 Ga0496100_0009697
1209 Ga0496100_0299803
1210 Ga0496102_0011444
1211 Ga0496104_0003861
1212 Ga0496104_0010979
1213 Ga0496105_0019762
1214 Ga0496105_0069631
1215 Ga0496106_0002044
1216 Ga0496106_0077617
1217 Ga0496107_0018779
1218 Ga0496108_0001756
1219 Ga0496108_0193563
1220 Ga0496109_0027625
1221 Ga0496109_0032755
1222 Ga0496109_0172163
1223 Ga0496110_0010414
1224 Ga0496111_0020287
1225 Ga0496112_0004975
1226 Ga0496112_0257853
1227 Ga0496113_0015848
1228 Ga0496113_0018386
1229 Ga0496113_0090010
1230 Ga0496114_0011862
1231 Ga0496115_0049764
1232 Ga0496120_0099444
1233 Ga0496122_0071515
1234 Ga0501031_0017066
1235 Ga0501031_0033529
1236 Ga0501031_0072612
1237 Ga0501031_0088173
1238 Ga0501032_0000002
1239 Ga0501032_0004236
1240 Ga0501034_0000001
1241 Ga0501034_0372268
1242 Ga0501036_0008719
1243 Ga0501036_0039766
1244 Ga0501036_0061894
1245 Ga0501036_0104350
1246 Ga0501036_0166448
1247 Ga0501038_0000011
1248 Ga0501038_0041508
1249 Ga0501038_0049012
1250 Ga0501039_0000006
1251 Ga0501039_0013493
1252 Ga0501039_0059289
1253 Ga0501040_0003946
1254 Ga0501040_0004178
1255 Ga0501040_0082631
1256 Ga0501040_0199374
1257 Ga0501040_0283372
1258 Ga0501041_0005041
1259 Ga0501041_0030948
1260 Ga0501041_0090708
1261 Ga0501041_0097666
1262 Ga0501041_0144658
1263 Ga0501042_0146531
1264 Ga0501043_0001441
1265 Ga0501043_0272250
1266 Ga0501046_0000246
1267 Ga0501046_0038092
1268 Ga0501046_0288842
1269 Ga0501047_0009299
1270 Ga0501047_0052314
1271 Ga0501048_0006578
1272 Ga0501048_0074692
1273 Ga0501048_0100460
1274 Ga0501048_0153520
1275 Ga0501067_0017826
1276 Ga0501067_0098794
1277 Ga0501068_0018602
1278 Ga0501068_0158464
1279 Ga0501069_0019612
1280 Ga0501069_0063131
1281 Ga0501070_0000031
1282 Ga0501070_0000540
1283 Ga0501070_0041326
1284 Ga0501070_0065393
1285 Ga0501070_0127387
1286 Ga0501071_0040237
1287 Ga0501071_0068569
1288 Ga0501071_0113875
1289 Ga0501072_0002691
1290 Ga0501072_0024741
1291 Ga0501072_0106659
1292 Ga0501073_0005304
1293 Ga0501073_0034322
1294 Ga0501073_0101348
1295 Ga0501074_0022854
1296 Ga0501074_0036465
1297 Ga0501074_0080025
1298 Ga0501075_0005490
1299 Ga0501075_0024067
1300 Ga0501075_0087915
1301 Ga0501076_0011183
1302 Ga0501076_0031005
1303 Ga0501076_0037448
1304 Ga0501076_0057399
1305 Ga0501076_0064657
1306 Ga0501077_0003004
1307 Ga0501077_0007974
1308 Ga0501077_0009385
1309 Ga0501077_0011442
1310 Ga0501077_0024163
1311 Ga0501079_0061874
1312 Ga0501079_0070704
1313 Ga0501079_0091873
1314 Ga0501079_0095708
1315 Ga0501079_0135921
1316 Ga0501080_0027989
1317 Ga0501080_0033719
1318 Ga0501080_0063844
1319 Ga0501080_0200345
1320 Ga0501080_0203088
1321 Ga0501080_0259918
1322 Ga0501080_0266840
1323 Ga0501081_0005212
1324 Ga0501081_0012541
1325 Ga0501081_0014229
1326 Ga0501081_0057742
1327 Ga0501083_0010030
1328 Ga0501083_0010058
1329 Ga0501083_0015131
1330 Ga0501083_0031936
1331 Ga0501083_0044898
1332 Ga0501083_0229074
1333 Ga0501035_0024295
1334 Ga0501035_0065866
1335 Ga0501044_0004918
1336 Ga0501044_0010458
1337 Ga0501044_0013991
1338 Ga0501044_0031163
1339 Ga0501044_0033244
1340 Ga0501044_0048091
1341 Ga0501044_0201516
1342 Ga0501045_0003999
1343 Ga0501045_0011608
1344 Ga0501045_0096220
1345 Ga0501045_0172435
1346 nmdc:mga03n38_3206_c1
1347 nmdc:mga0yw44_24908_c1
1348 nmdc:mga06z11_22729_c1
1349 nmdc:mga06z11_43395_c1
1350 nmdc:mga04h51_6493_c1
1351 nmdc:mga05p37_269707_c1
1352 nmdc:mga05p37_310591_c1
1353 nmdc:mga05p37_336861_c1
1354 nmdc:mga09592_27224_c1
1355 nmdc:mga0qj67_363851_c1
1356 nmdc:mga06r32_136447_c1
1357 nmdc:mga06r32_96940_c1
1358 nmdc:mga08y16_292236_c1
1359 nmdc:mga08y16_295319_c1
1360 nmdc:mga08y16_50457_c1
1361 nmdc:mga08y16_83016_c1
1362 nmdc:mga0n895_104034_c1
1363 nmdc:mga0n895_34632_c1
1364 nmdc:mga0n895_83649_c1
1365 nmdc:mga0rr50_27699_c1
1366 nmdc:mga08x19_250750_c1
1367 nmdc:mga08x19_8007_c1
1368 nmdc:mga08x19_85249_c1
1369 nmdc:mga0a205_2329_c1
1370 Ga0495601_0021555
1371 Ga0495601_0025847
1372 Ga0495612_0028965
1373 Ga0495595_0011852
1374 Ga0495619_0000737
1375 Ga0495619_0031973
1376 Ga0495619_0089592
1377 Ga0500651_0012206
1378 Ga0500555_031749
1379 Ga0500556_0000427
1380 Ga0500594_0038888
1381 Ga0500595_011938
1382 Ga0500595_033222
1383 Ga0500642_0001673
1384 Ga0500658_0007005
1385 Ga0500568_0025146
1386 Ga0500588_0004817
1387 Ga0500616_0000548
1388 Ga0500616_0015133
1389 Ga0500616_0018717
1390 Ga0500645_025159
1391 Ga0501084_0000658
1392 Ga0501084_0006920
1393 Ga0501084_0015177
1394 Ga0501084_0022794
1395 Ga0501084_0024755
1396 Ga0501084_0038055
1397 Ga0501084_0039332
1398 Ga0501084_0135754
1399 Ga0501084_0247083
1400 Ga0587111_0019506
1401 Ga0501082_0004559
1402 Ga0501082_0051106
1403 Ga0501082_0061771
1404 Ga0501082_0088115
1405 Ga0530510_0010850
1406 Ga0530510_0014376
1407 Ga0530510_0017882
1408 Ga0530510_0024825
1409 Ga0530510_0092650
1410 2512033911
1411 2523106899
1412 2524610456
1413 2599103501
1414 2821444496
1415 2842336289
1416 2844538575
1417 2846953388
1418 2848858862
1419 2883293017
1420 2883356010
1421 2897803633
1422 8054004603

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00953

Glycos_transf_4

Glycosyl transferase family 4

100

274

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oyz-assembly4.cif.gz_D crystal structure of mray bound to capuramycin 0.9623 20 359
8cxr-assembly4.cif.gz_D crystal structure of mray bound to a sphaerimicin analogue 0.9598 23 359
8cxr-assembly1.cif.gz_A crystal structure of mray bound to a sphaerimicin analogue 0.9571 24 359
6oyz-assembly4.cif.gz_D crystal structure of mray bound to capuramycin 0.9561 20 359
6oz6-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9527 24 359
ID Description Score Start End Superfamily
af_Q99PA5_49_164_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4097 93 186 1.20.140.150
af_Q99PA5_49_164_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3515 93 186 1.20.140.150
af_Q7XKJ7_269_452_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3001 135 361 1.20.1250.20
af_A0A1D8PLY7_67_271_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.284 93 355 1.20.1250.20
af_O14091_29_346_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.2791 101 359 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A537PIT9-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9919 1 296 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0051992
GO:0071555
AF-A0A2K9JP42-F1-model_v4 deleted 0.9897 1 361
AF-A0A3S2DDN4-F1-model_v4 deleted 0.9893 1 257
AF-A0A329P6I9-F1-model_v4 deleted 0.9889 134 361
AF-A0A2W5SC89-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) 0.9885 1 361 GO:0005886
GO:0008360
GO:0008963
GO:0009252
GO:0046872
GO:0051301
GO:0051992
GO:0071555

Map