F476755
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 711 | 363 | 1422 | 361 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10069314|Ga0070681_100693143 |
| Length | 349 |
| Sequence | MLYLLLYPWADQFQAFNLFRYITFRSGGAVVTALLISFVFGPQIIAWLKSKQGEGQPIRTDGPQSHLVRKKGTPTMGGFLILLALSVSTLLWADLADPYVWIVLFVTVAFGLIGFFDDYRKLTRRSHHGISARGKLLAYVMRQPLANSIAVPFLKNVLLNLGWFFLPFGVLVIAGASNAVNLTDGLDGLAIGPAMIAAGCFAFIAYVVGRADFSNYLQLHHVAGAGELAVFCAAMVGSGLGFLWFNAPPASVFMGDTGSLSIGAALGAIAIVTKHELVLAIVGGLFVLEAISVIVQVVSFKTTGQRVFRMAPLHHHFEQKGWGEAQIVIRFWIIAAILAIAGLATLKLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 120 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 123 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 211 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 246 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 247 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 251 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 252 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 286 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 320 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 337 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 340 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 342 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 345 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 351 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 352 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 353 | 2524023250 | Niveispirillum irakense DSM 11586 | Isolate | Unclassified |
| 354 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 355 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 356 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 357 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 358 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 359 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 360 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 361 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 362 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 363 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.63 |
| Nodule | 0.14 |
| Rhizoplane | 3.38 |
| Rhizosphere | 86.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070681_10069314 | 3300005458 | Bacteria | 3493 |
| 2 | JGI24750J21931_1000838 | 3300002070 | Bacteria | 4250 |
| 3 | JGI25159J45721_1016009 | 3300002987 | Bacteria | 1618 |
| 4 | JGI25151J46595_10000322 | 3300003187 | Bacteria | 51965 |
| 5 | rootH2_10010650 | 3300003320 | Bacteria | 8405 |
| 6 | rootH2_10112849 | 3300003320 | Bacteria | 6824 |
| 7 | Ga0070658_10008981 | 3300005327 | Bacteria | 8034 |
| 8 | Ga0070676_10015589 | 3300005328 | Bacteria | 4195 |
| 9 | Ga0070690_100000545 | 3300005330 | Bacteria | 18860 |
| 10 | Ga0068869_100006528 | 3300005334 | Bacteria | 7405 |
| 11 | Ga0068869_100008839 | 3300005334 | Bacteria | 6518 |
| 12 | Ga0070666_10006691 | 3300005335 | Bacteria | 7092 |
| 13 | Ga0070680_100001616 | 3300005336 | Bacteria | 16482 |
| 14 | Ga0070680_100013279 | 3300005336 | Bacteria | 6414 |
| 15 | Ga0070680_100021600 | 3300005336 | Bacteria | 5118 |
| 16 | Ga0070680_100042301 | 3300005336 | Bacteria | 3696 |
| 17 | Ga0070680_100102652 | 3300005336 | Bacteria | 2375 |
| 18 | Ga0070682_100025901 | 3300005337 | Bacteria | 3504 |
| 19 | Ga0068868_100005849 | 3300005338 | Bacteria | 8670 |
| 20 | Ga0070660_100001055 | 3300005339 | Bacteria | 18546 |
| 21 | Ga0070660_100045376 | 3300005339 | Bacteria | 3364 |
| 22 | Ga0070689_100001025 | 3300005340 | Bacteria | 17546 |
| 23 | Ga0070691_10000109 | 3300005341 | Bacteria | 24574 |
| 24 | Ga0070691_10000961 | 3300005341 | Bacteria | 11764 |
| 25 | Ga0070687_100002739 | 3300005343 | Bacteria | 6682 |
| 26 | Ga0070661_100006555 | 3300005344 | Bacteria | 8028 |
| 27 | Ga0070692_10001523 | 3300005345 | Bacteria | 8492 |
| 28 | Ga0070668_100000323 | 3300005347 | Bacteria | 31536 |
| 29 | Ga0070669_100023518 | 3300005353 | Bacteria | 4411 |
| 30 | Ga0070675_100051976 | 3300005354 | Bacteria | 3368 |
| 31 | Ga0070671_100001054 | 3300005355 | Bacteria | 20321 |
| 32 | Ga0070671_100042353 | 3300005355 | Bacteria | 3784 |
| 33 | Ga0070674_100001030 | 3300005356 | Bacteria | 14566 |
| 34 | Ga0070673_100001383 | 3300005364 | Bacteria | 14186 |
| 35 | Ga0070688_100000138 | 3300005365 | Bacteria | 39542 |
| 36 | Ga0070659_100000915 | 3300005366 | Bacteria | 21598 |
| 37 | Ga0070659_100043396 | 3300005366 | Bacteria | 3517 |
| 38 | Ga0070667_100002638 | 3300005367 | Bacteria | 15527 |
| 39 | Ga0070703_10000738 | 3300005406 | Bacteria | 10919 |
| 40 | Ga0070709_10000884 | 3300005434 | Bacteria | 16793 |
| 41 | Ga0070709_10033679 | 3300005434 | Bacteria | 3100 |
| 42 | Ga0070709_10088251 | 3300005434 | Bacteria | 2040 |
| 43 | Ga0070714_100011691 | 3300005435 | Bacteria | 6971 |
| 44 | Ga0070714_100013118 | 3300005435 | Bacteria | 6633 |
| 45 | Ga0070714_100172541 | 3300005435 | Bacteria | 1963 |
| 46 | Ga0070714_100180187 | 3300005435 | Bacteria | 1922 |
| 47 | Ga0070713_100005717 | 3300005436 | Bacteria | 8539 |
| 48 | Ga0070713_100092305 | 3300005436 | Bacteria | 2606 |
| 49 | Ga0070713_100111360 | 3300005436 | Bacteria | 2387 |
| 50 | Ga0070710_10006960 | 3300005437 | Bacteria | 5454 |
| 51 | Ga0070710_10010173 | 3300005437 | Bacteria | 4614 |
| 52 | Ga0070710_10166391 | 3300005437 | Bacteria | 1371 |
| 53 | Ga0070701_10003317 | 3300005438 | Bacteria | 6350 |
| 54 | Ga0070711_100005929 | 3300005439 | Bacteria | 7334 |
| 55 | Ga0070711_100011564 | 3300005439 | Bacteria | 5488 |
| 56 | Ga0070711_100027625 | 3300005439 | Bacteria | 3727 |
| 57 | Ga0070711_100037756 | 3300005439 | Bacteria | 3242 |
| 58 | Ga0070711_100318118 | 3300005439 | Bacteria | 1242 |
| 59 | Ga0070705_100000774 | 3300005440 | Bacteria | 18085 |
| 60 | Ga0070705_100001100 | 3300005440 | Bacteria | 14961 |
| 61 | Ga0070700_100001594 | 3300005441 | Bacteria | 11315 |
| 62 | Ga0070694_100000159 | 3300005444 | Bacteria | 34656 |
| 63 | Ga0070694_100007145 | 3300005444 | Bacteria | 6798 |
| 64 | Ga0070708_100265586 | 3300005445 | Bacteria | 1614 |
| 65 | Ga0070663_100001241 | 3300005455 | Bacteria | 14017 |
| 66 | Ga0070663_100060792 | 3300005455 | Bacteria | 2719 |
| 67 | Ga0070678_100001723 | 3300005456 | Bacteria | 11744 |
| 68 | Ga0070662_100019876 | 3300005457 | Bacteria | 4568 |
| 69 | Ga0070681_10009920 | 3300005458 | Bacteria | 9386 |
| 70 | Ga0070681_10016572 | 3300005458 | Bacteria | 7358 |
| 71 | Ga0070681_10042284 | 3300005458 | Bacteria | 4567 |
| 72 | Ga0070681_10125853 | 3300005458 | Bacteria | 2495 |
| 73 | Ga0070681_10297928 | 3300005458 | Bacteria | 1523 |
| 74 | Ga0070685_10026736 | 3300005466 | Bacteria | 3182 |
| 75 | Ga0070706_100047764 | 3300005467 | Bacteria | 3951 |
| 76 | Ga0070707_100015032 | 3300005468 | Bacteria | 7263 |
| 77 | Ga0070698_100001477 | 3300005471 | Bacteria | 26108 |
| 78 | Ga0070698_100043566 | 3300005471 | Bacteria | 4600 |
| 79 | Ga0070698_100165789 | 3300005471 | Bacteria | 2152 |
| 80 | Ga0070698_100333946 | 3300005471 | Bacteria | 1447 |
| 81 | Ga0070699_100001258 | 3300005518 | Bacteria | 23358 |
| 82 | Ga0070699_100014379 | 3300005518 | Bacteria | 6804 |
| 83 | Ga0070699_100065810 | 3300005518 | Bacteria | 3146 |
| 84 | Ga0070679_100012896 | 3300005530 | Bacteria | 8002 |
| 85 | Ga0070679_100017530 | 3300005530 | Bacteria | 6930 |
| 86 | Ga0070679_100154298 | 3300005530 | Bacteria | 2272 |
| 87 | Ga0070679_100192635 | 3300005530 | Bacteria | 2007 |
| 88 | Ga0070679_100274030 | 3300005530 | Bacteria | 1641 |
| 89 | Ga0070679_100293304 | 3300005530 | Bacteria | 1578 |
| 90 | Ga0070684_100006001 | 3300005535 | Bacteria | 9359 |
| 91 | Ga0070684_100326129 | 3300005535 | Bacteria | 1411 |
| 92 | Ga0070697_100005090 | 3300005536 | Bacteria | 10098 |
| 93 | Ga0070697_100144271 | 3300005536 | Bacteria | 2003 |
| 94 | Ga0068853_100000477 | 3300005539 | Bacteria | 27292 |
| 95 | Ga0070672_100003489 | 3300005543 | Bacteria | 10191 |
| 96 | Ga0070695_100001335 | 3300005545 | Bacteria | 13660 |
| 97 | Ga0070695_100001605 | 3300005545 | Bacteria | 12655 |
| 98 | Ga0070696_100000649 | 3300005546 | Bacteria | 22225 |
| 99 | Ga0070696_100001417 | 3300005546 | Bacteria | 15660 |
| 100 | Ga0070693_100000188 | 3300005547 | Bacteria | 28560 |
| 101 | Ga0070693_100140879 | 3300005547 | Bacteria | 1518 |
| 102 | Ga0070665_100017657 | 3300005548 | Bacteria | 7165 |
| 103 | Ga0070665_100041621 | 3300005548 | Bacteria | 4619 |
| 104 | Ga0070665_100455566 | 3300005548 | Bacteria | 1289 |
| 105 | Ga0070704_100017707 | 3300005549 | Bacteria | 4539 |
| 106 | Ga0070704_100032102 | 3300005549 | Bacteria | 3538 |
| 107 | Ga0070704_100035700 | 3300005549 | Bacteria | 3382 |
| 108 | Ga0070704_100177580 | 3300005549 | Bacteria | 1700 |
| 109 | Ga0068855_100002324 | 3300005563 | Bacteria | 23491 |
| 110 | Ga0068855_100313265 | 3300005563 | Bacteria | 1736 |
| 111 | Ga0070664_100001729 | 3300005564 | Bacteria | 17471 |
| 112 | Ga0070664_100216931 | 3300005564 | Bacteria | 1711 |
| 113 | Ga0068857_100003178 | 3300005577 | Bacteria | 13624 |
| 114 | Ga0068857_100073594 | 3300005577 | Bacteria | 3044 |
| 115 | Ga0068857_100161434 | 3300005577 | Bacteria | 2034 |
| 116 | Ga0068857_100350473 | 3300005577 | Bacteria | 1367 |
| 117 | Ga0068854_100001073 | 3300005578 | Bacteria | 16459 |
| 118 | Ga0068854_100092724 | 3300005578 | Bacteria | 2250 |
| 119 | Ga0068856_100001302 | 3300005614 | Bacteria | 26252 |
| 120 | Ga0068856_100085810 | 3300005614 | Bacteria | 3128 |
| 121 | Ga0070702_100000205 | 3300005615 | Bacteria | 19426 |
| 122 | Ga0068852_100006477 | 3300005616 | Bacteria | 8461 |
| 123 | Ga0068859_100025733 | 3300005617 | Bacteria | 5901 |
| 124 | Ga0068859_100033872 | 3300005617 | Bacteria | 5128 |
| 125 | Ga0068866_10003307 | 3300005718 | Bacteria | 6621 |
| 126 | Ga0068861_100000196 | 3300005719 | Bacteria | 32472 |
| 127 | Ga0068861_100046006 | 3300005719 | Bacteria | 3289 |
| 128 | Ga0068863_100023321 | 3300005841 | Bacteria | 5912 |
| 129 | Ga0068863_100043839 | 3300005841 | Bacteria | 4247 |
| 130 | Ga0068858_100001779 | 3300005842 | Bacteria | 21986 |
| 131 | Ga0068860_100000872 | 3300005843 | Bacteria | 33488 |
| 132 | Ga0068860_100006253 | 3300005843 | Bacteria | 11962 |
| 133 | Ga0068862_100002619 | 3300005844 | Bacteria | 15837 |
| 134 | Ga0068862_100015087 | 3300005844 | Bacteria | 6419 |
| 135 | Ga0081455_10000028 | 3300005937 | Bacteria | 155778 |
| 136 | Ga0081455_10001989 | 3300005937 | Bacteria | 24409 |
| 137 | Ga0081455_10002009 | 3300005937 | Bacteria | 24312 |
| 138 | Ga0081455_10075662 | 3300005937 | Bacteria | 2776 |
| 139 | Ga0081538_10032566 | 3300005981 | Bacteria | 3490 |
| 140 | Ga0081540_1000060 | 3300005983 | Bacteria | 119707 |
| 141 | Ga0081540_1003639 | 3300005983 | Bacteria | 12090 |
| 142 | Ga0081540_1005968 | 3300005983 | Bacteria | 8971 |
| 143 | Ga0070717_10000560 | 3300006028 | Bacteria | 23650 |
| 144 | Ga0070717_10041974 | 3300006028 | Bacteria | 3731 |
| 145 | Ga0070717_10095327 | 3300006028 | Bacteria | 2519 |
| 146 | Ga0075365_10010665 | 3300006038 | Bacteria | 5366 |
| 147 | Ga0075368_10028284 | 3300006042 | Bacteria | 2165 |
| 148 | Ga0075363_100010173 | 3300006048 | Bacteria | 4450 |
| 149 | Ga0075364_10001857 | 3300006051 | Bacteria | 11717 |
| 150 | Ga0070715_10000455 | 3300006163 | Bacteria | 10572 |
| 151 | Ga0070716_100001528 | 3300006173 | Bacteria | 10356 |
| 152 | Ga0070712_100011256 | 3300006175 | Bacteria | 5666 |
| 153 | Ga0070712_100016855 | 3300006175 | Bacteria | 4724 |
| 154 | Ga0070712_100075587 | 3300006175 | Bacteria | 2423 |
| 155 | Ga0075367_10001325 | 3300006178 | Bacteria | 10500 |
| 156 | Ga0075367_10011745 | 3300006178 | Bacteria | 4647 |
| 157 | Ga0068871_100009843 | 3300006358 | Bacteria | 6940 |
| 158 | Ga0068871_100067054 | 3300006358 | Bacteria | 2943 |
| 159 | Ga0075428_100008023 | 3300006844 | Bacteria | 11716 |
| 160 | Ga0075428_100056280 | 3300006844 | Bacteria | 4308 |
| 161 | Ga0075430_100130844 | 3300006846 | Bacteria | 2091 |
| 162 | Ga0075431_100004173 | 3300006847 | Bacteria | 14131 |
| 163 | Ga0075431_100026694 | 3300006847 | Bacteria | 5923 |
| 164 | Ga0075431_100031095 | 3300006847 | Bacteria | 5498 |
| 165 | Ga0075431_100073702 | 3300006847 | Bacteria | 3522 |
| 166 | Ga0075433_10008265 | 3300006852 | Bacteria | 8293 |
| 167 | Ga0075433_10022191 | 3300006852 | Bacteria | 5328 |
| 168 | Ga0075434_100001646 | 3300006871 | Bacteria | 19020 |
| 169 | Ga0075434_100049658 | 3300006871 | Bacteria | 4166 |
| 170 | Ga0075434_100382652 | 3300006871 | Bacteria | 1428 |
| 171 | Ga0075429_100020985 | 3300006880 | Bacteria | 5667 |
| 172 | Ga0075429_100022660 | 3300006880 | Bacteria | 5445 |
| 173 | Ga0075429_100052570 | 3300006880 | Bacteria | 3545 |
| 174 | Ga0068865_100001326 | 3300006881 | Bacteria | 14415 |
| 175 | Ga0075436_100019703 | 3300006914 | Bacteria | 4625 |
| 176 | Ga0075436_100027136 | 3300006914 | Bacteria | 3942 |
| 177 | Ga0097620_100025734 | 3300006931 | Bacteria | 5901 |
| 178 | Ga0097620_100033870 | 3300006931 | Bacteria | 5128 |
| 179 | Ga0075435_100026374 | 3300007076 | Bacteria | 4532 |
| 180 | Ga0075435_100106976 | 3300007076 | Bacteria | 2323 |
| 181 | Ga0105240_10056163 | 3300009093 | Bacteria | 4927 |
| 182 | Ga0105240_10269194 | 3300009093 | Bacteria | 1962 |
| 183 | Ga0111539_10015556 | 3300009094 | Bacteria | 9458 |
| 184 | Ga0111539_10048481 | 3300009094 | Bacteria | 5071 |
| 185 | Ga0111539_10058017 | 3300009094 | Bacteria | 4594 |
| 186 | Ga0111539_10162510 | 3300009094 | Bacteria | 2611 |
| 187 | Ga0105247_10002044 | 3300009101 | Bacteria | 13970 |
| 188 | Ga0105247_10029304 | 3300009101 | Bacteria | 3334 |
| 189 | Ga0105247_10030975 | 3300009101 | Bacteria | 3244 |
| 190 | Ga0114129_10005905 | 3300009147 | Bacteria | 17321 |
| 191 | Ga0114129_10088933 | 3300009147 | Bacteria | 4282 |
| 192 | Ga0114129_10143068 | 3300009147 | Bacteria | 3277 |
| 193 | Ga0114129_10241304 | 3300009147 | Bacteria | 2429 |
| 194 | Ga0114129_10773022 | 3300009147 | Bacteria | 1227 |
| 195 | Ga0105243_10002388 | 3300009148 | Bacteria | 15736 |
| 196 | Ga0105241_10006277 | 3300009174 | Bacteria | 8763 |
| 197 | Ga0105242_10001841 | 3300009176 | Bacteria | 16658 |
| 198 | Ga0105237_10002959 | 3300009545 | Bacteria | 20556 |
| 199 | Ga0105238_10016025 | 3300009551 | Bacteria | 7581 |
| 200 | Ga0105238_10022211 | 3300009551 | Bacteria | 6469 |
| 201 | Ga0105249_10005201 | 3300009553 | Bacteria | 11228 |
| 202 | Ga0105249_10005964 | 3300009553 | Bacteria | 10558 |
| 203 | Ga0105028_100214 | 3300009993 | Bacteria | 6306 |
| 204 | Ga0099796_10047668 | 3300010159 | Bacteria | 1475 |
| 205 | Ga0105239_10014169 | 3300010375 | Bacteria | 8846 |
| 206 | Ga0105239_10114434 | 3300010375 | Bacteria | 2992 |
| 207 | Ga0157371_10005468 | 3300013102 | Bacteria | 10709 |
| 208 | Ga0157370_10004490 | 3300013104 | Bacteria | 15991 |
| 209 | Ga0157370_10004646 | 3300013104 | Bacteria | 15692 |
| 210 | Ga0157370_10068142 | 3300013104 | Bacteria | 3363 |
| 211 | Ga0157369_10013096 | 3300013105 | Bacteria | 9386 |
| 212 | Ga0157369_10020301 | 3300013105 | Bacteria | 7425 |
| 213 | Ga0157369_10058245 | 3300013105 | Bacteria | 4167 |
| 214 | Ga0157378_10002206 | 3300013297 | Bacteria | 17281 |
| 215 | Ga0163162_10002752 | 3300013306 | Bacteria | 16697 |
| 216 | Ga0157372_10003944 | 3300013307 | Bacteria | 15940 |
| 217 | Ga0157372_10004421 | 3300013307 | Bacteria | 14988 |
| 218 | Ga0157372_10005907 | 3300013307 | Bacteria | 13032 |
| 219 | Ga0157372_10017772 | 3300013307 | Bacteria | 7634 |
| 220 | Ga0157372_10019499 | 3300013307 | Bacteria | 7313 |
| 221 | Ga0157372_10046507 | 3300013307 | Bacteria | 4818 |
| 222 | Ga0157375_10046242 | 3300013308 | Bacteria | 4241 |
| 223 | Ga0157380_10114829 | 3300014326 | Bacteria | 2270 |
| 224 | Ga0157380_10214665 | 3300014326 | Bacteria | 1717 |
| 225 | Ga0157379_10010073 | 3300014968 | Bacteria | 8239 |
| 226 | Ga0157376_10000823 | 3300014969 | Bacteria | 20317 |
| 227 | Ga0163161_10002941 | 3300017792 | Bacteria | 12068 |
| 228 | Ga0163161_10166518 | 3300017792 | Bacteria | 1683 |
| 229 | Ga0213872_10000522 | 3300021361 | Bacteria | 30024 |
| 230 | Ga0213872_10010762 | 3300021361 | Bacteria | 4344 |
| 231 | Ga0213872_10012233 | 3300021361 | Bacteria | 4043 |
| 232 | Ga0213872_10042325 | 3300021361 | Bacteria | 2077 |
| 233 | Ga0213872_10042412 | 3300021361 | Bacteria | 2075 |
| 234 | Ga0213876_10001035 | 3300021384 | Bacteria | 17965 |
| 235 | Ga0213875_10000364 | 3300021388 | Bacteria | 42225 |
| 236 | Ga0213875_10000568 | 3300021388 | Bacteria | 30109 |
| 237 | Ga0213871_10010104 | 3300021441 | Bacteria | 2132 |
| 238 | Ga0213871_10013160 | 3300021441 | Bacteria | 1938 |
| 239 | Ga0209148_1001047 | 3300025254 | Bacteria | 17118 |
| 240 | Ga0209455_1000278 | 3300025272 | Bacteria | 56010 |
| 241 | Ga0209130_1001314 | 3300025284 | Bacteria | 16988 |
| 242 | Ga0209025_1001048 | 3300025294 | Bacteria | 40501 |
| 243 | Ga0209564_1033334 | 3300025295 | Bacteria | 1534 |
| 244 | Ga0209758_1000118 | 3300025297 | Bacteria | 195889 |
| 245 | Ga0209758_1004898 | 3300025297 | Bacteria | 10766 |
| 246 | Ga0209758_1008576 | 3300025297 | Bacteria | 6580 |
| 247 | Ga0207426_1000256 | 3300025302 | Bacteria | 115405 |
| 248 | Ga0207426_1019907 | 3300025302 | Bacteria | 2340 |
| 249 | Ga0209257_1001036 | 3300025304 | Bacteria | 37117 |
| 250 | Ga0207653_10046254 | 3300025885 | Bacteria | 1438 |
| 251 | Ga0207692_10024990 | 3300025898 | Bacteria | 2785 |
| 252 | Ga0207692_10033094 | 3300025898 | Bacteria | 2490 |
| 253 | Ga0207692_10141969 | 3300025898 | Bacteria | 1367 |
| 254 | Ga0207710_10001172 | 3300025900 | Bacteria | 13328 |
| 255 | Ga0207710_10035892 | 3300025900 | Bacteria | 2183 |
| 256 | Ga0207688_10002512 | 3300025901 | Bacteria | 9888 |
| 257 | Ga0207680_10090152 | 3300025903 | Bacteria | 1948 |
| 258 | Ga0207647_10008374 | 3300025904 | Bacteria | 7419 |
| 259 | Ga0207699_10001135 | 3300025906 | Bacteria | 12602 |
| 260 | Ga0207699_10005261 | 3300025906 | Bacteria | 6194 |
| 261 | Ga0207699_10043721 | 3300025906 | Bacteria | 2604 |
| 262 | Ga0207645_10005698 | 3300025907 | Bacteria | 8999 |
| 263 | Ga0207705_10000611 | 3300025909 | Bacteria | 29892 |
| 264 | Ga0207705_10050274 | 3300025909 | Bacteria | 3001 |
| 265 | Ga0207654_10009164 | 3300025911 | Bacteria | 5018 |
| 266 | Ga0207707_10001384 | 3300025912 | Bacteria | 22525 |
| 267 | Ga0207707_10009542 | 3300025912 | Bacteria | 8418 |
| 268 | Ga0207707_10056261 | 3300025912 | Bacteria | 3422 |
| 269 | Ga0207707_10115572 | 3300025912 | Bacteria | 2345 |
| 270 | Ga0207707_10150641 | 3300025912 | Bacteria | 2034 |
| 271 | Ga0207707_10246541 | 3300025912 | Bacteria | 1552 |
| 272 | Ga0207707_10374957 | 3300025912 | Bacteria | 1224 |
| 273 | Ga0207695_10011770 | 3300025913 | Bacteria | 10570 |
| 274 | Ga0207695_10042772 | 3300025913 | Bacteria | 4833 |
| 275 | Ga0207695_10193658 | 3300025913 | Bacteria | 1950 |
| 276 | Ga0207693_10000313 | 3300025915 | Bacteria | 45228 |
| 277 | Ga0207693_10003314 | 3300025915 | Bacteria | 13780 |
| 278 | Ga0207693_10096675 | 3300025915 | Bacteria | 2315 |
| 279 | Ga0207663_10000796 | 3300025916 | Bacteria | 14148 |
| 280 | Ga0207663_10027755 | 3300025916 | Bacteria | 3304 |
| 281 | Ga0207663_10100610 | 3300025916 | Bacteria | 1940 |
| 282 | Ga0207663_10100699 | 3300025916 | Bacteria | 1940 |
| 283 | Ga0207663_10162572 | 3300025916 | Bacteria | 1578 |
| 284 | Ga0207660_10042548 | 3300025917 | Bacteria | 3189 |
| 285 | Ga0207660_10042581 | 3300025917 | Bacteria | 3188 |
| 286 | Ga0207660_10050840 | 3300025917 | Bacteria | 2944 |
| 287 | Ga0207662_10001471 | 3300025918 | Bacteria | 11439 |
| 288 | Ga0207657_10000112 | 3300025919 | Bacteria | 79849 |
| 289 | Ga0207657_10000815 | 3300025919 | Bacteria | 32909 |
| 290 | Ga0207649_10002140 | 3300025920 | Bacteria | 11182 |
| 291 | Ga0207649_10012726 | 3300025920 | Bacteria | 4677 |
| 292 | Ga0207652_10002462 | 3300025921 | Bacteria | 15598 |
| 293 | Ga0207652_10017420 | 3300025921 | Bacteria | 5879 |
| 294 | Ga0207652_10064208 | 3300025921 | Bacteria | 3177 |
| 295 | Ga0207652_10143941 | 3300025921 | Bacteria | 2132 |
| 296 | Ga0207652_10237183 | 3300025921 | Bacteria | 1644 |
| 297 | Ga0207646_10006025 | 3300025922 | Bacteria | 12630 |
| 298 | Ga0207646_10025801 | 3300025922 | Bacteria | 5373 |
| 299 | Ga0207694_10011426 | 3300025924 | Bacteria | 6700 |
| 300 | Ga0207694_10030218 | 3300025924 | Bacteria | 4137 |
| 301 | Ga0207650_10075996 | 3300025925 | Bacteria | 2537 |
| 302 | Ga0207659_10010504 | 3300025926 | Bacteria | 5820 |
| 303 | Ga0207687_10004074 | 3300025927 | Bacteria | 9796 |
| 304 | Ga0207700_10017076 | 3300025928 | Bacteria | 4836 |
| 305 | Ga0207700_10078563 | 3300025928 | Bacteria | 2567 |
| 306 | Ga0207700_10115108 | 3300025928 | Bacteria | 2171 |
| 307 | Ga0207700_10232702 | 3300025928 | Bacteria | 1567 |
| 308 | Ga0207664_10027840 | 3300025929 | Bacteria | 4290 |
| 309 | Ga0207664_10091478 | 3300025929 | Bacteria | 2495 |
| 310 | Ga0207664_10203149 | 3300025929 | Bacteria | 1711 |
| 311 | Ga0207644_10078146 | 3300025931 | Bacteria | 2438 |
| 312 | Ga0207690_10002166 | 3300025932 | Bacteria | 12002 |
| 313 | Ga0207690_10027815 | 3300025932 | Bacteria | 3577 |
| 314 | Ga0207690_10063786 | 3300025932 | Bacteria | 2513 |
| 315 | Ga0207690_10283266 | 3300025932 | Bacteria | 1291 |
| 316 | Ga0207706_10000831 | 3300025933 | Bacteria | 32015 |
| 317 | Ga0207686_10008320 | 3300025934 | Bacteria | 5596 |
| 318 | Ga0207670_10010280 | 3300025936 | Bacteria | 5382 |
| 319 | Ga0207669_10040421 | 3300025937 | Bacteria | 2705 |
| 320 | Ga0207665_10000565 | 3300025939 | Bacteria | 24973 |
| 321 | Ga0207665_10123515 | 3300025939 | Bacteria | 1831 |
| 322 | Ga0207691_10000623 | 3300025940 | Bacteria | 35146 |
| 323 | Ga0207711_10047762 | 3300025941 | Bacteria | 3661 |
| 324 | Ga0207689_10024023 | 3300025942 | Bacteria | 5113 |
| 325 | Ga0207689_10033128 | 3300025942 | Bacteria | 4293 |
| 326 | Ga0207661_10065820 | 3300025944 | Bacteria | 2943 |
| 327 | Ga0207679_10272539 | 3300025945 | Bacteria | 1448 |
| 328 | Ga0207667_10027474 | 3300025949 | Bacteria | 6193 |
| 329 | Ga0207651_10003894 | 3300025960 | Bacteria | 7408 |
| 330 | Ga0207712_10005840 | 3300025961 | Bacteria | 7758 |
| 331 | Ga0207712_10006060 | 3300025961 | Bacteria | 7628 |
| 332 | Ga0207668_10004522 | 3300025972 | Bacteria | 8179 |
| 333 | Ga0207668_10335772 | 3300025972 | Bacteria | 1259 |
| 334 | Ga0207640_10004889 | 3300025981 | Bacteria | 7282 |
| 335 | Ga0207658_10006904 | 3300025986 | Bacteria | 7731 |
| 336 | Ga0207658_10081453 | 3300025986 | Bacteria | 2482 |
| 337 | Ga0207677_10038570 | 3300026023 | Bacteria | 3134 |
| 338 | Ga0207703_10015180 | 3300026035 | Bacteria | 6010 |
| 339 | Ga0207639_10005657 | 3300026041 | Bacteria | 8459 |
| 340 | Ga0207639_10184842 | 3300026041 | Bacteria | 1776 |
| 341 | Ga0207678_10000086 | 3300026067 | Bacteria | 76696 |
| 342 | Ga0207708_10002960 | 3300026075 | Bacteria | 12517 |
| 343 | Ga0207702_10013420 | 3300026078 | Bacteria | 6811 |
| 344 | Ga0207702_10084239 | 3300026078 | Bacteria | 2768 |
| 345 | Ga0207641_10008810 | 3300026088 | Bacteria | 8333 |
| 346 | Ga0207641_10033633 | 3300026088 | Bacteria | 4259 |
| 347 | Ga0207648_10068154 | 3300026089 | Bacteria | 3100 |
| 348 | Ga0207676_10023761 | 3300026095 | Bacteria | 4528 |
| 349 | Ga0207676_10158426 | 3300026095 | Bacteria | 1959 |
| 350 | Ga0207674_10003298 | 3300026116 | Bacteria | 19855 |
| 351 | Ga0207675_100000111 | 3300026118 | Bacteria | 66086 |
| 352 | Ga0207683_10000120 | 3300026121 | Bacteria | 64461 |
| 353 | Ga0207698_10035109 | 3300026142 | Bacteria | 3664 |
| 354 | Ga0209813_10002716 | 3300027866 | Bacteria | 4076 |
| 355 | Ga0209813_10062136 | 3300027866 | Bacteria | 1194 |
| 356 | Ga0207428_10109023 | 3300027907 | Bacteria | 2132 |
| 357 | Ga0268266_10002921 | 3300028379 | Bacteria | 17677 |
| 358 | Ga0268266_10069557 | 3300028379 | Bacteria | 3050 |
| 359 | Ga0268265_10161166 | 3300028380 | Bacteria | 1905 |
| 360 | Ga0268264_10010894 | 3300028381 | Bacteria | 7512 |
| 361 | Ga0265337_1003396 | 3300028556 | Bacteria | 6915 |
| 362 | Ga0265318_10007334 | 3300028577 | Bacteria | 4992 |
| 363 | Ga0265338_10007502 | 3300028800 | Bacteria | 13509 |
| 364 | Ga0265338_10013718 | 3300028800 | Bacteria | 9114 |
| 365 | Ga0265324_10002634 | 3300029957 | Bacteria | 8991 |
| 366 | Ga0265330_10085312 | 3300031235 | Bacteria | 1358 |
| 367 | Ga0265332_10006311 | 3300031238 | Bacteria | 5389 |
| 368 | Ga0265332_10016725 | 3300031238 | Bacteria | 3237 |
| 369 | Ga0265328_10001788 | 3300031239 | Bacteria | 9801 |
| 370 | Ga0265320_10003600 | 3300031240 | Bacteria | 10356 |
| 371 | Ga0265320_10032282 | 3300031240 | Bacteria | 2683 |
| 372 | Ga0265325_10022538 | 3300031241 | Bacteria | 3449 |
| 373 | Ga0265340_10000319 | 3300031247 | Bacteria | 25435 |
| 374 | Ga0265340_10003799 | 3300031247 | Bacteria | 8509 |
| 375 | Ga0265331_10000156 | 3300031250 | Bacteria | 87128 |
| 376 | Ga0265331_10002640 | 3300031250 | Bacteria | 12017 |
| 377 | Ga0265331_10002733 | 3300031250 | Bacteria | 11750 |
| 378 | Ga0265331_10002902 | 3300031250 | Bacteria | 11329 |
| 379 | Ga0265327_10000297 | 3300031251 | Bacteria | 96213 |
| 380 | Ga0265327_10000543 | 3300031251 | Bacteria | 64532 |
| 381 | Ga0265327_10020336 | 3300031251 | Bacteria | 4049 |
| 382 | Ga0265316_10052395 | 3300031344 | Bacteria | 3202 |
| 383 | Ga0265316_10061570 | 3300031344 | Bacteria | 2914 |
| 384 | Ga0307513_10048697 | 3300031456 | Bacteria | 4597 |
| 385 | Ga0265313_10000913 | 3300031595 | Bacteria | 29513 |
| 386 | Ga0265313_10001440 | 3300031595 | Bacteria | 22235 |
| 387 | Ga0265313_10001587 | 3300031595 | Bacteria | 21094 |
| 388 | Ga0265313_10006326 | 3300031595 | Bacteria | 8425 |
| 389 | Ga0265313_10039421 | 3300031595 | Bacteria | 2343 |
| 390 | Ga0265314_10003764 | 3300031711 | Bacteria | 14507 |
| 391 | Ga0265314_10007122 | 3300031711 | Bacteria | 9747 |
| 392 | Ga0265314_10007521 | 3300031711 | Bacteria | 9441 |
| 393 | Ga0265314_10105106 | 3300031711 | Bacteria | 1806 |
| 394 | Ga0265342_10018018 | 3300031712 | Bacteria | 4583 |
| 395 | Ga0316576_10182422 | 3300031727 | Bacteria | 1583 |
| 396 | Ga0316578_10097282 | 3300031728 | Bacteria | 1763 |
| 397 | Ga0307405_10340446 | 3300031731 | Bacteria | 1153 |
| 398 | Ga0373934_0023656 | 3300035086 | Bacteria | 2374 |
| 399 | Ga0373940_0039470 | 3300035088 | Bacteria | 1292 |
| 400 | Ga0373949_0001990 | 3300035090 | Bacteria | 5461 |
| 401 | Ga0373932_0008825 | 3300035112 | Bacteria | 2413 |
| 402 | Ga0373939_0000816 | 3300035114 | Bacteria | 7695 |
| 403 | Ga0373941_0006433 | 3300035115 | Bacteria | 2831 |
| 404 | Ga0373941_0016386 | 3300035115 | Bacteria | 2013 |
| 405 | Ga0373953_0006842 | 3300035117 | Bacteria | 3783 |
| 406 | Ga0373953_0045262 | 3300035117 | Bacteria | 1763 |
| 407 | Ga0373954_0033397 | 3300035118 | Bacteria | 2381 |
| 408 | Ga0373956_0080342 | 3300035119 | Bacteria | 1496 |
| 409 | Ga0373960_0001630 | 3300035121 | Bacteria | 5014 |
| 410 | Ga0373943_0029155 | 3300035170 | Bacteria | 2606 |
| 411 | Ga0373955_0114047 | 3300035172 | Bacteria | 1565 |
| 412 | Ga0373962_0007067 | 3300035242 | Bacteria | 2742 |
| 413 | Ga0316574_0036442 | 3300035398 | Bacteria | 3011 |
| 414 | Ga0373931_0004913 | 3300035691 | Bacteria | 6147 |
| 415 | Ga0373931_0020651 | 3300035691 | Bacteria | 3297 |
| 416 | Ga0373931_0255950 | 3300035691 | Bacteria | 1066 |
| 417 | Ga0373935_0012331 | 3300035692 | Bacteria | 5143 |
| 418 | Ga0373933_0031028 | 3300035724 | Bacteria | 3098 |
| 419 | Ga0373947_0005812 | 3300035725 | Bacteria | 7193 |
| 420 | Ga0373947_0015921 | 3300035725 | Bacteria | 4320 |
| 421 | Ga0373937_0000540 | 3300036401 | Bacteria | 33623 |
| 422 | Ga0373937_0009309 | 3300036401 | Bacteria | 8528 |
| 423 | Ga0373937_0009654 | 3300036401 | Bacteria | 8403 |
| 424 | Ga0373937_0066603 | 3300036401 | Bacteria | 3317 |
| 425 | Ga0373937_0499738 | 3300036401 | Bacteria | 1155 |
| 426 | Ga0316584_0021379 | 3300036712 | Bacteria | 4702 |
| 427 | Ga0316584_0099391 | 3300036712 | Bacteria | 2179 |
| 428 | Ga0373925_0002418 | 3300037068 | Bacteria | 14974 |
| 429 | Ga0395899_0039525 | 3300037312 | Bacteria | 3531 |
| 430 | Ga0395900_0015652 | 3300037418 | Bacteria | 7732 |
| 431 | Ga0395900_0113947 | 3300037418 | Bacteria | 2775 |
| 432 | Ga0395898_0300389 | 3300037466 | Bacteria | 1532 |
| 433 | Ga0395905_0002147 | 3300037471 | Bacteria | 22373 |
| 434 | Ga0395905_0175560 | 3300037471 | Bacteria | 2012 |
| 435 | Ga0436364_0067731 | 3300037853 | Bacteria | 42277 |
| 436 | Ga0436364_0639582 | 3300037853 | Bacteria | 14262 |
| 437 | Ga0395901_0008188 | 3300038443 | Bacteria | 10567 |
| 438 | Ga0400483_055840 | 3300039062 | Bacteria | 4269 |
| 439 | Ga0400483_110392 | 3300039062 | Bacteria | 37401 |
| 440 | Ga0400483_151200 | 3300039062 | Bacteria | 17559 |
| 441 | Ga0400483_184879 | 3300039062 | Bacteria | 6517 |
| 442 | Ga0400483_198838 | 3300039062 | Bacteria | 2660 |
| 443 | Ga0436365_0229005 | 3300039437 | Bacteria | 20037 |
| 444 | Ga0436365_0457441 | 3300039437 | Bacteria | 3699 |
| 445 | Ga0436365_1325603 | 3300039437 | Bacteria | 1670 |
| 446 | Ga0436365_1712708 | 3300039437 | Bacteria | 68148 |
| 447 | Ga0436365_1888495 | 3300039437 | Bacteria | 1202 |
| 448 | Ga0436360_0040490 | 3300039438 | Bacteria | 5741 |
| 449 | Ga0436361_0064010 | 3300039447 | Bacteria | 1867 |
| 450 | Ga0436361_0199013 | 3300039447 | Bacteria | 2151 |
| 451 | Ga0436361_0351574 | 3300039447 | Bacteria | 5016 |
| 452 | Ga0436361_0358253 | 3300039447 | Bacteria | 1994 |
| 453 | Ga0436361_0814479 | 3300039447 | Bacteria | 4151 |
| 454 | Ga0436361_1182689 | 3300039447 | Bacteria | 35500 |
| 455 | Ga0436363_0082910 | 3300039450 | Bacteria | 4465 |
| 456 | Ga0436363_0912598 | 3300039450 | Bacteria | 1904 |
| 457 | Ga0436362_0291175 | 3300039453 | Bacteria | 2572 |
| 458 | Ga0436362_0473767 | 3300039453 | Bacteria | 2629 |
| 459 | Ga0436362_1067723 | 3300039453 | Bacteria | 7427 |
| 460 | Ga0436362_1083403 | 3300039453 | Bacteria | 2315 |
| 461 | Ga0436362_1095303 | 3300039453 | Bacteria | 2458 |
| 462 | Ga0439448_0041596 | 3300042005 | Bacteria | 1488 |
| 463 | Ga0439440_0013740 | 3300042993 | Bacteria | 1741 |
| 464 | Ga0453683_0017308 | 3300044673 | Bacteria | 4643 |
| 465 | Ga0453684_0000062 | 3300044712 | Bacteria | 487590 |
| 466 | Ga0453684_0000071 | 3300044712 | Bacteria | 448904 |
| 467 | Ga0453684_0028882 | 3300044712 | Bacteria | 7894 |
| 468 | Ga0453684_0039359 | 3300044712 | Bacteria | 6445 |
| 469 | Ga0453684_0081616 | 3300044712 | Bacteria | 4032 |
| 470 | Ga0466960_0070512 | 3300044901 | Bacteria | 1739 |
| 471 | Ga0451576_0005756 | 3300045051 | Bacteria | 15432 |
| 472 | Ga0451576_0014949 | 3300045051 | Bacteria | 8620 |
| 473 | Ga0451576_0047602 | 3300045051 | Bacteria | 4507 |
| 474 | Ga0451576_0053851 | 3300045051 | Bacteria | 4213 |
| 475 | Ga0466958_0000103 | 3300045836 | Bacteria | 26961 |
| 476 | Ga0495603_0000690 | 3300046455 | Bacteria | 19141 |
| 477 | Ga0495603_0158632 | 3300046455 | Bacteria | 1312 |
| 478 | Ga0495629_0019650 | 3300046459 | Bacteria | 4823 |
| 479 | Ga0495629_0248872 | 3300046459 | Bacteria | 1223 |
| 480 | Ga0495641_0017633 | 3300046461 | Bacteria | 3713 |
| 481 | Ga0495639_0004560 | 3300046475 | Bacteria | 5939 |
| 482 | Ga0495610_0048438 | 3300046512 | Bacteria | 2086 |
| 483 | Ga0495652_0074354 | 3300046529 | Bacteria | 2826 |
| 484 | Ga0495665_0025230 | 3300046531 | Bacteria | 3193 |
| 485 | Ga0495640_0069595 | 3300046533 | Bacteria | 2367 |
| 486 | Ga0495586_0002921 | 3300046535 | Bacteria | 9221 |
| 487 | Ga0495587_0084592 | 3300046536 | Bacteria | 1837 |
| 488 | Ga0495622_0005959 | 3300046557 | Bacteria | 5664 |
| 489 | Ga0495667_0106891 | 3300046559 | Bacteria | 1808 |
| 490 | Ga0495634_0014400 | 3300046642 | Bacteria | 5704 |
| 491 | Ga0495635_0045185 | 3300046663 | Bacteria | 3039 |
| 492 | Ga0495588_0000969 | 3300046674 | Bacteria | 12540 |
| 493 | Ga0495657_0109608 | 3300046675 | Bacteria | 1751 |
| 494 | Ga0495658_0000923 | 3300046683 | Bacteria | 15683 |
| 495 | Ga0495676_0034205 | 3300047321 | Bacteria | 4267 |
| 496 | Ga0495593_0003109 | 3300047673 | Bacteria | 9989 |
| 497 | Ga0496100_0009697 | 3300048903 | Bacteria | 5417 |
| 498 | Ga0496100_0299803 | 3300048903 | Bacteria | 1203 |
| 499 | Ga0496102_0011444 | 3300048905 | Bacteria | 7650 |
| 500 | Ga0496104_0003861 | 3300048907 | Bacteria | 12964 |
| 501 | Ga0496104_0010979 | 3300048907 | Bacteria | 8103 |
| 502 | Ga0496105_0019762 | 3300048908 | Bacteria | 5435 |
| 503 | Ga0496105_0069631 | 3300048908 | Bacteria | 2907 |
| 504 | Ga0496106_0002044 | 3300048909 | Bacteria | 15165 |
| 505 | Ga0496106_0077617 | 3300048909 | Bacteria | 2547 |
| 506 | Ga0496107_0018779 | 3300048910 | Bacteria | 4872 |
| 507 | Ga0496108_0001756 | 3300048911 | Bacteria | 17236 |
| 508 | Ga0496108_0193563 | 3300048911 | Bacteria | 1763 |
| 509 | Ga0496109_0027625 | 3300048912 | Bacteria | 5069 |
| 510 | Ga0496109_0032755 | 3300048912 | Bacteria | 4674 |
| 511 | Ga0496109_0172163 | 3300048912 | Bacteria | 2031 |
| 512 | Ga0496110_0010414 | 3300048913 | Bacteria | 7559 |
| 513 | Ga0496111_0020287 | 3300048914 | Bacteria | 4625 |
| 514 | Ga0496112_0004975 | 3300048915 | Bacteria | 11392 |
| 515 | Ga0496112_0257853 | 3300048915 | Bacteria | 1694 |
| 516 | Ga0496113_0015848 | 3300048916 | Bacteria | 5194 |
| 517 | Ga0496113_0018386 | 3300048916 | Bacteria | 4867 |
| 518 | Ga0496113_0090010 | 3300048916 | Bacteria | 2363 |
| 519 | Ga0496114_0011862 | 3300048917 | Bacteria | 6973 |
| 520 | Ga0496115_0049764 | 3300048918 | Bacteria | 3355 |
| 521 | Ga0496120_0099444 | 3300048923 | Bacteria | 1540 |
| 522 | Ga0496122_0071515 | 3300048925 | Bacteria | 2472 |
| 523 | Ga0501031_0017066 | 3300049568 | Bacteria | 4716 |
| 524 | Ga0501031_0033529 | 3300049568 | Bacteria | 3350 |
| 525 | Ga0501031_0072612 | 3300049568 | Bacteria | 2240 |
| 526 | Ga0501031_0088173 | 3300049568 | Bacteria | 2023 |
| 527 | Ga0501032_0000002 | 3300049569 | Bacteria | 335417 |
| 528 | Ga0501032_0004236 | 3300049569 | Bacteria | 10846 |
| 529 | Ga0501034_0000001 | 3300049571 | Bacteria | 2184493 |
| 530 | Ga0501034_0372268 | 3300049571 | Bacteria | 1354 |
| 531 | Ga0501036_0008719 | 3300049572 | Bacteria | 8320 |
| 532 | Ga0501036_0039766 | 3300049572 | Bacteria | 3979 |
| 533 | Ga0501036_0061894 | 3300049572 | Bacteria | 3170 |
| 534 | Ga0501036_0104350 | 3300049572 | Bacteria | 2397 |
| 535 | Ga0501036_0166448 | 3300049572 | Bacteria | 1858 |
| 536 | Ga0501038_0000011 | 3300049574 | Bacteria | 181217 |
| 537 | Ga0501038_0041508 | 3300049574 | Bacteria | 4012 |
| 538 | Ga0501038_0049012 | 3300049574 | Bacteria | 3653 |
| 539 | Ga0501039_0000006 | 3300049575 | Bacteria | 278135 |
| 540 | Ga0501039_0013493 | 3300049575 | Bacteria | 6248 |
| 541 | Ga0501039_0059289 | 3300049575 | Bacteria | 2965 |
| 542 | Ga0501040_0003946 | 3300049576 | Bacteria | 9630 |
| 543 | Ga0501040_0004178 | 3300049576 | Bacteria | 9394 |
| 544 | Ga0501040_0082631 | 3300049576 | Bacteria | 2227 |
| 545 | Ga0501040_0199374 | 3300049576 | Bacteria | 1421 |
| 546 | Ga0501040_0283372 | 3300049576 | Bacteria | 1184 |
| 547 | Ga0501041_0005041 | 3300049577 | Bacteria | 7689 |
| 548 | Ga0501041_0030948 | 3300049577 | Bacteria | 3230 |
| 549 | Ga0501041_0090708 | 3300049577 | Bacteria | 1887 |
| 550 | Ga0501041_0097666 | 3300049577 | Bacteria | 1816 |
| 551 | Ga0501041_0144658 | 3300049577 | Bacteria | 1483 |
| 552 | Ga0501042_0146531 | 3300049578 | Bacteria | 1702 |
| 553 | Ga0501043_0001441 | 3300049579 | Bacteria | 20804 |
| 554 | Ga0501043_0272250 | 3300049579 | Bacteria | 1300 |
| 555 | Ga0501046_0000246 | 3300049580 | Bacteria | 55453 |
| 556 | Ga0501046_0038092 | 3300049580 | Bacteria | 3861 |
| 557 | Ga0501046_0288842 | 3300049580 | Bacteria | 1200 |
| 558 | Ga0501047_0009299 | 3300049581 | Bacteria | 9282 |
| 559 | Ga0501047_0052314 | 3300049581 | Bacteria | 3947 |
| 560 | Ga0501048_0006578 | 3300049582 | Bacteria | 8834 |
| 561 | Ga0501048_0074692 | 3300049582 | Bacteria | 2392 |
| 562 | Ga0501048_0100460 | 3300049582 | Bacteria | 2041 |
| 563 | Ga0501048_0153520 | 3300049582 | Bacteria | 1629 |
| 564 | Ga0501067_0017826 | 3300049583 | Bacteria | 3931 |
| 565 | Ga0501067_0098794 | 3300049583 | Bacteria | 1621 |
| 566 | Ga0501068_0018602 | 3300049584 | Bacteria | 4023 |
| 567 | Ga0501068_0158464 | 3300049584 | Bacteria | 1426 |
| 568 | Ga0501069_0019612 | 3300049585 | Bacteria | 3658 |
| 569 | Ga0501069_0063131 | 3300049585 | Bacteria | 2069 |
| 570 | Ga0501070_0000031 | 3300049586 | Bacteria | 138137 |
| 571 | Ga0501070_0000540 | 3300049586 | Bacteria | 34697 |
| 572 | Ga0501070_0041326 | 3300049586 | Bacteria | 3842 |
| 573 | Ga0501070_0065393 | 3300049586 | Bacteria | 3011 |
| 574 | Ga0501070_0127387 | 3300049586 | Bacteria | 2104 |
| 575 | Ga0501071_0040237 | 3300049587 | Bacteria | 3345 |
| 576 | Ga0501071_0068569 | 3300049587 | Bacteria | 2581 |
| 577 | Ga0501071_0113875 | 3300049587 | Bacteria | 2000 |
| 578 | Ga0501072_0002691 | 3300049588 | Bacteria | 13336 |
| 579 | Ga0501072_0024741 | 3300049588 | Bacteria | 4673 |
| 580 | Ga0501072_0106659 | 3300049588 | Bacteria | 2228 |
| 581 | Ga0501073_0005304 | 3300049589 | Bacteria | 9668 |
| 582 | Ga0501073_0034322 | 3300049589 | Bacteria | 3611 |
| 583 | Ga0501073_0101348 | 3300049589 | Bacteria | 1999 |
| 584 | Ga0501074_0022854 | 3300049590 | Bacteria | 4547 |
| 585 | Ga0501074_0036465 | 3300049590 | Bacteria | 3562 |
| 586 | Ga0501074_0080025 | 3300049590 | Bacteria | 2345 |
| 587 | Ga0501075_0005490 | 3300049591 | Bacteria | 8676 |
| 588 | Ga0501075_0024067 | 3300049591 | Bacteria | 4459 |
| 589 | Ga0501075_0087915 | 3300049591 | Bacteria | 2355 |
| 590 | Ga0501076_0011183 | 3300049592 | Bacteria | 6679 |
| 591 | Ga0501076_0031005 | 3300049592 | Bacteria | 4167 |
| 592 | Ga0501076_0037448 | 3300049592 | Bacteria | 3804 |
| 593 | Ga0501076_0057399 | 3300049592 | Bacteria | 3091 |
| 594 | Ga0501076_0064657 | 3300049592 | Bacteria | 2916 |
| 595 | Ga0501077_0003004 | 3300049593 | Bacteria | 10116 |
| 596 | Ga0501077_0007974 | 3300049593 | Bacteria | 6545 |
| 597 | Ga0501077_0009385 | 3300049593 | Bacteria | 6079 |
| 598 | Ga0501077_0011442 | 3300049593 | Bacteria | 5542 |
| 599 | Ga0501077_0024163 | 3300049593 | Bacteria | 3858 |
| 600 | Ga0501079_0061874 | 3300049741 | Bacteria | 2887 |
| 601 | Ga0501079_0070704 | 3300049741 | Bacteria | 2695 |
| 602 | Ga0501079_0091873 | 3300049741 | Bacteria | 2352 |
| 603 | Ga0501079_0095708 | 3300049741 | Bacteria | 2301 |
| 604 | Ga0501079_0135921 | 3300049741 | Bacteria | 1914 |
| 605 | Ga0501080_0027989 | 3300049742 | Bacteria | 5241 |
| 606 | Ga0501080_0033719 | 3300049742 | Bacteria | 4780 |
| 607 | Ga0501080_0063844 | 3300049742 | Bacteria | 3426 |
| 608 | Ga0501080_0200345 | 3300049742 | Bacteria | 1833 |
| 609 | Ga0501080_0203088 | 3300049742 | Bacteria | 1819 |
| 610 | Ga0501080_0259918 | 3300049742 | Bacteria | 1582 |
| 611 | Ga0501080_0266840 | 3300049742 | Bacteria | 1559 |
| 612 | Ga0501081_0005212 | 3300049743 | Bacteria | 8371 |
| 613 | Ga0501081_0012541 | 3300049743 | Bacteria | 5573 |
| 614 | Ga0501081_0014229 | 3300049743 | Bacteria | 5246 |
| 615 | Ga0501081_0057742 | 3300049743 | Bacteria | 2684 |
| 616 | Ga0501083_0010030 | 3300049744 | Bacteria | 6682 |
| 617 | Ga0501083_0010058 | 3300049744 | Bacteria | 6670 |
| 618 | Ga0501083_0015131 | 3300049744 | Bacteria | 5401 |
| 619 | Ga0501083_0031936 | 3300049744 | Bacteria | 3612 |
| 620 | Ga0501083_0044898 | 3300049744 | Bacteria | 2991 |
| 621 | Ga0501083_0229074 | 3300049744 | Bacteria | 1210 |
| 622 | Ga0501035_0024295 | 3300049822 | Bacteria | 5558 |
| 623 | Ga0501035_0065866 | 3300049822 | Bacteria | 3216 |
| 624 | Ga0501044_0004918 | 3300049823 | Bacteria | 14936 |
| 625 | Ga0501044_0010458 | 3300049823 | Bacteria | 10071 |
| 626 | Ga0501044_0013991 | 3300049823 | Bacteria | 8667 |
| 627 | Ga0501044_0031163 | 3300049823 | Bacteria | 5614 |
| 628 | Ga0501044_0033244 | 3300049823 | Bacteria | 5421 |
| 629 | Ga0501044_0048091 | 3300049823 | Bacteria | 4408 |
| 630 | Ga0501044_0201516 | 3300049823 | Bacteria | 1948 |
| 631 | Ga0501045_0003999 | 3300049824 | Bacteria | 10152 |
| 632 | Ga0501045_0011608 | 3300049824 | Bacteria | 6186 |
| 633 | Ga0501045_0096220 | 3300049824 | Bacteria | 2191 |
| 634 | Ga0501045_0172435 | 3300049824 | Bacteria | 1611 |
| 635 | nmdc:mga03n38_3206_c1 | 3300050490 | Bacteria | 5212 |
| 636 | nmdc:mga0yw44_24908_c1 | 3300050492 | Bacteria | 3394 |
| 637 | nmdc:mga06z11_22729_c1 | 3300050494 | Bacteria | 2934 |
| 638 | nmdc:mga06z11_43395_c1 | 3300050494 | Bacteria | 2262 |
| 639 | nmdc:mga04h51_6493_c1 | 3300050495 | Bacteria | 3035 |
| 640 | nmdc:mga05p37_269707_c1 | 3300050507 | Bacteria | 2034 |
| 641 | nmdc:mga05p37_310591_c1 | 3300050507 | Bacteria | 1869 |
| 642 | nmdc:mga05p37_336861_c1 | 3300050507 | Bacteria | 1780 |
| 643 | nmdc:mga09592_27224_c1 | 3300050508 | Bacteria | 4744 |
| 644 | nmdc:mga0qj67_363851_c1 | 3300050509 | Bacteria | 1169 |
| 645 | nmdc:mga06r32_136447_c1 | 3300050510 | Bacteria | 2428 |
| 646 | nmdc:mga06r32_96940_c1 | 3300050510 | Bacteria | 2889 |
| 647 | nmdc:mga08y16_292236_c1 | 3300050511 | Bacteria | 1680 |
| 648 | nmdc:mga08y16_295319_c1 | 3300050511 | Bacteria | 1671 |
| 649 | nmdc:mga08y16_50457_c1 | 3300050511 | Bacteria | 4354 |
| 650 | nmdc:mga08y16_83016_c1 | 3300050511 | Bacteria | 3340 |
| 651 | nmdc:mga0n895_104034_c1 | 3300050512 | Bacteria | 2851 |
| 652 | nmdc:mga0n895_34632_c1 | 3300050512 | Bacteria | 4863 |
| 653 | nmdc:mga0n895_83649_c1 | 3300050512 | Bacteria | 3184 |
| 654 | nmdc:mga0rr50_27699_c1 | 3300050513 | Bacteria | 3973 |
| 655 | nmdc:mga08x19_250750_c1 | 3300050514 | Bacteria | 1222 |
| 656 | nmdc:mga08x19_8007_c1 | 3300050514 | Bacteria | 6280 |
| 657 | nmdc:mga08x19_85249_c1 | 3300050514 | Bacteria | 2079 |
| 658 | nmdc:mga0a205_2329_c1 | 3300050515 | Bacteria | 16759 |
| 659 | Ga0495601_0021555 | 3300053077 | Bacteria | 3947 |
| 660 | Ga0495601_0025847 | 3300053077 | Bacteria | 3622 |
| 661 | Ga0495612_0028965 | 3300053078 | Bacteria | 2229 |
| 662 | Ga0495595_0011852 | 3300053084 | Bacteria | 3655 |
| 663 | Ga0495619_0000737 | 3300053085 | Bacteria | 21356 |
| 664 | Ga0495619_0031973 | 3300053085 | Bacteria | 3412 |
| 665 | Ga0495619_0089592 | 3300053085 | Bacteria | 2081 |
| 666 | Ga0500651_0012206 | 3300053093 | Bacteria | 5205 |
| 667 | Ga0500555_031749 | 3300053103 | Bacteria | 1495 |
| 668 | Ga0500556_0000427 | 3300053104 | Bacteria | 30287 |
| 669 | Ga0500594_0038888 | 3300053118 | Bacteria | 1291 |
| 670 | Ga0500595_011938 | 3300053119 | Bacteria | 3378 |
| 671 | Ga0500595_033222 | 3300053119 | Bacteria | 1713 |
| 672 | Ga0500642_0001673 | 3300053130 | Bacteria | 6401 |
| 673 | Ga0500658_0007005 | 3300053134 | Bacteria | 4171 |
| 674 | Ga0500568_0025146 | 3300053139 | Bacteria | 2516 |
| 675 | Ga0500588_0004817 | 3300053146 | Bacteria | 2947 |
| 676 | Ga0500616_0000548 | 3300053153 | Bacteria | 46717 |
| 677 | Ga0500616_0015133 | 3300053153 | Bacteria | 4418 |
| 678 | Ga0500616_0018717 | 3300053153 | Bacteria | 3913 |
| 679 | Ga0500645_025159 | 3300053730 | Bacteria | 1817 |
| 680 | Ga0501084_0000658 | 3300054114 | Bacteria | 26356 |
| 681 | Ga0501084_0006920 | 3300054114 | Bacteria | 9335 |
| 682 | Ga0501084_0015177 | 3300054114 | Bacteria | 6385 |
| 683 | Ga0501084_0022794 | 3300054114 | Bacteria | 5226 |
| 684 | Ga0501084_0024755 | 3300054114 | Bacteria | 5009 |
| 685 | Ga0501084_0038055 | 3300054114 | Bacteria | 4021 |
| 686 | Ga0501084_0039332 | 3300054114 | Bacteria | 3956 |
| 687 | Ga0501084_0135754 | 3300054114 | Bacteria | 2071 |
| 688 | Ga0501084_0247083 | 3300054114 | Bacteria | 1506 |
| 689 | Ga0587111_0019506 | 3300060346 | Bacteria | 1287 |
| 690 | Ga0501082_0004559 | 3300060353 | Bacteria | 12095 |
| 691 | Ga0501082_0051106 | 3300060353 | Bacteria | 3563 |
| 692 | Ga0501082_0061771 | 3300060353 | Bacteria | 3225 |
| 693 | Ga0501082_0088115 | 3300060353 | Bacteria | 2678 |
| 694 | Ga0530510_0010850 | 3300061734 | Bacteria | 6391 |
| 695 | Ga0530510_0014376 | 3300061734 | Bacteria | 5581 |
| 696 | Ga0530510_0017882 | 3300061734 | Bacteria | 5027 |
| 697 | Ga0530510_0024825 | 3300061734 | Bacteria | 4283 |
| 698 | Ga0530510_0092650 | 3300061734 | Bacteria | 2205 |
| 699 | 2512033911 | 2511231221 | Bacteria | 6846400 |
| 700 | 2523106899 | 2522572158 | Bacteria | 6514390 |
| 701 | 2524610456 | 2524023250 | Bacteria | 5457705 |
| 702 | 2599103501 | 2597490356 | Bacteria | 7030811 |
| 703 | 2821444496 | 2821443989 | Bacteria | 7658172 |
| 704 | 2842336289 | 2842333319 | Bacteria | 8899485 |
| 705 | 2844538575 | 2844533157 | Bacteria | 7517899 |
| 706 | 2846953388 | 2846952575 | Bacteria | 6587527 |
| 707 | 2848858862 | 2848858292 | Bacteria | 7391279 |
| 708 | 2883293017 | 2883291878 | Bacteria | 5894118 |
| 709 | 2883356010 | 2883354860 | Bacteria | 5865246 |
| 710 | 2897803633 | 2897803580 | Bacteria | 7000062 |
| 711 | 8054004603 | 8054002106 | Bacteria | 7987183 |
| 712 | Ga0070681_10069314 | |||
| 713 | JGI24750J21931_1000838 | |||
| 714 | JGI25159J45721_1016009 | |||
| 715 | JGI25151J46595_10000322 | |||
| 716 | rootH2_10010650 | |||
| 717 | rootH2_10112849 | |||
| 718 | Ga0070658_10008981 | |||
| 719 | Ga0070676_10015589 | |||
| 720 | Ga0070690_100000545 | |||
| 721 | Ga0068869_100006528 | |||
| 722 | Ga0068869_100008839 | |||
| 723 | Ga0070666_10006691 | |||
| 724 | Ga0070680_100001616 | |||
| 725 | Ga0070680_100013279 | |||
| 726 | Ga0070680_100021600 | |||
| 727 | Ga0070680_100042301 | |||
| 728 | Ga0070680_100102652 | |||
| 729 | Ga0070682_100025901 | |||
| 730 | Ga0068868_100005849 | |||
| 731 | Ga0070660_100001055 | |||
| 732 | Ga0070660_100045376 | |||
| 733 | Ga0070689_100001025 | |||
| 734 | Ga0070691_10000109 | |||
| 735 | Ga0070691_10000961 | |||
| 736 | Ga0070687_100002739 | |||
| 737 | Ga0070661_100006555 | |||
| 738 | Ga0070692_10001523 | |||
| 739 | Ga0070668_100000323 | |||
| 740 | Ga0070669_100023518 | |||
| 741 | Ga0070675_100051976 | |||
| 742 | Ga0070671_100001054 | |||
| 743 | Ga0070671_100042353 | |||
| 744 | Ga0070674_100001030 | |||
| 745 | Ga0070673_100001383 | |||
| 746 | Ga0070688_100000138 | |||
| 747 | Ga0070659_100000915 | |||
| 748 | Ga0070659_100043396 | |||
| 749 | Ga0070667_100002638 | |||
| 750 | Ga0070703_10000738 | |||
| 751 | Ga0070709_10000884 | |||
| 752 | Ga0070709_10033679 | |||
| 753 | Ga0070709_10088251 | |||
| 754 | Ga0070714_100011691 | |||
| 755 | Ga0070714_100013118 | |||
| 756 | Ga0070714_100172541 | |||
| 757 | Ga0070714_100180187 | |||
| 758 | Ga0070713_100005717 | |||
| 759 | Ga0070713_100092305 | |||
| 760 | Ga0070713_100111360 | |||
| 761 | Ga0070710_10006960 | |||
| 762 | Ga0070710_10010173 | |||
| 763 | Ga0070710_10166391 | |||
| 764 | Ga0070701_10003317 | |||
| 765 | Ga0070711_100005929 | |||
| 766 | Ga0070711_100011564 | |||
| 767 | Ga0070711_100027625 | |||
| 768 | Ga0070711_100037756 | |||
| 769 | Ga0070711_100318118 | |||
| 770 | Ga0070705_100000774 | |||
| 771 | Ga0070705_100001100 | |||
| 772 | Ga0070700_100001594 | |||
| 773 | Ga0070694_100000159 | |||
| 774 | Ga0070694_100007145 | |||
| 775 | Ga0070708_100265586 | |||
| 776 | Ga0070663_100001241 | |||
| 777 | Ga0070663_100060792 | |||
| 778 | Ga0070678_100001723 | |||
| 779 | Ga0070662_100019876 | |||
| 780 | Ga0070681_10009920 | |||
| 781 | Ga0070681_10016572 | |||
| 782 | Ga0070681_10042284 | |||
| 783 | Ga0070681_10125853 | |||
| 784 | Ga0070681_10297928 | |||
| 785 | Ga0070685_10026736 | |||
| 786 | Ga0070706_100047764 | |||
| 787 | Ga0070707_100015032 | |||
| 788 | Ga0070698_100001477 | |||
| 789 | Ga0070698_100043566 | |||
| 790 | Ga0070698_100165789 | |||
| 791 | Ga0070698_100333946 | |||
| 792 | Ga0070699_100001258 | |||
| 793 | Ga0070699_100014379 | |||
| 794 | Ga0070699_100065810 | |||
| 795 | Ga0070679_100012896 | |||
| 796 | Ga0070679_100017530 | |||
| 797 | Ga0070679_100154298 | |||
| 798 | Ga0070679_100192635 | |||
| 799 | Ga0070679_100274030 | |||
| 800 | Ga0070679_100293304 | |||
| 801 | Ga0070684_100006001 | |||
| 802 | Ga0070684_100326129 | |||
| 803 | Ga0070697_100005090 | |||
| 804 | Ga0070697_100144271 | |||
| 805 | Ga0068853_100000477 | |||
| 806 | Ga0070672_100003489 | |||
| 807 | Ga0070695_100001335 | |||
| 808 | Ga0070695_100001605 | |||
| 809 | Ga0070696_100000649 | |||
| 810 | Ga0070696_100001417 | |||
| 811 | Ga0070693_100000188 | |||
| 812 | Ga0070693_100140879 | |||
| 813 | Ga0070665_100017657 | |||
| 814 | Ga0070665_100041621 | |||
| 815 | Ga0070665_100455566 | |||
| 816 | Ga0070704_100017707 | |||
| 817 | Ga0070704_100032102 | |||
| 818 | Ga0070704_100035700 | |||
| 819 | Ga0070704_100177580 | |||
| 820 | Ga0068855_100002324 | |||
| 821 | Ga0068855_100313265 | |||
| 822 | Ga0070664_100001729 | |||
| 823 | Ga0070664_100216931 | |||
| 824 | Ga0068857_100003178 | |||
| 825 | Ga0068857_100073594 | |||
| 826 | Ga0068857_100161434 | |||
| 827 | Ga0068857_100350473 | |||
| 828 | Ga0068854_100001073 | |||
| 829 | Ga0068854_100092724 | |||
| 830 | Ga0068856_100001302 | |||
| 831 | Ga0068856_100085810 | |||
| 832 | Ga0070702_100000205 | |||
| 833 | Ga0068852_100006477 | |||
| 834 | Ga0068859_100025733 | |||
| 835 | Ga0068859_100033872 | |||
| 836 | Ga0068866_10003307 | |||
| 837 | Ga0068861_100000196 | |||
| 838 | Ga0068861_100046006 | |||
| 839 | Ga0068863_100023321 | |||
| 840 | Ga0068863_100043839 | |||
| 841 | Ga0068858_100001779 | |||
| 842 | Ga0068860_100000872 | |||
| 843 | Ga0068860_100006253 | |||
| 844 | Ga0068862_100002619 | |||
| 845 | Ga0068862_100015087 | |||
| 846 | Ga0081455_10000028 | |||
| 847 | Ga0081455_10001989 | |||
| 848 | Ga0081455_10002009 | |||
| 849 | Ga0081455_10075662 | |||
| 850 | Ga0081538_10032566 | |||
| 851 | Ga0081540_1000060 | |||
| 852 | Ga0081540_1003639 | |||
| 853 | Ga0081540_1005968 | |||
| 854 | Ga0070717_10000560 | |||
| 855 | Ga0070717_10041974 | |||
| 856 | Ga0070717_10095327 | |||
| 857 | Ga0075365_10010665 | |||
| 858 | Ga0075368_10028284 | |||
| 859 | Ga0075363_100010173 | |||
| 860 | Ga0075364_10001857 | |||
| 861 | Ga0070715_10000455 | |||
| 862 | Ga0070716_100001528 | |||
| 863 | Ga0070712_100011256 | |||
| 864 | Ga0070712_100016855 | |||
| 865 | Ga0070712_100075587 | |||
| 866 | Ga0075367_10001325 | |||
| 867 | Ga0075367_10011745 | |||
| 868 | Ga0068871_100009843 | |||
| 869 | Ga0068871_100067054 | |||
| 870 | Ga0075428_100008023 | |||
| 871 | Ga0075428_100056280 | |||
| 872 | Ga0075430_100130844 | |||
| 873 | Ga0075431_100004173 | |||
| 874 | Ga0075431_100026694 | |||
| 875 | Ga0075431_100031095 | |||
| 876 | Ga0075431_100073702 | |||
| 877 | Ga0075433_10008265 | |||
| 878 | Ga0075433_10022191 | |||
| 879 | Ga0075434_100001646 | |||
| 880 | Ga0075434_100049658 | |||
| 881 | Ga0075434_100382652 | |||
| 882 | Ga0075429_100020985 | |||
| 883 | Ga0075429_100022660 | |||
| 884 | Ga0075429_100052570 | |||
| 885 | Ga0068865_100001326 | |||
| 886 | Ga0075436_100019703 | |||
| 887 | Ga0075436_100027136 | |||
| 888 | Ga0097620_100025734 | |||
| 889 | Ga0097620_100033870 | |||
| 890 | Ga0075435_100026374 | |||
| 891 | Ga0075435_100106976 | |||
| 892 | Ga0105240_10056163 | |||
| 893 | Ga0105240_10269194 | |||
| 894 | Ga0111539_10015556 | |||
| 895 | Ga0111539_10048481 | |||
| 896 | Ga0111539_10058017 | |||
| 897 | Ga0111539_10162510 | |||
| 898 | Ga0105247_10002044 | |||
| 899 | Ga0105247_10029304 | |||
| 900 | Ga0105247_10030975 | |||
| 901 | Ga0114129_10005905 | |||
| 902 | Ga0114129_10088933 | |||
| 903 | Ga0114129_10143068 | |||
| 904 | Ga0114129_10241304 | |||
| 905 | Ga0114129_10773022 | |||
| 906 | Ga0105243_10002388 | |||
| 907 | Ga0105241_10006277 | |||
| 908 | Ga0105242_10001841 | |||
| 909 | Ga0105237_10002959 | |||
| 910 | Ga0105238_10016025 | |||
| 911 | Ga0105238_10022211 | |||
| 912 | Ga0105249_10005201 | |||
| 913 | Ga0105249_10005964 | |||
| 914 | Ga0105028_100214 | |||
| 915 | Ga0099796_10047668 | |||
| 916 | Ga0105239_10014169 | |||
| 917 | Ga0105239_10114434 | |||
| 918 | Ga0157371_10005468 | |||
| 919 | Ga0157370_10004490 | |||
| 920 | Ga0157370_10004646 | |||
| 921 | Ga0157370_10068142 | |||
| 922 | Ga0157369_10013096 | |||
| 923 | Ga0157369_10020301 | |||
| 924 | Ga0157369_10058245 | |||
| 925 | Ga0157378_10002206 | |||
| 926 | Ga0163162_10002752 | |||
| 927 | Ga0157372_10003944 | |||
| 928 | Ga0157372_10004421 | |||
| 929 | Ga0157372_10005907 | |||
| 930 | Ga0157372_10017772 | |||
| 931 | Ga0157372_10019499 | |||
| 932 | Ga0157372_10046507 | |||
| 933 | Ga0157375_10046242 | |||
| 934 | Ga0157380_10114829 | |||
| 935 | Ga0157380_10214665 | |||
| 936 | Ga0157379_10010073 | |||
| 937 | Ga0157376_10000823 | |||
| 938 | Ga0163161_10002941 | |||
| 939 | Ga0163161_10166518 | |||
| 940 | Ga0213872_10000522 | |||
| 941 | Ga0213872_10010762 | |||
| 942 | Ga0213872_10012233 | |||
| 943 | Ga0213872_10042325 | |||
| 944 | Ga0213872_10042412 | |||
| 945 | Ga0213876_10001035 | |||
| 946 | Ga0213875_10000364 | |||
| 947 | Ga0213875_10000568 | |||
| 948 | Ga0213871_10010104 | |||
| 949 | Ga0213871_10013160 | |||
| 950 | Ga0209148_1001047 | |||
| 951 | Ga0209455_1000278 | |||
| 952 | Ga0209130_1001314 | |||
| 953 | Ga0209025_1001048 | |||
| 954 | Ga0209564_1033334 | |||
| 955 | Ga0209758_1000118 | |||
| 956 | Ga0209758_1004898 | |||
| 957 | Ga0209758_1008576 | |||
| 958 | Ga0207426_1000256 | |||
| 959 | Ga0207426_1019907 | |||
| 960 | Ga0209257_1001036 | |||
| 961 | Ga0207653_10046254 | |||
| 962 | Ga0207692_10024990 | |||
| 963 | Ga0207692_10033094 | |||
| 964 | Ga0207692_10141969 | |||
| 965 | Ga0207710_10001172 | |||
| 966 | Ga0207710_10035892 | |||
| 967 | Ga0207688_10002512 | |||
| 968 | Ga0207680_10090152 | |||
| 969 | Ga0207647_10008374 | |||
| 970 | Ga0207699_10001135 | |||
| 971 | Ga0207699_10005261 | |||
| 972 | Ga0207699_10043721 | |||
| 973 | Ga0207645_10005698 | |||
| 974 | Ga0207705_10000611 | |||
| 975 | Ga0207705_10050274 | |||
| 976 | Ga0207654_10009164 | |||
| 977 | Ga0207707_10001384 | |||
| 978 | Ga0207707_10009542 | |||
| 979 | Ga0207707_10056261 | |||
| 980 | Ga0207707_10115572 | |||
| 981 | Ga0207707_10150641 | |||
| 982 | Ga0207707_10246541 | |||
| 983 | Ga0207707_10374957 | |||
| 984 | Ga0207695_10011770 | |||
| 985 | Ga0207695_10042772 | |||
| 986 | Ga0207695_10193658 | |||
| 987 | Ga0207693_10000313 | |||
| 988 | Ga0207693_10003314 | |||
| 989 | Ga0207693_10096675 | |||
| 990 | Ga0207663_10000796 | |||
| 991 | Ga0207663_10027755 | |||
| 992 | Ga0207663_10100610 | |||
| 993 | Ga0207663_10100699 | |||
| 994 | Ga0207663_10162572 | |||
| 995 | Ga0207660_10042548 | |||
| 996 | Ga0207660_10042581 | |||
| 997 | Ga0207660_10050840 | |||
| 998 | Ga0207662_10001471 | |||
| 999 | Ga0207657_10000112 | |||
| 1000 | Ga0207657_10000815 | |||
| 1001 | Ga0207649_10002140 | |||
| 1002 | Ga0207649_10012726 | |||
| 1003 | Ga0207652_10002462 | |||
| 1004 | Ga0207652_10017420 | |||
| 1005 | Ga0207652_10064208 | |||
| 1006 | Ga0207652_10143941 | |||
| 1007 | Ga0207652_10237183 | |||
| 1008 | Ga0207646_10006025 | |||
| 1009 | Ga0207646_10025801 | |||
| 1010 | Ga0207694_10011426 | |||
| 1011 | Ga0207694_10030218 | |||
| 1012 | Ga0207650_10075996 | |||
| 1013 | Ga0207659_10010504 | |||
| 1014 | Ga0207687_10004074 | |||
| 1015 | Ga0207700_10017076 | |||
| 1016 | Ga0207700_10078563 | |||
| 1017 | Ga0207700_10115108 | |||
| 1018 | Ga0207700_10232702 | |||
| 1019 | Ga0207664_10027840 | |||
| 1020 | Ga0207664_10091478 | |||
| 1021 | Ga0207664_10203149 | |||
| 1022 | Ga0207644_10078146 | |||
| 1023 | Ga0207690_10002166 | |||
| 1024 | Ga0207690_10027815 | |||
| 1025 | Ga0207690_10063786 | |||
| 1026 | Ga0207690_10283266 | |||
| 1027 | Ga0207706_10000831 | |||
| 1028 | Ga0207686_10008320 | |||
| 1029 | Ga0207670_10010280 | |||
| 1030 | Ga0207669_10040421 | |||
| 1031 | Ga0207665_10000565 | |||
| 1032 | Ga0207665_10123515 | |||
| 1033 | Ga0207691_10000623 | |||
| 1034 | Ga0207711_10047762 | |||
| 1035 | Ga0207689_10024023 | |||
| 1036 | Ga0207689_10033128 | |||
| 1037 | Ga0207661_10065820 | |||
| 1038 | Ga0207679_10272539 | |||
| 1039 | Ga0207667_10027474 | |||
| 1040 | Ga0207651_10003894 | |||
| 1041 | Ga0207712_10005840 | |||
| 1042 | Ga0207712_10006060 | |||
| 1043 | Ga0207668_10004522 | |||
| 1044 | Ga0207668_10335772 | |||
| 1045 | Ga0207640_10004889 | |||
| 1046 | Ga0207658_10006904 | |||
| 1047 | Ga0207658_10081453 | |||
| 1048 | Ga0207677_10038570 | |||
| 1049 | Ga0207703_10015180 | |||
| 1050 | Ga0207639_10005657 | |||
| 1051 | Ga0207639_10184842 | |||
| 1052 | Ga0207678_10000086 | |||
| 1053 | Ga0207708_10002960 | |||
| 1054 | Ga0207702_10013420 | |||
| 1055 | Ga0207702_10084239 | |||
| 1056 | Ga0207641_10008810 | |||
| 1057 | Ga0207641_10033633 | |||
| 1058 | Ga0207648_10068154 | |||
| 1059 | Ga0207676_10023761 | |||
| 1060 | Ga0207676_10158426 | |||
| 1061 | Ga0207674_10003298 | |||
| 1062 | Ga0207675_100000111 | |||
| 1063 | Ga0207683_10000120 | |||
| 1064 | Ga0207698_10035109 | |||
| 1065 | Ga0209813_10002716 | |||
| 1066 | Ga0209813_10062136 | |||
| 1067 | Ga0207428_10109023 | |||
| 1068 | Ga0268266_10002921 | |||
| 1069 | Ga0268266_10069557 | |||
| 1070 | Ga0268265_10161166 | |||
| 1071 | Ga0268264_10010894 | |||
| 1072 | Ga0265337_1003396 | |||
| 1073 | Ga0265318_10007334 | |||
| 1074 | Ga0265338_10007502 | |||
| 1075 | Ga0265338_10013718 | |||
| 1076 | Ga0265324_10002634 | |||
| 1077 | Ga0265330_10085312 | |||
| 1078 | Ga0265332_10006311 | |||
| 1079 | Ga0265332_10016725 | |||
| 1080 | Ga0265328_10001788 | |||
| 1081 | Ga0265320_10003600 | |||
| 1082 | Ga0265320_10032282 | |||
| 1083 | Ga0265325_10022538 | |||
| 1084 | Ga0265340_10000319 | |||
| 1085 | Ga0265340_10003799 | |||
| 1086 | Ga0265331_10000156 | |||
| 1087 | Ga0265331_10002640 | |||
| 1088 | Ga0265331_10002733 | |||
| 1089 | Ga0265331_10002902 | |||
| 1090 | Ga0265327_10000297 | |||
| 1091 | Ga0265327_10000543 | |||
| 1092 | Ga0265327_10020336 | |||
| 1093 | Ga0265316_10052395 | |||
| 1094 | Ga0265316_10061570 | |||
| 1095 | Ga0307513_10048697 | |||
| 1096 | Ga0265313_10000913 | |||
| 1097 | Ga0265313_10001440 | |||
| 1098 | Ga0265313_10001587 | |||
| 1099 | Ga0265313_10006326 | |||
| 1100 | Ga0265313_10039421 | |||
| 1101 | Ga0265314_10003764 | |||
| 1102 | Ga0265314_10007122 | |||
| 1103 | Ga0265314_10007521 | |||
| 1104 | Ga0265314_10105106 | |||
| 1105 | Ga0265342_10018018 | |||
| 1106 | Ga0316576_10182422 | |||
| 1107 | Ga0316578_10097282 | |||
| 1108 | Ga0307405_10340446 | |||
| 1109 | Ga0373934_0023656 | |||
| 1110 | Ga0373940_0039470 | |||
| 1111 | Ga0373949_0001990 | |||
| 1112 | Ga0373932_0008825 | |||
| 1113 | Ga0373939_0000816 | |||
| 1114 | Ga0373941_0006433 | |||
| 1115 | Ga0373941_0016386 | |||
| 1116 | Ga0373953_0006842 | |||
| 1117 | Ga0373953_0045262 | |||
| 1118 | Ga0373954_0033397 | |||
| 1119 | Ga0373956_0080342 | |||
| 1120 | Ga0373960_0001630 | |||
| 1121 | Ga0373943_0029155 | |||
| 1122 | Ga0373955_0114047 | |||
| 1123 | Ga0373962_0007067 | |||
| 1124 | Ga0316574_0036442 | |||
| 1125 | Ga0373931_0004913 | |||
| 1126 | Ga0373931_0020651 | |||
| 1127 | Ga0373931_0255950 | |||
| 1128 | Ga0373935_0012331 | |||
| 1129 | Ga0373933_0031028 | |||
| 1130 | Ga0373947_0005812 | |||
| 1131 | Ga0373947_0015921 | |||
| 1132 | Ga0373937_0000540 | |||
| 1133 | Ga0373937_0009309 | |||
| 1134 | Ga0373937_0009654 | |||
| 1135 | Ga0373937_0066603 | |||
| 1136 | Ga0373937_0499738 | |||
| 1137 | Ga0316584_0021379 | |||
| 1138 | Ga0316584_0099391 | |||
| 1139 | Ga0373925_0002418 | |||
| 1140 | Ga0395899_0039525 | |||
| 1141 | Ga0395900_0015652 | |||
| 1142 | Ga0395900_0113947 | |||
| 1143 | Ga0395898_0300389 | |||
| 1144 | Ga0395905_0002147 | |||
| 1145 | Ga0395905_0175560 | |||
| 1146 | Ga0436364_0067731 | |||
| 1147 | Ga0436364_0639582 | |||
| 1148 | Ga0395901_0008188 | |||
| 1149 | Ga0400483_055840 | |||
| 1150 | Ga0400483_110392 | |||
| 1151 | Ga0400483_151200 | |||
| 1152 | Ga0400483_184879 | |||
| 1153 | Ga0400483_198838 | |||
| 1154 | Ga0436365_0229005 | |||
| 1155 | Ga0436365_0457441 | |||
| 1156 | Ga0436365_1325603 | |||
| 1157 | Ga0436365_1712708 | |||
| 1158 | Ga0436365_1888495 | |||
| 1159 | Ga0436360_0040490 | |||
| 1160 | Ga0436361_0064010 | |||
| 1161 | Ga0436361_0199013 | |||
| 1162 | Ga0436361_0351574 | |||
| 1163 | Ga0436361_0358253 | |||
| 1164 | Ga0436361_0814479 | |||
| 1165 | Ga0436361_1182689 | |||
| 1166 | Ga0436363_0082910 | |||
| 1167 | Ga0436363_0912598 | |||
| 1168 | Ga0436362_0291175 | |||
| 1169 | Ga0436362_0473767 | |||
| 1170 | Ga0436362_1067723 | |||
| 1171 | Ga0436362_1083403 | |||
| 1172 | Ga0436362_1095303 | |||
| 1173 | Ga0439448_0041596 | |||
| 1174 | Ga0439440_0013740 | |||
| 1175 | Ga0453683_0017308 | |||
| 1176 | Ga0453684_0000062 | |||
| 1177 | Ga0453684_0000071 | |||
| 1178 | Ga0453684_0028882 | |||
| 1179 | Ga0453684_0039359 | |||
| 1180 | Ga0453684_0081616 | |||
| 1181 | Ga0466960_0070512 | |||
| 1182 | Ga0451576_0005756 | |||
| 1183 | Ga0451576_0014949 | |||
| 1184 | Ga0451576_0047602 | |||
| 1185 | Ga0451576_0053851 | |||
| 1186 | Ga0466958_0000103 | |||
| 1187 | Ga0495603_0000690 | |||
| 1188 | Ga0495603_0158632 | |||
| 1189 | Ga0495629_0019650 | |||
| 1190 | Ga0495629_0248872 | |||
| 1191 | Ga0495641_0017633 | |||
| 1192 | Ga0495639_0004560 | |||
| 1193 | Ga0495610_0048438 | |||
| 1194 | Ga0495652_0074354 | |||
| 1195 | Ga0495665_0025230 | |||
| 1196 | Ga0495640_0069595 | |||
| 1197 | Ga0495586_0002921 | |||
| 1198 | Ga0495587_0084592 | |||
| 1199 | Ga0495622_0005959 | |||
| 1200 | Ga0495667_0106891 | |||
| 1201 | Ga0495634_0014400 | |||
| 1202 | Ga0495635_0045185 | |||
| 1203 | Ga0495588_0000969 | |||
| 1204 | Ga0495657_0109608 | |||
| 1205 | Ga0495658_0000923 | |||
| 1206 | Ga0495676_0034205 | |||
| 1207 | Ga0495593_0003109 | |||
| 1208 | Ga0496100_0009697 | |||
| 1209 | Ga0496100_0299803 | |||
| 1210 | Ga0496102_0011444 | |||
| 1211 | Ga0496104_0003861 | |||
| 1212 | Ga0496104_0010979 | |||
| 1213 | Ga0496105_0019762 | |||
| 1214 | Ga0496105_0069631 | |||
| 1215 | Ga0496106_0002044 | |||
| 1216 | Ga0496106_0077617 | |||
| 1217 | Ga0496107_0018779 | |||
| 1218 | Ga0496108_0001756 | |||
| 1219 | Ga0496108_0193563 | |||
| 1220 | Ga0496109_0027625 | |||
| 1221 | Ga0496109_0032755 | |||
| 1222 | Ga0496109_0172163 | |||
| 1223 | Ga0496110_0010414 | |||
| 1224 | Ga0496111_0020287 | |||
| 1225 | Ga0496112_0004975 | |||
| 1226 | Ga0496112_0257853 | |||
| 1227 | Ga0496113_0015848 | |||
| 1228 | Ga0496113_0018386 | |||
| 1229 | Ga0496113_0090010 | |||
| 1230 | Ga0496114_0011862 | |||
| 1231 | Ga0496115_0049764 | |||
| 1232 | Ga0496120_0099444 | |||
| 1233 | Ga0496122_0071515 | |||
| 1234 | Ga0501031_0017066 | |||
| 1235 | Ga0501031_0033529 | |||
| 1236 | Ga0501031_0072612 | |||
| 1237 | Ga0501031_0088173 | |||
| 1238 | Ga0501032_0000002 | |||
| 1239 | Ga0501032_0004236 | |||
| 1240 | Ga0501034_0000001 | |||
| 1241 | Ga0501034_0372268 | |||
| 1242 | Ga0501036_0008719 | |||
| 1243 | Ga0501036_0039766 | |||
| 1244 | Ga0501036_0061894 | |||
| 1245 | Ga0501036_0104350 | |||
| 1246 | Ga0501036_0166448 | |||
| 1247 | Ga0501038_0000011 | |||
| 1248 | Ga0501038_0041508 | |||
| 1249 | Ga0501038_0049012 | |||
| 1250 | Ga0501039_0000006 | |||
| 1251 | Ga0501039_0013493 | |||
| 1252 | Ga0501039_0059289 | |||
| 1253 | Ga0501040_0003946 | |||
| 1254 | Ga0501040_0004178 | |||
| 1255 | Ga0501040_0082631 | |||
| 1256 | Ga0501040_0199374 | |||
| 1257 | Ga0501040_0283372 | |||
| 1258 | Ga0501041_0005041 | |||
| 1259 | Ga0501041_0030948 | |||
| 1260 | Ga0501041_0090708 | |||
| 1261 | Ga0501041_0097666 | |||
| 1262 | Ga0501041_0144658 | |||
| 1263 | Ga0501042_0146531 | |||
| 1264 | Ga0501043_0001441 | |||
| 1265 | Ga0501043_0272250 | |||
| 1266 | Ga0501046_0000246 | |||
| 1267 | Ga0501046_0038092 | |||
| 1268 | Ga0501046_0288842 | |||
| 1269 | Ga0501047_0009299 | |||
| 1270 | Ga0501047_0052314 | |||
| 1271 | Ga0501048_0006578 | |||
| 1272 | Ga0501048_0074692 | |||
| 1273 | Ga0501048_0100460 | |||
| 1274 | Ga0501048_0153520 | |||
| 1275 | Ga0501067_0017826 | |||
| 1276 | Ga0501067_0098794 | |||
| 1277 | Ga0501068_0018602 | |||
| 1278 | Ga0501068_0158464 | |||
| 1279 | Ga0501069_0019612 | |||
| 1280 | Ga0501069_0063131 | |||
| 1281 | Ga0501070_0000031 | |||
| 1282 | Ga0501070_0000540 | |||
| 1283 | Ga0501070_0041326 | |||
| 1284 | Ga0501070_0065393 | |||
| 1285 | Ga0501070_0127387 | |||
| 1286 | Ga0501071_0040237 | |||
| 1287 | Ga0501071_0068569 | |||
| 1288 | Ga0501071_0113875 | |||
| 1289 | Ga0501072_0002691 | |||
| 1290 | Ga0501072_0024741 | |||
| 1291 | Ga0501072_0106659 | |||
| 1292 | Ga0501073_0005304 | |||
| 1293 | Ga0501073_0034322 | |||
| 1294 | Ga0501073_0101348 | |||
| 1295 | Ga0501074_0022854 | |||
| 1296 | Ga0501074_0036465 | |||
| 1297 | Ga0501074_0080025 | |||
| 1298 | Ga0501075_0005490 | |||
| 1299 | Ga0501075_0024067 | |||
| 1300 | Ga0501075_0087915 | |||
| 1301 | Ga0501076_0011183 | |||
| 1302 | Ga0501076_0031005 | |||
| 1303 | Ga0501076_0037448 | |||
| 1304 | Ga0501076_0057399 | |||
| 1305 | Ga0501076_0064657 | |||
| 1306 | Ga0501077_0003004 | |||
| 1307 | Ga0501077_0007974 | |||
| 1308 | Ga0501077_0009385 | |||
| 1309 | Ga0501077_0011442 | |||
| 1310 | Ga0501077_0024163 | |||
| 1311 | Ga0501079_0061874 | |||
| 1312 | Ga0501079_0070704 | |||
| 1313 | Ga0501079_0091873 | |||
| 1314 | Ga0501079_0095708 | |||
| 1315 | Ga0501079_0135921 | |||
| 1316 | Ga0501080_0027989 | |||
| 1317 | Ga0501080_0033719 | |||
| 1318 | Ga0501080_0063844 | |||
| 1319 | Ga0501080_0200345 | |||
| 1320 | Ga0501080_0203088 | |||
| 1321 | Ga0501080_0259918 | |||
| 1322 | Ga0501080_0266840 | |||
| 1323 | Ga0501081_0005212 | |||
| 1324 | Ga0501081_0012541 | |||
| 1325 | Ga0501081_0014229 | |||
| 1326 | Ga0501081_0057742 | |||
| 1327 | Ga0501083_0010030 | |||
| 1328 | Ga0501083_0010058 | |||
| 1329 | Ga0501083_0015131 | |||
| 1330 | Ga0501083_0031936 | |||
| 1331 | Ga0501083_0044898 | |||
| 1332 | Ga0501083_0229074 | |||
| 1333 | Ga0501035_0024295 | |||
| 1334 | Ga0501035_0065866 | |||
| 1335 | Ga0501044_0004918 | |||
| 1336 | Ga0501044_0010458 | |||
| 1337 | Ga0501044_0013991 | |||
| 1338 | Ga0501044_0031163 | |||
| 1339 | Ga0501044_0033244 | |||
| 1340 | Ga0501044_0048091 | |||
| 1341 | Ga0501044_0201516 | |||
| 1342 | Ga0501045_0003999 | |||
| 1343 | Ga0501045_0011608 | |||
| 1344 | Ga0501045_0096220 | |||
| 1345 | Ga0501045_0172435 | |||
| 1346 | nmdc:mga03n38_3206_c1 | |||
| 1347 | nmdc:mga0yw44_24908_c1 | |||
| 1348 | nmdc:mga06z11_22729_c1 | |||
| 1349 | nmdc:mga06z11_43395_c1 | |||
| 1350 | nmdc:mga04h51_6493_c1 | |||
| 1351 | nmdc:mga05p37_269707_c1 | |||
| 1352 | nmdc:mga05p37_310591_c1 | |||
| 1353 | nmdc:mga05p37_336861_c1 | |||
| 1354 | nmdc:mga09592_27224_c1 | |||
| 1355 | nmdc:mga0qj67_363851_c1 | |||
| 1356 | nmdc:mga06r32_136447_c1 | |||
| 1357 | nmdc:mga06r32_96940_c1 | |||
| 1358 | nmdc:mga08y16_292236_c1 | |||
| 1359 | nmdc:mga08y16_295319_c1 | |||
| 1360 | nmdc:mga08y16_50457_c1 | |||
| 1361 | nmdc:mga08y16_83016_c1 | |||
| 1362 | nmdc:mga0n895_104034_c1 | |||
| 1363 | nmdc:mga0n895_34632_c1 | |||
| 1364 | nmdc:mga0n895_83649_c1 | |||
| 1365 | nmdc:mga0rr50_27699_c1 | |||
| 1366 | nmdc:mga08x19_250750_c1 | |||
| 1367 | nmdc:mga08x19_8007_c1 | |||
| 1368 | nmdc:mga08x19_85249_c1 | |||
| 1369 | nmdc:mga0a205_2329_c1 | |||
| 1370 | Ga0495601_0021555 | |||
| 1371 | Ga0495601_0025847 | |||
| 1372 | Ga0495612_0028965 | |||
| 1373 | Ga0495595_0011852 | |||
| 1374 | Ga0495619_0000737 | |||
| 1375 | Ga0495619_0031973 | |||
| 1376 | Ga0495619_0089592 | |||
| 1377 | Ga0500651_0012206 | |||
| 1378 | Ga0500555_031749 | |||
| 1379 | Ga0500556_0000427 | |||
| 1380 | Ga0500594_0038888 | |||
| 1381 | Ga0500595_011938 | |||
| 1382 | Ga0500595_033222 | |||
| 1383 | Ga0500642_0001673 | |||
| 1384 | Ga0500658_0007005 | |||
| 1385 | Ga0500568_0025146 | |||
| 1386 | Ga0500588_0004817 | |||
| 1387 | Ga0500616_0000548 | |||
| 1388 | Ga0500616_0015133 | |||
| 1389 | Ga0500616_0018717 | |||
| 1390 | Ga0500645_025159 | |||
| 1391 | Ga0501084_0000658 | |||
| 1392 | Ga0501084_0006920 | |||
| 1393 | Ga0501084_0015177 | |||
| 1394 | Ga0501084_0022794 | |||
| 1395 | Ga0501084_0024755 | |||
| 1396 | Ga0501084_0038055 | |||
| 1397 | Ga0501084_0039332 | |||
| 1398 | Ga0501084_0135754 | |||
| 1399 | Ga0501084_0247083 | |||
| 1400 | Ga0587111_0019506 | |||
| 1401 | Ga0501082_0004559 | |||
| 1402 | Ga0501082_0051106 | |||
| 1403 | Ga0501082_0061771 | |||
| 1404 | Ga0501082_0088115 | |||
| 1405 | Ga0530510_0010850 | |||
| 1406 | Ga0530510_0014376 | |||
| 1407 | Ga0530510_0017882 | |||
| 1408 | Ga0530510_0024825 | |||
| 1409 | Ga0530510_0092650 | |||
| 1410 | 2512033911 | |||
| 1411 | 2523106899 | |||
| 1412 | 2524610456 | |||
| 1413 | 2599103501 | |||
| 1414 | 2821444496 | |||
| 1415 | 2842336289 | |||
| 1416 | 2844538575 | |||
| 1417 | 2846953388 | |||
| 1418 | 2848858862 | |||
| 1419 | 2883293017 | |||
| 1420 | 2883356010 | |||
| 1421 | 2897803633 | |||
| 1422 | 8054004603 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6oyz-assembly4.cif.gz_D | crystal structure of mray bound to capuramycin | 0.9623 | 20 | 359 |
| 8cxr-assembly4.cif.gz_D | crystal structure of mray bound to a sphaerimicin analogue | 0.9598 | 23 | 359 |
| 8cxr-assembly1.cif.gz_A | crystal structure of mray bound to a sphaerimicin analogue | 0.9571 | 24 | 359 |
| 6oyz-assembly4.cif.gz_D | crystal structure of mray bound to capuramycin | 0.9561 | 20 | 359 |
| 6oz6-assembly4.cif.gz_D | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9527 | 24 | 359 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q99PA5_49_164_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.4097 | 93 | 186 | 1.20.140.150 |
| af_Q99PA5_49_164_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3515 | 93 | 186 | 1.20.140.150 |
| af_Q7XKJ7_269_452_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3001 | 135 | 361 | 1.20.1250.20 |
| af_A0A1D8PLY7_67_271_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.284 | 93 | 355 | 1.20.1250.20 |
| af_O14091_29_346_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.2791 | 101 | 359 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537PIT9-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) | 0.9919 | 1 | 296 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0051992 GO:0071555 |
| AF-A0A2K9JP42-F1-model_v4 | deleted | 0.9897 | 1 | 361 |
|
| AF-A0A3S2DDN4-F1-model_v4 | deleted | 0.9893 | 1 | 257 |
|
| AF-A0A329P6I9-F1-model_v4 | deleted | 0.9889 | 134 | 361 |
|
| AF-A0A2W5SC89-F1-model_v4 | Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase) | 0.9885 | 1 | 361 |
GO:0005886
GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0051992 GO:0071555 |