F476703
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 710 | 387 | 596 | 367 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10146480|Ga0157370_101464801 |
| Length | 394 |
| Sequence | MIPPAKHANNDCDRGEDEMLDWSEAVIDNSSDLVLTPPPIREDSDATDLGKIARGAARVRVDDKAMINCRADVNQLLPLKYRWAWEKYLSGCSNHWMPTEISMQADIALWKSPDGVTTDERRAIKRNLGFFASSESLVANNIVLAIYRHLTNPECRQYLLRQAFEEAVHTHTFQYIVESLGLDEGELFNMYREVPSITEKAAWAIQYTQNLSDPSFVTGSSAADRAFLRDLIAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQIKIENPHLWSEPFQQEVRGMLQNAAELEAAYGRDTMPNGFLGLSAGLCEQYMHFIANRRCSQLGLEAVFPPTDNPFPWMSEAMDLKKEKNFFETRVIEYQNGGSLTWE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 4 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 5 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 6 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 7 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 8 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 9 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 10 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 11 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 12 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 13 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 14 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 15 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 16 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 17 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 18 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 19 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 20 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 21 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 22 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 23 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 24 | 2786546517 | Verrucomicrobia bacterium LW23 | Isolate | Rhizoplane |
| 25 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 26 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 27 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 28 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 29 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 30 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 31 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 32 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 33 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 34 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 35 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 36 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 37 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 38 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 39 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 40 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 41 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 42 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 43 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 44 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 45 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 46 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 47 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 48 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 49 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 50 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 51 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 52 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 53 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 54 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 55 | 2906610324 | |||
| 56 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 57 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 58 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 59 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 60 | 2922368715 | |||
| 61 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 62 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 63 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 64 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 65 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 66 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 67 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 68 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 69 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 70 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 71 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 72 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 73 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 74 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 75 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 76 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 77 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 78 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 79 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 80 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 81 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 82 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 83 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 84 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 85 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 86 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 87 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 88 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 89 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 90 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 91 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 92 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 93 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 94 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 95 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 96 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 97 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 98 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 99 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 100 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 101 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 102 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 103 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 104 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 105 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 106 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 124 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 125 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 128 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 129 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 132 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 134 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 135 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 136 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 137 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 138 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 139 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 140 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 141 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 142 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 143 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 144 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 145 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 146 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 147 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 148 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 149 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 150 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 151 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 152 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 162 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 172 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 219 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 220 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 222 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 223 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 224 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 242 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 243 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 245 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 246 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 247 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 248 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 249 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 250 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 251 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 284 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 285 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 286 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 330 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 332 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 335 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 340 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 342 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 343 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 345 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 346 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 347 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 348 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 349 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 350 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 351 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 352 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 357 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 360 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 362 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 363 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 368 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 369 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 370 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 371 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 372 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 373 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 374 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 375 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 376 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 377 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 378 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 379 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 380 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 381 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 382 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 383 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 384 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 385 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 386 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 387 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.18 |
| Metatranscriptomes | 0 |
| Isolates | 15.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.39 |
| Nodule | 7.89 |
| Rhizoplane | 5.35 |
| Rhizosphere | 62.54 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 11.69 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10010281 | 3300001989 | Bacteria | 3475 |
| 2 | JGI24737J22298_10042568 | 3300001990 | Bacteria | 1391 |
| 3 | JGI24735J21928_10028584 | 3300002067 | Bacteria | 1664 |
| 4 | JGI24735J21928_10040147 | 3300002067 | Bacteria | 1367 |
| 5 | JGI24742J22300_10011531 | 3300002244 | Bacteria | 1468 |
| 6 | JGI25159J45721_1012079 | 3300002987 | Bacteria | 2079 |
| 7 | JGI25151J46595_10000115 | 3300003187 | Bacteria | 107493 |
| 8 | JGI25165J46597_1000254 | 3300003214 | Bacteria | 71635 |
| 9 | JGI25153J46596_10006347 | 3300003215 | Bacteria | 6006 |
| 10 | rootH2_10004835 | 3300003320 | Bacteria | 6667 |
| 11 | Ga0055526_1000476 | 3300003771 | Bacteria | 31852 |
| 12 | Ga0055524_1000065 | 3300003775 | Bacteria | 132117 |
| 13 | Ga0065165_1000234 | 3300005262 | Bacteria | 96709 |
| 14 | Ga0070658_10084687 | 3300005327 | Bacteria | 2607 |
| 15 | Ga0070658_10329615 | 3300005327 | Bacteria | 1304 |
| 16 | Ga0070683_100018116 | 3300005329 | Bacteria | 6232 |
| 17 | Ga0070680_100041343 | 3300005336 | Bacteria | 3738 |
| 18 | Ga0070680_100042419 | 3300005336 | Bacteria | 3692 |
| 19 | Ga0070682_100147618 | 3300005337 | Bacteria | 1610 |
| 20 | Ga0070660_100011370 | 3300005339 | Bacteria | 6320 |
| 21 | Ga0070660_100097419 | 3300005339 | Bacteria | 2327 |
| 22 | Ga0070668_100008027 | 3300005347 | Bacteria | 7842 |
| 23 | Ga0070668_100077419 | 3300005347 | Bacteria | 2600 |
| 24 | Ga0070668_100134473 | 3300005347 | Bacteria | 1987 |
| 25 | Ga0070669_100112287 | 3300005353 | Bacteria | 2069 |
| 26 | Ga0070675_100219364 | 3300005354 | Bacteria | 1656 |
| 27 | Ga0070671_100151891 | 3300005355 | Bacteria | 1955 |
| 28 | Ga0070674_100039327 | 3300005356 | Bacteria | 3193 |
| 29 | Ga0070674_100163758 | 3300005356 | Bacteria | 1690 |
| 30 | Ga0070659_100017643 | 3300005366 | Bacteria | 5376 |
| 31 | Ga0070709_10006797 | 3300005434 | Bacteria | 6243 |
| 32 | Ga0070714_100477322 | 3300005435 | Bacteria | 1187 |
| 33 | Ga0070710_10003372 | 3300005437 | Bacteria | 7576 |
| 34 | Ga0070711_100023658 | 3300005439 | Bacteria | 3999 |
| 35 | Ga0070663_100014777 | 3300005455 | Bacteria | 5019 |
| 36 | Ga0070663_100027481 | 3300005455 | Bacteria | 3865 |
| 37 | Ga0070663_100027666 | 3300005455 | Bacteria | 3852 |
| 38 | Ga0070663_100034922 | 3300005455 | Bacteria | 3485 |
| 39 | Ga0070663_100061736 | 3300005455 | Bacteria | 2699 |
| 40 | Ga0070678_100037889 | 3300005456 | Bacteria | 3390 |
| 41 | Ga0070681_10077741 | 3300005458 | Bacteria | 3276 |
| 42 | Ga0068867_100074046 | 3300005459 | Bacteria | 2551 |
| 43 | Ga0070707_100127385 | 3300005468 | Bacteria | 2474 |
| 44 | Ga0070679_100021210 | 3300005530 | Bacteria | 6339 |
| 45 | Ga0070679_100034031 | 3300005530 | Bacteria | 5048 |
| 46 | Ga0070679_100387958 | 3300005530 | Bacteria | 1343 |
| 47 | Ga0070684_100126565 | 3300005535 | Bacteria | 2302 |
| 48 | Ga0068853_100067129 | 3300005539 | Bacteria | 3116 |
| 49 | Ga0068853_100210610 | 3300005539 | Bacteria | 1771 |
| 50 | Ga0068853_100339801 | 3300005539 | Bacteria | 1395 |
| 51 | Ga0070696_100026747 | 3300005546 | Bacteria | 3926 |
| 52 | Ga0070665_100057580 | 3300005548 | Bacteria | 3896 |
| 53 | Ga0070665_100078620 | 3300005548 | Bacteria | 3305 |
| 54 | Ga0070665_100459281 | 3300005548 | Bacteria | 1283 |
| 55 | Ga0068855_100178166 | 3300005563 | Bacteria | 2404 |
| 56 | Ga0070664_100049276 | 3300005564 | Bacteria | 3562 |
| 57 | Ga0068857_100006293 | 3300005577 | Bacteria | 10158 |
| 58 | Ga0068856_100004432 | 3300005614 | Bacteria | 13977 |
| 59 | Ga0068856_100054240 | 3300005614 | Bacteria | 3953 |
| 60 | Ga0068852_100130918 | 3300005616 | Bacteria | 2310 |
| 61 | Ga0068866_10000352 | 3300005718 | Bacteria | 21609 |
| 62 | Ga0068866_10118755 | 3300005718 | Bacteria | 1487 |
| 63 | Ga0068858_100250787 | 3300005842 | Bacteria | 1681 |
| 64 | Ga0081455_10002181 | 3300005937 | Bacteria | 23343 |
| 65 | Ga0081455_10017868 | 3300005937 | Bacteria | 6779 |
| 66 | Ga0081455_10018740 | 3300005937 | Bacteria | 6570 |
| 67 | Ga0081455_10214017 | 3300005937 | Bacteria | 1434 |
| 68 | Ga0081538_10050827 | 3300005981 | Bacteria | 2497 |
| 69 | Ga0081540_1002178 | 3300005983 | Bacteria | 16217 |
| 70 | Ga0081540_1004228 | 3300005983 | Bacteria | 11030 |
| 71 | Ga0081540_1007503 | 3300005983 | Bacteria | 7765 |
| 72 | Ga0081540_1022713 | 3300005983 | Bacteria | 3698 |
| 73 | Ga0075365_10195658 | 3300006038 | Bacteria | 1415 |
| 74 | Ga0075363_100000054 | 3300006048 | Bacteria | 22658 |
| 75 | Ga0075363_100085491 | 3300006048 | Bacteria | 1730 |
| 76 | Ga0075364_10005813 | 3300006051 | Bacteria | 7200 |
| 77 | Ga0075364_10006576 | 3300006051 | Bacteria | 6840 |
| 78 | Ga0075364_10096044 | 3300006051 | Bacteria | 1971 |
| 79 | Ga0075364_10098650 | 3300006051 | Bacteria | 1943 |
| 80 | Ga0070712_100014886 | 3300006175 | Bacteria | 4999 |
| 81 | Ga0075362_10000010 | 3300006177 | Bacteria | 109823 |
| 82 | Ga0075367_10015014 | 3300006178 | Bacteria | 4199 |
| 83 | Ga0075367_10092277 | 3300006178 | Bacteria | 1843 |
| 84 | Ga0075366_10015875 | 3300006195 | Bacteria | 4322 |
| 85 | Ga0075370_10005200 | 3300006353 | Bacteria | 6436 |
| 86 | Ga0075370_10017896 | 3300006353 | Bacteria | 3834 |
| 87 | Ga0068871_100128779 | 3300006358 | Bacteria | 2144 |
| 88 | Ga0075428_100041074 | 3300006844 | Bacteria | 5087 |
| 89 | Ga0075428_100137254 | 3300006844 | Bacteria | 2659 |
| 90 | Ga0099795_10003131 | 3300007788 | Bacteria | 4053 |
| 91 | Ga0105240_10008978 | 3300009093 | Bacteria | 14208 |
| 92 | Ga0105240_10076252 | 3300009093 | Bacteria | 4133 |
| 93 | Ga0105240_10144047 | 3300009093 | Bacteria | 2845 |
| 94 | Ga0105240_10187683 | 3300009093 | Bacteria | 2433 |
| 95 | Ga0105240_10287702 | 3300009093 | Bacteria | 1885 |
| 96 | Ga0114129_10028277 | 3300009147 | Bacteria | 7943 |
| 97 | Ga0114129_10262210 | 3300009147 | Bacteria | 2315 |
| 98 | Ga0105243_10101259 | 3300009148 | Bacteria | 2392 |
| 99 | Ga0105241_10000040 | 3300009174 | Bacteria | 111228 |
| 100 | Ga0105241_10169272 | 3300009174 | Bacteria | 1803 |
| 101 | Ga0105242_10000863 | 3300009176 | Bacteria | 23516 |
| 102 | Ga0105242_10199507 | 3300009176 | Bacteria | 1776 |
| 103 | Ga0105248_10017437 | 3300009177 | Bacteria | 7917 |
| 104 | Ga0105237_10012602 | 3300009545 | Bacteria | 8905 |
| 105 | Ga0105237_10022058 | 3300009545 | Bacteria | 6536 |
| 106 | Ga0105237_10072488 | 3300009545 | Bacteria | 3437 |
| 107 | Ga0105237_10196225 | 3300009545 | Bacteria | 2019 |
| 108 | Ga0105238_10017854 | 3300009551 | Bacteria | 7213 |
| 109 | Ga0105238_10033083 | 3300009551 | Bacteria | 5261 |
| 110 | Ga0105238_10082103 | 3300009551 | Bacteria | 3213 |
| 111 | Ga0105238_10258675 | 3300009551 | Bacteria | 1720 |
| 112 | Ga0105238_10279469 | 3300009551 | Bacteria | 1651 |
| 113 | Ga0105249_10006316 | 3300009553 | Bacteria | 10298 |
| 114 | Ga0105249_10154760 | 3300009553 | Bacteria | 2210 |
| 115 | Ga0099796_10005011 | 3300010159 | Bacteria | 3267 |
| 116 | Ga0105239_10002481 | 3300010375 | Bacteria | 23516 |
| 117 | Ga0105239_10025567 | 3300010375 | Bacteria | 6499 |
| 118 | Ga0105239_10036746 | 3300010375 | Bacteria | 5374 |
| 119 | Ga0105239_10147181 | 3300010375 | Bacteria | 2628 |
| 120 | Ga0105239_10148647 | 3300010375 | Bacteria | 2614 |
| 121 | Ga0105246_10237865 | 3300011119 | Bacteria | 1438 |
| 122 | Ga0157371_10040186 | 3300013102 | Bacteria | 3342 |
| 123 | Ga0157370_10146480 | 3300013104 | Bacteria | 2199 |
| 124 | Ga0157369_10044262 | 3300013105 | Bacteria | 4847 |
| 125 | Ga0157369_10059929 | 3300013105 | Bacteria | 4105 |
| 126 | Ga0157369_10337134 | 3300013105 | Bacteria | 1566 |
| 127 | Ga0157374_10085287 | 3300013296 | Bacteria | 3003 |
| 128 | Ga0157374_10386595 | 3300013296 | Bacteria | 1394 |
| 129 | Ga0163162_10050689 | 3300013306 | Bacteria | 4163 |
| 130 | Ga0163163_10073912 | 3300014325 | Bacteria | 3400 |
| 131 | Ga0163163_10084396 | 3300014325 | Bacteria | 3182 |
| 132 | Ga0157376_10012422 | 3300014969 | Bacteria | 6322 |
| 133 | Ga0157376_10046105 | 3300014969 | Bacteria | 3593 |
| 134 | Ga0157376_10117973 | 3300014969 | Bacteria | 2347 |
| 135 | Ga0157376_10285287 | 3300014969 | Bacteria | 1557 |
| 136 | Ga0182007_10000051 | 3300015262 | Bacteria | 99393 |
| 137 | Ga0182007_10016874 | 3300015262 | Bacteria | 2683 |
| 138 | Ga0182005_1028056 | 3300015265 | Bacteria | 1535 |
| 139 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 140 | Ga0209130_1000090 | 3300025284 | Bacteria | 151512 |
| 141 | Ga0209130_1000609 | 3300025284 | Bacteria | 34548 |
| 142 | Ga0209675_1001075 | 3300025291 | Bacteria | 16889 |
| 143 | Ga0209025_1000084 | 3300025294 | Bacteria | 263812 |
| 144 | Ga0209564_1000059 | 3300025295 | Bacteria | 328782 |
| 145 | Ga0209564_1000971 | 3300025295 | Bacteria | 36259 |
| 146 | Ga0209758_1001444 | 3300025297 | Bacteria | 28002 |
| 147 | Ga0209758_1003954 | 3300025297 | Bacteria | 12863 |
| 148 | Ga0209256_1000033 | 3300025299 | Bacteria | 393924 |
| 149 | Ga0207426_1000113 | 3300025302 | Bacteria | 228304 |
| 150 | Ga0207692_10001968 | 3300025898 | Bacteria | 7838 |
| 151 | Ga0207692_10022820 | 3300025898 | Bacteria | 2886 |
| 152 | Ga0207642_10000092 | 3300025899 | Bacteria | 23522 |
| 153 | Ga0207647_10000520 | 3300025904 | Bacteria | 30739 |
| 154 | Ga0207647_10013527 | 3300025904 | Bacteria | 5652 |
| 155 | Ga0207647_10018948 | 3300025904 | Bacteria | 4637 |
| 156 | Ga0207647_10080587 | 3300025904 | Bacteria | 1952 |
| 157 | Ga0207699_10016578 | 3300025906 | Bacteria | 3857 |
| 158 | Ga0207705_10000703 | 3300025909 | Bacteria | 27614 |
| 159 | Ga0207654_10000060 | 3300025911 | Bacteria | 74426 |
| 160 | Ga0207707_10061643 | 3300025912 | Bacteria | 3264 |
| 161 | Ga0207695_10022662 | 3300025913 | Bacteria | 7120 |
| 162 | Ga0207695_10072417 | 3300025913 | Bacteria | 3516 |
| 163 | Ga0207695_10310666 | 3300025913 | Bacteria | 1466 |
| 164 | Ga0207671_10008185 | 3300025914 | Bacteria | 8914 |
| 165 | Ga0207671_10022133 | 3300025914 | Bacteria | 4810 |
| 166 | Ga0207671_10073260 | 3300025914 | Bacteria | 2558 |
| 167 | Ga0207671_10137920 | 3300025914 | Bacteria | 1877 |
| 168 | Ga0207693_10011976 | 3300025915 | Bacteria | 7013 |
| 169 | Ga0207663_10025887 | 3300025916 | Bacteria | 3399 |
| 170 | Ga0207657_10045293 | 3300025919 | Bacteria | 3862 |
| 171 | Ga0207652_10005516 | 3300025921 | Bacteria | 10254 |
| 172 | Ga0207652_10108381 | 3300025921 | Bacteria | 2461 |
| 173 | Ga0207652_10335493 | 3300025921 | Bacteria | 1365 |
| 174 | Ga0207681_10111220 | 3300025923 | Bacteria | 1993 |
| 175 | Ga0207694_10003718 | 3300025924 | Bacteria | 12086 |
| 176 | Ga0207694_10009881 | 3300025924 | Bacteria | 7202 |
| 177 | Ga0207694_10073457 | 3300025924 | Bacteria | 2676 |
| 178 | Ga0207694_10140387 | 3300025924 | Bacteria | 1943 |
| 179 | Ga0207694_10181841 | 3300025924 | Bacteria | 1705 |
| 180 | Ga0207694_10206129 | 3300025924 | Bacteria | 1601 |
| 181 | Ga0207700_10213245 | 3300025928 | Bacteria | 1634 |
| 182 | Ga0207664_10068142 | 3300025929 | Bacteria | 2858 |
| 183 | Ga0207690_10039354 | 3300025932 | Bacteria | 3084 |
| 184 | Ga0207706_10022060 | 3300025933 | Bacteria | 5715 |
| 185 | Ga0207686_10000304 | 3300025934 | Bacteria | 35773 |
| 186 | Ga0207686_10124467 | 3300025934 | Bacteria | 1760 |
| 187 | Ga0207665_10015899 | 3300025939 | Bacteria | 4941 |
| 188 | Ga0207691_10092757 | 3300025940 | Bacteria | 2704 |
| 189 | Ga0207711_10051028 | 3300025941 | Bacteria | 3542 |
| 190 | Ga0207661_10043270 | 3300025944 | Bacteria | 3554 |
| 191 | Ga0207661_10063302 | 3300025944 | Bacteria | 2995 |
| 192 | Ga0207667_10031905 | 3300025949 | Bacteria | 5681 |
| 193 | Ga0207667_10152217 | 3300025949 | Bacteria | 2380 |
| 194 | Ga0207667_10225043 | 3300025949 | Bacteria | 1922 |
| 195 | Ga0207668_10009915 | 3300025972 | Bacteria | 5728 |
| 196 | Ga0207668_10104521 | 3300025972 | Bacteria | 2111 |
| 197 | Ga0207639_10206845 | 3300026041 | Bacteria | 1687 |
| 198 | Ga0207678_10000350 | 3300026067 | Bacteria | 41955 |
| 199 | Ga0207678_10026232 | 3300026067 | Bacteria | 5084 |
| 200 | Ga0207678_10047116 | 3300026067 | Bacteria | 3728 |
| 201 | Ga0207678_10047386 | 3300026067 | Bacteria | 3717 |
| 202 | Ga0207678_10050769 | 3300026067 | Bacteria | 3583 |
| 203 | Ga0207702_10000452 | 3300026078 | Bacteria | 46403 |
| 204 | Ga0207702_10000795 | 3300026078 | Bacteria | 33510 |
| 205 | Ga0207702_10146107 | 3300026078 | Bacteria | 2146 |
| 206 | Ga0207675_100143059 | 3300026118 | Bacteria | 2273 |
| 207 | Ga0207675_100278048 | 3300026118 | Bacteria | 1626 |
| 208 | Ga0207683_10003385 | 3300026121 | Bacteria | 13900 |
| 209 | Ga0207683_10114405 | 3300026121 | Bacteria | 2418 |
| 210 | Ga0207698_10028481 | 3300026142 | Bacteria | 3983 |
| 211 | Ga0209179_1000277 | 3300027512 | Bacteria | 4922 |
| 212 | Ga0209588_1008878 | 3300027671 | Bacteria | 2990 |
| 213 | Ga0209813_10017050 | 3300027866 | Bacteria | 1989 |
| 214 | Ga0268266_10001439 | 3300028379 | Bacteria | 28336 |
| 215 | Ga0268266_10008469 | 3300028379 | Bacteria | 9141 |
| 216 | Ga0268266_10010578 | 3300028379 | Bacteria | 8048 |
| 217 | Ga0268266_10114685 | 3300028379 | Bacteria | 2391 |
| 218 | Ga0268266_10355042 | 3300028379 | Bacteria | 1378 |
| 219 | Ga0268265_10106089 | 3300028380 | Bacteria | 2281 |
| 220 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 221 | Ga0307515_10052231 | 3300028794 | Bacteria | 6068 |
| 222 | Ga0265338_10015712 | 3300028800 | Bacteria | 8295 |
| 223 | Ga0316177_1184578 | 3300030731 | Bacteria | 2943 |
| 224 | Ga0265331_10028985 | 3300031250 | Bacteria | 2766 |
| 225 | Ga0307513_10061771 | 3300031456 | Bacteria | 3964 |
| 226 | Ga0307513_10085474 | 3300031456 | Bacteria | 3237 |
| 227 | Ga0307509_10064501 | 3300031507 | Bacteria | 3852 |
| 228 | Ga0307509_10299862 | 3300031507 | Bacteria | 1356 |
| 229 | Ga0265314_10032920 | 3300031711 | Bacteria | 3807 |
| 230 | Ga0307412_10013585 | 3300031911 | Bacteria | 4779 |
| 231 | Ga0307412_10171950 | 3300031911 | Bacteria | 1621 |
| 232 | Ga0307416_100144355 | 3300032002 | Bacteria | 2170 |
| 233 | Ga0307507_10008496 | 3300033179 | Bacteria | 14162 |
| 234 | Ga0373938_0024743 | 3300034957 | Bacteria | 1244 |
| 235 | Ga0373954_0003833 | 3300035118 | Bacteria | 6429 |
| 236 | Ga0373956_0002705 | 3300035119 | Bacteria | 7177 |
| 237 | Ga0373943_0090859 | 3300035170 | Bacteria | 1581 |
| 238 | Ga0373931_0001367 | 3300035691 | Bacteria | 10427 |
| 239 | Ga0373931_0084727 | 3300035691 | Bacteria | 1756 |
| 240 | Ga0373933_0092173 | 3300035724 | Bacteria | 1871 |
| 241 | Ga0373925_0014095 | 3300037068 | Bacteria | 5785 |
| 242 | Ga0395899_0000030 | 3300037312 | Bacteria | 329063 |
| 243 | Ga0395900_0000023 | 3300037418 | Bacteria | 336048 |
| 244 | Ga0395900_0214183 | 3300037418 | Bacteria | 1944 |
| 245 | Ga0395898_0000038 | 3300037466 | Bacteria | 329063 |
| 246 | Ga0395898_0231982 | 3300037466 | Bacteria | 1760 |
| 247 | Ga0395905_0000021 | 3300037471 | Bacteria | 329054 |
| 248 | Ga0395901_0000018 | 3300038443 | Bacteria | 336048 |
| 249 | Ga0395901_0020495 | 3300038443 | Bacteria | 6766 |
| 250 | Ga0237819_07090 | 3300038705 | Bacteria | 1633 |
| 251 | Ga0436365_0395979 | 3300039437 | Bacteria | 10769 |
| 252 | Ga0436365_0472674 | 3300039437 | Bacteria | 1794 |
| 253 | Ga0436365_0722766 | 3300039437 | Bacteria | 4324 |
| 254 | Ga0436365_1623535 | 3300039437 | Bacteria | 2188 |
| 255 | Ga0451793_0104272 | 3300041452 | Bacteria | 2090 |
| 256 | Ga0451843_1428360 | 3300041509 | Bacteria | 2398 |
| 257 | Ga0439456_000061 | 3300042013 | Bacteria | 39035 |
| 258 | Ga0466972_0052974 | 3300044658 | Bacteria | 1954 |
| 259 | Ga0466965_0003030 | 3300044683 | Bacteria | 7301 |
| 260 | Ga0466960_0001054 | 3300044901 | Bacteria | 9868 |
| 261 | Ga0466959_0091662 | 3300045049 | Bacteria | 2182 |
| 262 | Ga0451576_0404833 | 3300045051 | Bacteria | 1431 |
| 263 | Ga0466958_0200855 | 3300045836 | Bacteria | 1269 |
| 264 | Ga0466967_0013725 | 3300045976 | Bacteria | 6276 |
| 265 | Ga0495603_0008610 | 3300046455 | Bacteria | 6166 |
| 266 | Ga0495629_0033615 | 3300046459 | Bacteria | 3627 |
| 267 | Ga0495629_0038136 | 3300046459 | Bacteria | 3386 |
| 268 | Ga0495638_0007762 | 3300046460 | Bacteria | 7659 |
| 269 | Ga0495650_0000009 | 3300046471 | Bacteria | 653845 |
| 270 | Ga0495650_0003587 | 3300046471 | Bacteria | 11211 |
| 271 | Ga0495580_0005598 | 3300046472 | Bacteria | 10353 |
| 272 | Ga0495582_0006316 | 3300046473 | Bacteria | 6593 |
| 273 | Ga0495594_0003253 | 3300046499 | Bacteria | 8418 |
| 274 | Ga0495610_0029570 | 3300046512 | Bacteria | 2883 |
| 275 | Ga0495631_0076804 | 3300046518 | Bacteria | 1441 |
| 276 | Ga0495632_0032085 | 3300046519 | Bacteria | 2709 |
| 277 | Ga0495665_0142380 | 3300046531 | Unclassified | 1253 |
| 278 | Ga0495622_0070746 | 3300046557 | Bacteria | 1610 |
| 279 | Ga0495633_0012077 | 3300046558 | Bacteria | 4611 |
| 280 | Ga0495625_0001312 | 3300046660 | Bacteria | 30956 |
| 281 | Ga0495625_0104136 | 3300046660 | Bacteria | 1945 |
| 282 | Ga0495659_0018054 | 3300046664 | Bacteria | 2346 |
| 283 | Ga0495661_0000017 | 3300046665 | Bacteria | 208119 |
| 284 | Ga0495658_0008414 | 3300046683 | Bacteria | 5113 |
| 285 | Ga0495672_0002365 | 3300047320 | Bacteria | 17421 |
| 286 | Ga0495672_0026387 | 3300047320 | Bacteria | 3707 |
| 287 | Ga0495672_0068685 | 3300047320 | Bacteria | 2014 |
| 288 | Ga0495673_0036699 | 3300047469 | Bacteria | 2245 |
| 289 | Ga0495686_0051322 | 3300047472 | Bacteria | 2588 |
| 290 | Ga0495686_0055567 | 3300047472 | Bacteria | 2475 |
| 291 | Ga0496100_0042584 | 3300048903 | Bacteria | 2900 |
| 292 | Ga0496101_0093781 | 3300048904 | Bacteria | 2236 |
| 293 | Ga0496101_0104927 | 3300048904 | Bacteria | 2120 |
| 294 | Ga0496102_0112028 | 3300048905 | Bacteria | 2544 |
| 295 | Ga0496102_0291451 | 3300048905 | Bacteria | 1538 |
| 296 | Ga0496102_0494228 | 3300048905 | Bacteria | 1145 |
| 297 | Ga0496104_0008854 | 3300048907 | Bacteria | 8945 |
| 298 | Ga0496104_0022051 | 3300048907 | Bacteria | 5853 |
| 299 | Ga0496104_0027826 | 3300048907 | Bacteria | 5233 |
| 300 | Ga0496104_0145144 | 3300048907 | Bacteria | 2279 |
| 301 | Ga0496105_0014982 | 3300048908 | Bacteria | 6170 |
| 302 | Ga0496105_0029646 | 3300048908 | Bacteria | 4479 |
| 303 | Ga0496105_0144040 | 3300048908 | Bacteria | 1960 |
| 304 | Ga0496106_0014503 | 3300048909 | Bacteria | 5822 |
| 305 | Ga0496107_0005083 | 3300048910 | Bacteria | 8967 |
| 306 | Ga0496107_0043881 | 3300048910 | Bacteria | 3213 |
| 307 | Ga0496108_0012405 | 3300048911 | Bacteria | 6934 |
| 308 | Ga0496108_0085153 | 3300048911 | Bacteria | 2683 |
| 309 | Ga0496108_0195006 | 3300048911 | Bacteria | 1756 |
| 310 | Ga0496108_0211516 | 3300048911 | Bacteria | 1684 |
| 311 | Ga0496110_0006254 | 3300048913 | Bacteria | 9392 |
| 312 | Ga0496110_0029624 | 3300048913 | Bacteria | 4713 |
| 313 | Ga0496110_0169332 | 3300048913 | Bacteria | 1981 |
| 314 | Ga0496110_0405915 | 3300048913 | Bacteria | 1242 |
| 315 | Ga0496111_0021599 | 3300048914 | Bacteria | 4498 |
| 316 | Ga0496111_0070617 | 3300048914 | Bacteria | 2540 |
| 317 | Ga0496112_0073963 | 3300048915 | Bacteria | 3369 |
| 318 | Ga0496112_0100598 | 3300048915 | Bacteria | 2860 |
| 319 | Ga0496112_0215931 | 3300048915 | Bacteria | 1874 |
| 320 | Ga0496113_0039249 | 3300048916 | Bacteria | 3484 |
| 321 | Ga0496114_0005433 | 3300048917 | Bacteria | 9970 |
| 322 | Ga0496114_0072517 | 3300048917 | Bacteria | 2896 |
| 323 | Ga0496114_0137647 | 3300048917 | Bacteria | 2112 |
| 324 | Ga0496115_0000662 | 3300048918 | Bacteria | 25511 |
| 325 | Ga0496115_0014023 | 3300048918 | Bacteria | 6066 |
| 326 | Ga0496116_0009986 | 3300048919 | Bacteria | 8018 |
| 327 | Ga0496116_0049085 | 3300048919 | Bacteria | 2826 |
| 328 | Ga0496117_0043947 | 3300048920 | Bacteria | 3241 |
| 329 | Ga0496117_0067982 | 3300048920 | Bacteria | 2408 |
| 330 | Ga0496117_0082914 | 3300048920 | Bacteria | 2098 |
| 331 | Ga0496118_0139097 | 3300048921 | Bacteria | 1543 |
| 332 | Ga0496119_0021633 | 3300048922 | Bacteria | 4638 |
| 333 | Ga0496120_0087944 | 3300048923 | Bacteria | 1667 |
| 334 | Ga0496121_0000265 | 3300048924 | Bacteria | 109251 |
| 335 | Ga0496121_0004306 | 3300048924 | Bacteria | 19282 |
| 336 | Ga0496121_0007746 | 3300048924 | Bacteria | 12872 |
| 337 | Ga0496121_0010192 | 3300048924 | Bacteria | 10642 |
| 338 | Ga0496122_0003946 | 3300048925 | Bacteria | 18964 |
| 339 | Ga0496123_0002697 | 3300048926 | Bacteria | 21346 |
| 340 | Ga0496123_0063434 | 3300048926 | Bacteria | 2360 |
| 341 | Ga0496124_0093856 | 3300048927 | Bacteria | 2442 |
| 342 | Ga0496124_0179137 | 3300048927 | Bacteria | 1633 |
| 343 | Ga0496124_0253182 | 3300048927 | Bacteria | 1301 |
| 344 | Ga0496125_0002054 | 3300048928 | Bacteria | 27194 |
| 345 | Ga0496126_0009405 | 3300048929 | Bacteria | 10380 |
| 346 | Ga0496126_0040565 | 3300048929 | Bacteria | 4314 |
| 347 | Ga0496126_0090963 | 3300048929 | Bacteria | 2684 |
| 348 | Ga0496126_0197635 | 3300048929 | Bacteria | 1700 |
| 349 | Ga0496126_0261445 | 3300048929 | Bacteria | 1439 |
| 350 | Ga0501031_0001626 | 3300049568 | Bacteria | 14067 |
| 351 | Ga0501031_0003394 | 3300049568 | Bacteria | 10221 |
| 352 | Ga0501031_0033746 | 3300049568 | Bacteria | 3340 |
| 353 | Ga0501031_0078537 | 3300049568 | Bacteria | 2150 |
| 354 | Ga0501031_0087122 | 3300049568 | Bacteria | 2036 |
| 355 | Ga0501031_0158696 | 3300049568 | Bacteria | 1478 |
| 356 | Ga0501032_0000005 | 3300049569 | Bacteria | 262926 |
| 357 | Ga0501032_0004418 | 3300049569 | Bacteria | 10613 |
| 358 | Ga0501032_0009241 | 3300049569 | Bacteria | 7145 |
| 359 | Ga0501032_0015782 | 3300049569 | Bacteria | 5326 |
| 360 | Ga0501032_0025530 | 3300049569 | Bacteria | 4072 |
| 361 | Ga0501033_0001174 | 3300049570 | Bacteria | 23619 |
| 362 | Ga0501033_0001918 | 3300049570 | Bacteria | 18103 |
| 363 | Ga0501033_0006909 | 3300049570 | Bacteria | 8861 |
| 364 | Ga0501033_0007700 | 3300049570 | Bacteria | 8356 |
| 365 | Ga0501033_0011510 | 3300049570 | Bacteria | 6770 |
| 366 | Ga0501033_0014091 | 3300049570 | Bacteria | 6079 |
| 367 | Ga0501033_0103944 | 3300049570 | Bacteria | 2071 |
| 368 | Ga0501033_0159196 | 3300049570 | Bacteria | 1626 |
| 369 | Ga0501034_0000027 | 3300049571 | Bacteria | 260512 |
| 370 | Ga0501034_0006928 | 3300049571 | Bacteria | 12113 |
| 371 | Ga0501034_0043172 | 3300049571 | Bacteria | 4564 |
| 372 | Ga0501034_0048394 | 3300049571 | Bacteria | 4291 |
| 373 | Ga0501034_0069581 | 3300049571 | Bacteria | 3530 |
| 374 | Ga0501034_0069856 | 3300049571 | Bacteria | 3523 |
| 375 | Ga0501034_0094596 | 3300049571 | Bacteria | 2985 |
| 376 | Ga0501034_0178099 | 3300049571 | Bacteria | 2091 |
| 377 | Ga0501034_0195433 | 3300049571 | Bacteria | 1983 |
| 378 | Ga0501034_0218387 | 3300049571 | Bacteria | 1859 |
| 379 | Ga0501034_0317015 | 3300049571 | Bacteria | 1492 |
| 380 | Ga0501036_0003212 | 3300049572 | Bacteria | 13040 |
| 381 | Ga0501036_0003777 | 3300049572 | Bacteria | 12139 |
| 382 | Ga0501036_0014934 | 3300049572 | Bacteria | 6478 |
| 383 | Ga0501036_0038227 | 3300049572 | Bacteria | 4061 |
| 384 | Ga0501036_0111337 | 3300049572 | Bacteria | 2313 |
| 385 | Ga0501037_0000125 | 3300049573 | Bacteria | 71187 |
| 386 | Ga0501037_0001255 | 3300049573 | Bacteria | 18688 |
| 387 | Ga0501037_0001881 | 3300049573 | Bacteria | 15257 |
| 388 | Ga0501037_0003998 | 3300049573 | Bacteria | 10688 |
| 389 | Ga0501037_0024632 | 3300049573 | Bacteria | 4449 |
| 390 | Ga0501037_0027629 | 3300049573 | Bacteria | 4192 |
| 391 | Ga0501037_0031308 | 3300049573 | Bacteria | 3927 |
| 392 | Ga0501037_0246800 | 3300049573 | Bacteria | 1250 |
| 393 | Ga0501038_0000053 | 3300049574 | Bacteria | 94583 |
| 394 | Ga0501038_0001348 | 3300049574 | Bacteria | 22355 |
| 395 | Ga0501038_0002739 | 3300049574 | Bacteria | 16418 |
| 396 | Ga0501038_0009152 | 3300049574 | Bacteria | 9088 |
| 397 | Ga0501038_0010268 | 3300049574 | Bacteria | 8568 |
| 398 | Ga0501038_0010552 | 3300049574 | Bacteria | 8448 |
| 399 | Ga0501038_0021002 | 3300049574 | Bacteria | 5866 |
| 400 | Ga0501038_0025672 | 3300049574 | Bacteria | 5249 |
| 401 | Ga0501038_0034203 | 3300049574 | Bacteria | 4471 |
| 402 | Ga0501038_0037038 | 3300049574 | Bacteria | 4279 |
| 403 | Ga0501038_0084110 | 3300049574 | Bacteria | 2677 |
| 404 | Ga0501038_0275214 | 3300049574 | Bacteria | 1326 |
| 405 | Ga0501039_0001416 | 3300049575 | Bacteria | 17647 |
| 406 | Ga0501039_0001417 | 3300049575 | Bacteria | 17639 |
| 407 | Ga0501039_0007940 | 3300049575 | Bacteria | 8084 |
| 408 | Ga0501039_0061713 | 3300049575 | Bacteria | 2903 |
| 409 | Ga0501039_0070553 | 3300049575 | Bacteria | 2714 |
| 410 | Ga0501039_0082655 | 3300049575 | Bacteria | 2500 |
| 411 | Ga0501039_0105324 | 3300049575 | Bacteria | 2202 |
| 412 | Ga0501039_0174663 | 3300049575 | Bacteria | 1689 |
| 413 | Ga0501039_0194065 | 3300049575 | Bacteria | 1596 |
| 414 | Ga0501042_0006938 | 3300049578 | Bacteria | 7391 |
| 415 | Ga0501042_0015677 | 3300049578 | Bacteria | 5191 |
| 416 | Ga0501042_0021926 | 3300049578 | Bacteria | 4458 |
| 417 | Ga0501042_0091435 | 3300049578 | Bacteria | 2184 |
| 418 | Ga0501043_0000011 | 3300049579 | Bacteria | 198958 |
| 419 | Ga0501043_0001785 | 3300049579 | Bacteria | 18494 |
| 420 | Ga0501043_0003502 | 3300049579 | Bacteria | 12909 |
| 421 | Ga0501043_0003989 | 3300049579 | Bacteria | 12089 |
| 422 | Ga0501043_0007977 | 3300049579 | Bacteria | 8362 |
| 423 | Ga0501043_0010777 | 3300049579 | Bacteria | 7159 |
| 424 | Ga0501043_0023994 | 3300049579 | Bacteria | 4785 |
| 425 | Ga0501043_0041137 | 3300049579 | Bacteria | 3631 |
| 426 | Ga0501043_0044293 | 3300049579 | Bacteria | 3498 |
| 427 | Ga0501043_0052745 | 3300049579 | Bacteria | 3194 |
| 428 | Ga0501046_0004167 | 3300049580 | Bacteria | 13167 |
| 429 | Ga0501046_0010460 | 3300049580 | Bacteria | 7969 |
| 430 | Ga0501046_0011219 | 3300049580 | Bacteria | 7673 |
| 431 | Ga0501046_0021539 | 3300049580 | Bacteria | 5319 |
| 432 | Ga0501046_0024230 | 3300049580 | Bacteria | 4981 |
| 433 | Ga0501046_0038705 | 3300049580 | Bacteria | 3824 |
| 434 | Ga0501046_0042039 | 3300049580 | Bacteria | 3645 |
| 435 | Ga0501046_0132664 | 3300049580 | Bacteria | 1888 |
| 436 | Ga0501046_0221858 | 3300049580 | Bacteria | 1399 |
| 437 | Ga0501047_0000581 | 3300049581 | Bacteria | 38872 |
| 438 | Ga0501047_0004223 | 3300049581 | Bacteria | 13522 |
| 439 | Ga0501047_0009350 | 3300049581 | Bacteria | 9254 |
| 440 | Ga0501047_0026424 | 3300049581 | Bacteria | 5584 |
| 441 | Ga0501047_0036757 | 3300049581 | Bacteria | 4734 |
| 442 | Ga0501047_0040670 | 3300049581 | Bacteria | 4495 |
| 443 | Ga0501047_0043601 | 3300049581 | Bacteria | 4333 |
| 444 | Ga0501047_0084287 | 3300049581 | Bacteria | 3054 |
| 445 | Ga0501047_0301651 | 3300049581 | Bacteria | 1444 |
| 446 | Ga0501048_0002011 | 3300049582 | Bacteria | 15451 |
| 447 | Ga0501048_0005098 | 3300049582 | Bacteria | 10009 |
| 448 | Ga0501048_0010180 | 3300049582 | Bacteria | 7032 |
| 449 | Ga0501048_0011775 | 3300049582 | Bacteria | 6519 |
| 450 | Ga0501048_0029682 | 3300049582 | Bacteria | 3963 |
| 451 | Ga0501048_0031071 | 3300049582 | Bacteria | 3865 |
| 452 | Ga0501067_0004621 | 3300049583 | Bacteria | 7622 |
| 453 | Ga0501067_0008285 | 3300049583 | Bacteria | 5772 |
| 454 | Ga0501067_0025467 | 3300049583 | Bacteria | 3279 |
| 455 | Ga0501067_0062471 | 3300049583 | Bacteria | 2062 |
| 456 | Ga0501068_0002752 | 3300049584 | Bacteria | 9339 |
| 457 | Ga0501068_0016002 | 3300049584 | Bacteria | 4320 |
| 458 | Ga0501068_0016689 | 3300049584 | Bacteria | 4235 |
| 459 | Ga0501068_0020455 | 3300049584 | Bacteria | 3856 |
| 460 | Ga0501068_0085158 | 3300049584 | Bacteria | 1945 |
| 461 | Ga0501069_0001078 | 3300049585 | Bacteria | 13114 |
| 462 | Ga0501069_0002656 | 3300049585 | Bacteria | 9124 |
| 463 | Ga0501069_0006483 | 3300049585 | Bacteria | 6119 |
| 464 | Ga0501069_0009547 | 3300049585 | Bacteria | 5122 |
| 465 | Ga0501070_0008169 | 3300049586 | Bacteria | 8853 |
| 466 | Ga0501070_0015441 | 3300049586 | Bacteria | 6424 |
| 467 | Ga0501070_0070219 | 3300049586 | Bacteria | 2900 |
| 468 | Ga0501070_0074318 | 3300049586 | Bacteria | 2813 |
| 469 | Ga0501070_0227273 | 3300049586 | Bacteria | 1529 |
| 470 | Ga0501071_0014348 | 3300049587 | Bacteria | 5417 |
| 471 | Ga0501071_0086994 | 3300049587 | Bacteria | 2292 |
| 472 | Ga0501072_0197083 | 3300049588 | Bacteria | 1606 |
| 473 | Ga0501073_0003878 | 3300049589 | Bacteria | 11225 |
| 474 | Ga0501073_0019733 | 3300049589 | Bacteria | 4865 |
| 475 | Ga0501073_0019784 | 3300049589 | Bacteria | 4858 |
| 476 | Ga0501073_0048125 | 3300049589 | Bacteria | 2994 |
| 477 | Ga0501073_0059823 | 3300049589 | Bacteria | 2659 |
| 478 | Ga0501073_0109947 | 3300049589 | Bacteria | 1912 |
| 479 | Ga0501074_0004446 | 3300049590 | Bacteria | 10031 |
| 480 | Ga0501074_0005779 | 3300049590 | Bacteria | 8921 |
| 481 | Ga0501074_0008800 | 3300049590 | Bacteria | 7317 |
| 482 | Ga0501074_0028821 | 3300049590 | Bacteria | 4022 |
| 483 | Ga0501076_0042168 | 3300049592 | Bacteria | 3593 |
| 484 | Ga0501077_0136906 | 3300049593 | Bacteria | 1553 |
| 485 | Ga0501077_0188865 | 3300049593 | Bacteria | 1309 |
| 486 | Ga0501259_000060 | 3300049688 | Bacteria | 15102 |
| 487 | Ga0501079_0089088 | 3300049741 | Bacteria | 2389 |
| 488 | Ga0501079_0199788 | 3300049741 | Bacteria | 1561 |
| 489 | Ga0501080_0001694 | 3300049742 | Bacteria | 18799 |
| 490 | Ga0501080_0005649 | 3300049742 | Bacteria | 11180 |
| 491 | Ga0501080_0008204 | 3300049742 | Bacteria | 9459 |
| 492 | Ga0501080_0015542 | 3300049742 | Bacteria | 7019 |
| 493 | Ga0501080_0020346 | 3300049742 | Bacteria | 6141 |
| 494 | Ga0501080_0030751 | 3300049742 | Bacteria | 5002 |
| 495 | Ga0501080_0048187 | 3300049742 | Bacteria | 3966 |
| 496 | Ga0501080_0090332 | 3300049742 | Bacteria | 2845 |
| 497 | Ga0501080_0213891 | 3300049742 | Bacteria | 1766 |
| 498 | Ga0501080_0250923 | 3300049742 | Bacteria | 1613 |
| 499 | Ga0501083_0000208 | 3300049744 | Bacteria | 38117 |
| 500 | Ga0501083_0057951 | 3300049744 | Bacteria | 2592 |
| 501 | Ga0501083_0108254 | 3300049744 | Bacteria | 1828 |
| 502 | Ga0501035_0000589 | 3300049822 | Bacteria | 40009 |
| 503 | Ga0501035_0000594 | 3300049822 | Bacteria | 39868 |
| 504 | Ga0501035_0000755 | 3300049822 | Bacteria | 34825 |
| 505 | Ga0501035_0001704 | 3300049822 | Bacteria | 22196 |
| 506 | Ga0501035_0004158 | 3300049822 | Bacteria | 13758 |
| 507 | Ga0501035_0022979 | 3300049822 | Bacteria | 5723 |
| 508 | Ga0501035_0039124 | 3300049822 | Bacteria | 4292 |
| 509 | Ga0501035_0040993 | 3300049822 | Bacteria | 4181 |
| 510 | Ga0501035_0045961 | 3300049822 | Bacteria | 3927 |
| 511 | Ga0501035_0046601 | 3300049822 | Bacteria | 3899 |
| 512 | Ga0501035_0071855 | 3300049822 | Bacteria | 3063 |
| 513 | Ga0501035_0099665 | 3300049822 | Bacteria | 2550 |
| 514 | Ga0501035_0105297 | 3300049822 | Bacteria | 2473 |
| 515 | Ga0501035_0159802 | 3300049822 | Bacteria | 1951 |
| 516 | Ga0501035_0167675 | 3300049822 | Bacteria | 1898 |
| 517 | Ga0501035_0217812 | 3300049822 | Bacteria | 1631 |
| 518 | Ga0501044_0002324 | 3300049823 | Bacteria | 21666 |
| 519 | Ga0501044_0008654 | 3300049823 | Bacteria | 11148 |
| 520 | Ga0501044_0013659 | 3300049823 | Bacteria | 8775 |
| 521 | Ga0501044_0026369 | 3300049823 | Bacteria | 6152 |
| 522 | Ga0501044_0056105 | 3300049823 | Bacteria | 4044 |
| 523 | Ga0501044_0060429 | 3300049823 | Bacteria | 3880 |
| 524 | Ga0501044_0081195 | 3300049823 | Bacteria | 3282 |
| 525 | Ga0501044_0161190 | 3300049823 | Bacteria | 2219 |
| 526 | Ga0501044_0176342 | 3300049823 | Bacteria | 2106 |
| 527 | Ga0501044_0211891 | 3300049823 | Bacteria | 1891 |
| 528 | Ga0501044_0237105 | 3300049823 | Bacteria | 1769 |
| 529 | Ga0501044_0319498 | 3300049823 | Bacteria | 1477 |
| 530 | Ga0501044_0365042 | 3300049823 | Bacteria | 1361 |
| 531 | Ga0501045_0005507 | 3300049824 | Bacteria | 8759 |
| 532 | Ga0501045_0014258 | 3300049824 | Bacteria | 5633 |
| 533 | Ga0501045_0085901 | 3300049824 | Bacteria | 2322 |
| 534 | nmdc:mga03683_5_c1 | 3300050489 | Bacteria | 157897 |
| 535 | nmdc:mga03n38_244_c1 | 3300050490 | Bacteria | 12819 |
| 536 | nmdc:mga03n38_59697_c1 | 3300050490 | Bacteria | 1732 |
| 537 | nmdc:mga00v17_78829_c1 | 3300050491 | Bacteria | 2053 |
| 538 | nmdc:mga00v17_95_c1 | 3300050491 | Bacteria | 52432 |
| 539 | nmdc:mga0yw44_72617_c1 | 3300050492 | Bacteria | 2139 |
| 540 | nmdc:mga0k408_29423_c1 | 3300050493 | Bacteria | 3126 |
| 541 | nmdc:mga06z11_17662_c1 | 3300050494 | Bacteria | 3243 |
| 542 | nmdc:mga04h51_5197_c1 | 3300050495 | Bacteria | 3303 |
| 543 | nmdc:mga07m45_2837_c1 | 3300050496 | Bacteria | 8199 |
| 544 | nmdc:mga07m45_7313_c1 | 3300050496 | Bacteria | 5634 |
| 545 | nmdc:mga05p37_395962_c1 | 3300050507 | Bacteria | 1614 |
| 546 | nmdc:mga06r32_188771_c1 | 3300050510 | Bacteria | 2048 |
| 547 | Ga0500644_0000325 | 3300053088 | Bacteria | 24740 |
| 548 | Ga0500644_0023547 | 3300053088 | Bacteria | 1871 |
| 549 | Ga0500651_0000004 | 3300053093 | Bacteria | 389879 |
| 550 | Ga0500651_0001377 | 3300053093 | Bacteria | 12178 |
| 551 | Ga0500651_0003048 | 3300053093 | Bacteria | 9060 |
| 552 | Ga0500566_0003537 | 3300053094 | Bacteria | 9314 |
| 553 | Ga0500641_0005170 | 3300053096 | Bacteria | 4624 |
| 554 | Ga0500641_0022724 | 3300053096 | Bacteria | 2405 |
| 555 | Ga0500650_0011126 | 3300053098 | Bacteria | 3690 |
| 556 | Ga0500555_000026 | 3300053103 | Bacteria | 114412 |
| 557 | Ga0500556_0000017 | 3300053104 | Bacteria | 192495 |
| 558 | Ga0500556_0000195 | 3300053104 | Bacteria | 49800 |
| 559 | Ga0500592_000349 | 3300053116 | Bacteria | 7762 |
| 560 | Ga0500593_000006 | 3300053117 | Bacteria | 88644 |
| 561 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 562 | Ga0500595_000035 | 3300053119 | Bacteria | 106463 |
| 563 | Ga0500595_002917 | 3300053119 | Bacteria | 8181 |
| 564 | Ga0500595_002948 | 3300053119 | Bacteria | 8123 |
| 565 | Ga0500595_006998 | 3300053119 | Bacteria | 4727 |
| 566 | Ga0500607_088437 | 3300053121 | Bacteria | 1564 |
| 567 | Ga0500608_012354 | 3300053122 | Bacteria | 3742 |
| 568 | Ga0500642_0000012 | 3300053130 | Bacteria | 206424 |
| 569 | Ga0500652_000146 | 3300053131 | Bacteria | 26947 |
| 570 | Ga0500652_012191 | 3300053131 | Bacteria | 3008 |
| 571 | Ga0500658_0006611 | 3300053134 | Bacteria | 4297 |
| 572 | Ga0500658_0015652 | 3300053134 | Bacteria | 2818 |
| 573 | Ga0500559_0000848 | 3300053136 | Bacteria | 19718 |
| 574 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 575 | Ga0500568_0010600 | 3300053139 | Bacteria | 4303 |
| 576 | Ga0500568_0011318 | 3300053139 | Bacteria | 4147 |
| 577 | Ga0500577_0006426 | 3300053142 | Bacteria | 3243 |
| 578 | Ga0500586_002295 | 3300053145 | Bacteria | 4270 |
| 579 | Ga0500604_0023785 | 3300053151 | Bacteria | 1749 |
| 580 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 581 | Ga0500616_0001093 | 3300053153 | Bacteria | 28182 |
| 582 | Ga0500616_0012122 | 3300053153 | Bacteria | 5056 |
| 583 | Ga0500616_0023146 | 3300053153 | Bacteria | 3463 |
| 584 | Ga0500622_0001963 | 3300053156 | Bacteria | 15485 |
| 585 | Ga0500622_0031719 | 3300053156 | Bacteria | 2773 |
| 586 | Ga0500627_0038807 | 3300053158 | Bacteria | 2038 |
| 587 | Ga0500634_0000014 | 3300053161 | Bacteria | 114625 |
| 588 | Ga0500638_000002 | 3300053162 | Bacteria | 188968 |
| 589 | Ga0500636_0000495 | 3300053177 | Bacteria | 21410 |
| 590 | Ga0500645_000629 | 3300053730 | Bacteria | 22510 |
| 591 | Ga0500645_024648 | 3300053730 | Bacteria | 1838 |
| 592 | Ga0501084_0009969 | 3300054114 | Bacteria | 7852 |
| 593 | Ga0501084_0023861 | 3300054114 | Bacteria | 5101 |
| 594 | Ga0501084_0024592 | 3300054114 | Bacteria | 5026 |
| 595 | Ga0501082_0013202 | 3300060353 | Bacteria | 7104 |
| 596 | Ga0501082_0093886 | 3300060353 | Bacteria | 2592 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046531 | Ga0495665_0142380 | Ga0495665_0142380_313_1203 | 296 |
| 2 | 3300025924 | Ga0207694_10206129 | Ga0207694_102061291 | 313 |
| 3 | 3300009551 | Ga0105238_10279469 | Ga0105238_102794692 | 315 |
| 4 | 3300035118 | Ga0373954_0003833 | Ga0373954_0003833_99_1049 | 316 |
| 5 | 3300035119 | Ga0373956_0002705 | Ga0373956_0002705_6108_7058 | 316 |
| 6 | 3300035724 | Ga0373933_0092173 | Ga0373933_0092173_805_1755 | 316 |
| 7 | 3300046558 | Ga0495633_0012077 | Ga0495633_0012077_3156_4307 | 318 |
| 8 | 3300015262 | Ga0182007_10000051 | Ga0182007_10000051125 | 319 |
| 9 | 3300046665 | Ga0495661_0000017 | Ga0495661_0000017_125751_126902 | 319 |
| 10 | 3300039437 | Ga0436365_0722766 | Ga0436365_0722766_2738_3703 | 321 |
| 11 | 3300049573 | Ga0501037_0246800 | Ga0501037_0246800_15_983 | 322 |
| 12 | iso_pu_bacteria | 2899370129 | 2899372841 | 322 |
| 13 | 3300005458 | Ga0070681_10077741 | Ga0070681_100777412 | 325 |
| 14 | 3300005530 | Ga0070679_100387958 | Ga0070679_1003879582 | 325 |
| 15 | 3300053103 | Ga0500555_000026 | Ga0500555_000026_93263_94321 | 325 |
| 16 | 3300053153 | Ga0500616_0012122 | Ga0500616_0012122_2465_3523 | 325 |
| 17 | iso_pu_bacteria | 2935684952 | 2935688570 | 325 |
| 18 | iso_pu_bacteria | 2935713505 | 2935715589 | 325 |
| 19 | iso_pu_bacteria | 2935722832 | 2935725847 | 325 |
| 20 | iso_pu_bacteria | 2935732158 | 2935734408 | 325 |
| 21 | iso_pu_bacteria | 2935741537 | 2935743787 | 325 |
| 22 | iso_pu_bacteria | 2935750917 | 2935754176 | 325 |
| 23 | iso_pu_bacteria | 2940556831 | 2940560448 | 325 |
| 24 | 3300003320 | rootH2_10004835 | rootH2_100048352 | 326 |
| 25 | 3300005546 | Ga0070696_100026747 | Ga0070696_1000267472 | 326 |
| 26 | 3300005614 | Ga0068856_100004432 | Ga0068856_1000044324 | 326 |
| 27 | 3300005614 | Ga0068856_100054240 | Ga0068856_1000542402 | 326 |
| 28 | 3300006844 | Ga0075428_100137254 | Ga0075428_1001372542 | 326 |
| 29 | 3300009093 | Ga0105240_10144047 | Ga0105240_101440471 | 326 |
| 30 | 3300009093 | Ga0105240_10287702 | Ga0105240_102877022 | 326 |
| 31 | 3300009545 | Ga0105237_10012602 | Ga0105237_100126021 | 326 |
| 32 | 3300009551 | Ga0105238_10017854 | Ga0105238_100178542 | 326 |
| 33 | 3300009551 | Ga0105238_10258675 | Ga0105238_102586751 | 326 |
| 34 | 3300014969 | Ga0157376_10285287 | Ga0157376_102852872 | 326 |
| 35 | 3300025912 | Ga0207707_10061643 | Ga0207707_100616432 | 326 |
| 36 | 3300025914 | Ga0207671_10008185 | Ga0207671_100081851 | 326 |
| 37 | 3300025921 | Ga0207652_10335493 | Ga0207652_103354932 | 326 |
| 38 | 3300025924 | Ga0207694_10003718 | Ga0207694_100037183 | 326 |
| 39 | 3300025924 | Ga0207694_10009881 | Ga0207694_100098814 | 326 |
| 40 | 3300025924 | Ga0207694_10073457 | Ga0207694_100734572 | 326 |
| 41 | 3300025949 | Ga0207667_10152217 | Ga0207667_101522172 | 326 |
| 42 | 3300026078 | Ga0207702_10000452 | Ga0207702_1000045233 | 326 |
| 43 | 3300026078 | Ga0207702_10000795 | Ga0207702_1000079537 | 326 |
| 44 | 3300028800 | Ga0265338_10015712 | Ga0265338_100157124 | 326 |
| 45 | 3300039437 | Ga0436365_0395979 | Ga0436365_0395979_8711_9772 | 326 |
| 46 | iso_pu_bacteria | 2786546517 | 2787437863 | 326 |
| 47 | 3300005327 | Ga0070658_10329615 | Ga0070658_103296151 | 327 |
| 48 | 3300005336 | Ga0070680_100042419 | Ga0070680_1000424191 | 327 |
| 49 | 3300005435 | Ga0070714_100477322 | Ga0070714_1004773221 | 327 |
| 50 | 3300005468 | Ga0070707_100127385 | Ga0070707_1001273852 | 327 |
| 51 | 3300005530 | Ga0070679_100034031 | Ga0070679_1000340312 | 327 |
| 52 | 3300005548 | Ga0070665_100078620 | Ga0070665_1000786203 | 327 |
| 53 | 3300005842 | Ga0068858_100250787 | Ga0068858_1002507873 | 327 |
| 54 | 3300006048 | Ga0075363_100000054 | Ga0075363_10000005416 | 327 |
| 55 | 3300006051 | Ga0075364_10006576 | Ga0075364_100065766 | 327 |
| 56 | 3300006177 | Ga0075362_10000010 | Ga0075362_1000001081 | 327 |
| 57 | 3300006178 | Ga0075367_10015014 | Ga0075367_100150147 | 327 |
| 58 | 3300006353 | Ga0075370_10017896 | Ga0075370_100178965 | 327 |
| 59 | 3300009093 | Ga0105240_10187683 | Ga0105240_101876833 | 327 |
| 60 | 3300009174 | Ga0105241_10000040 | Ga0105241_1000004034 | 327 |
| 61 | 3300009176 | Ga0105242_10199507 | Ga0105242_101995072 | 327 |
| 62 | 3300009545 | Ga0105237_10072488 | Ga0105237_100724881 | 327 |
| 63 | 3300009551 | Ga0105238_10082103 | Ga0105238_100821032 | 327 |
| 64 | 3300010375 | Ga0105239_10025567 | Ga0105239_100255674 | 327 |
| 65 | 3300010375 | Ga0105239_10036746 | Ga0105239_100367462 | 327 |
| 66 | 3300010375 | Ga0105239_10147181 | Ga0105239_101471813 | 327 |
| 67 | 3300013296 | Ga0157374_10386595 | Ga0157374_103865952 | 327 |
| 68 | 3300014969 | Ga0157376_10012422 | Ga0157376_100124223 | 327 |
| 69 | 3300015262 | Ga0182007_10016874 | Ga0182007_100168743 | 327 |
| 70 | 3300025911 | Ga0207654_10000060 | Ga0207654_100000609 | 327 |
| 71 | 3300025913 | Ga0207695_10310666 | Ga0207695_103106662 | 327 |
| 72 | 3300025914 | Ga0207671_10022133 | Ga0207671_100221331 | 327 |
| 73 | 3300025921 | Ga0207652_10005516 | Ga0207652_100055166 | 327 |
| 74 | 3300025924 | Ga0207694_10140387 | Ga0207694_101403873 | 327 |
| 75 | 3300025934 | Ga0207686_10124467 | Ga0207686_101244671 | 327 |
| 76 | 3300026078 | Ga0207702_10146107 | Ga0207702_101461072 | 327 |
| 77 | 3300028379 | Ga0268266_10114685 | Ga0268266_101146852 | 327 |
| 78 | 3300028379 | Ga0268266_10355042 | Ga0268266_103550421 | 327 |
| 79 | 3300031911 | Ga0307412_10171950 | Ga0307412_101719501 | 327 |
| 80 | 3300032002 | Ga0307416_100144355 | Ga0307416_1001443552 | 327 |
| 81 | 3300037068 | Ga0373925_0014095 | Ga0373925_0014095_251_1276 | 327 |
| 82 | 3300039437 | Ga0436365_0472674 | Ga0436365_0472674_175_1227 | 327 |
| 83 | 3300045049 | Ga0466959_0091662 | Ga0466959_0091662_668_1699 | 327 |
| 84 | 3300045051 | Ga0451576_0404833 | Ga0451576_0404833_380_1420 | 327 |
| 85 | 3300045836 | Ga0466958_0200855 | Ga0466958_0200855_35_1066 | 327 |
| 86 | 3300046459 | Ga0495629_0038136 | Ga0495629_0038136_1100_2143 | 327 |
| 87 | 3300046472 | Ga0495580_0005598 | Ga0495580_0005598_2815_3858 | 327 |
| 88 | 3300046473 | Ga0495582_0006316 | Ga0495582_0006316_2456_3499 | 327 |
| 89 | 3300046499 | Ga0495594_0003253 | Ga0495594_0003253_6497_7540 | 327 |
| 90 | 3300046683 | Ga0495658_0008414 | Ga0495658_0008414_978_2021 | 327 |
| 91 | 3300047320 | Ga0495672_0002365 | Ga0495672_0002365_3044_4045 | 327 |
| 92 | 3300048918 | Ga0496115_0014023 | Ga0496115_0014023_1337_2362 | 327 |
| 93 | 3300049571 | Ga0501034_0195433 | Ga0501034_0195433_197_1249 | 327 |
| 94 | 3300049573 | Ga0501037_0001881 | Ga0501037_0001881_138_1184 | 327 |
| 95 | 3300049581 | Ga0501047_0000581 | Ga0501047_0000581_194_1195 | 327 |
| 96 | 3300049688 | Ga0501259_000060 | Ga0501259_000060_9604_10644 | 327 |
| 97 | 3300049822 | Ga0501035_0000594 | Ga0501035_0000594_35088_36089 | 327 |
| 98 | 3300049823 | Ga0501044_0002324 | Ga0501044_0002324_9529_10530 | 327 |
| 99 | 3300049823 | Ga0501044_0008654 | Ga0501044_0008654_1642_2688 | 327 |
| 100 | 3300050489 | nmdc:mga03683_5_c1 | nmdc:mga03683_5_c1_83903_84943 | 327 |
| 101 | 3300050490 | nmdc:mga03n38_244_c1 | nmdc:mga03n38_244_c1_9318_10361 | 327 |
| 102 | 3300050491 | nmdc:mga00v17_95_c1 | nmdc:mga00v17_95_c1_7099_8139 | 327 |
| 103 | 3300050493 | nmdc:mga0k408_29423_c1 | nmdc:mga0k408_29423_c1_1754_2797 | 327 |
| 104 | 3300050494 | nmdc:mga06z11_17662_c1 | nmdc:mga06z11_17662_c1_921_1964 | 327 |
| 105 | 3300050496 | nmdc:mga07m45_2837_c1 | nmdc:mga07m45_2837_c1_1539_2582 | 327 |
| 106 | 3300053119 | Ga0500595_000035 | Ga0500595_000035_70119_71195 | 327 |
| 107 | 3300053162 | Ga0500638_000002 | Ga0500638_000002_98037_99071 | 327 |
| 108 | iso_pu_bacteria | 2687453341 | 2688391968 | 327 |
| 109 | 3300005437 | Ga0070710_10003372 | Ga0070710_100033729 | 328 |
| 110 | 3300005563 | Ga0068855_100178166 | Ga0068855_1001781662 | 328 |
| 111 | 3300005616 | Ga0068852_100130918 | Ga0068852_1001309182 | 328 |
| 112 | 3300005718 | Ga0068866_10000352 | Ga0068866_100003527 | 328 |
| 113 | 3300009093 | Ga0105240_10008978 | Ga0105240_100089784 | 328 |
| 114 | 3300009176 | Ga0105242_10000863 | Ga0105242_1000086314 | 328 |
| 115 | 3300009553 | Ga0105249_10006316 | Ga0105249_100063162 | 328 |
| 116 | 3300010375 | Ga0105239_10002481 | Ga0105239_1000248114 | 328 |
| 117 | 3300025898 | Ga0207692_10001968 | Ga0207692_100019682 | 328 |
| 118 | 3300025899 | Ga0207642_10000092 | Ga0207642_100000929 | 328 |
| 119 | 3300025913 | Ga0207695_10022662 | Ga0207695_100226622 | 328 |
| 120 | 3300025934 | Ga0207686_10000304 | Ga0207686_1000030414 | 328 |
| 121 | 3300025949 | Ga0207667_10225043 | Ga0207667_102250432 | 328 |
| 122 | 3300030731 | Ga0316177_1184578 | Ga0316177_11845784 | 328 |
| 123 | 3300035691 | Ga0373931_0084727 | Ga0373931_0084727_295_1332 | 328 |
| 124 | 3300044658 | Ga0466972_0052974 | Ga0466972_0052974_167_1213 | 328 |
| 125 | 3300044683 | Ga0466965_0003030 | Ga0466965_0003030_1817_2863 | 328 |
| 126 | 3300044901 | Ga0466960_0001054 | Ga0466960_0001054_834_1880 | 328 |
| 127 | 3300049568 | Ga0501031_0087122 | Ga0501031_0087122_420_1481 | 328 |
| 128 | 3300049569 | Ga0501032_0015782 | Ga0501032_0015782_506_1567 | 328 |
| 129 | 3300049571 | Ga0501034_0006928 | Ga0501034_0006928_5769_6830 | 328 |
| 130 | 3300049575 | Ga0501039_0007940 | Ga0501039_0007940_1954_3018 | 328 |
| 131 | 3300049575 | Ga0501039_0061713 | Ga0501039_0061713_91_1152 | 328 |
| 132 | 3300049579 | Ga0501043_0001785 | Ga0501043_0001785_1453_2511 | 328 |
| 133 | 3300049580 | Ga0501046_0011219 | Ga0501046_0011219_6529_7590 | 328 |
| 134 | 3300049581 | Ga0501047_0040670 | Ga0501047_0040670_1403_2467 | 328 |
| 135 | 3300049581 | Ga0501047_0043601 | Ga0501047_0043601_1214_2272 | 328 |
| 136 | 3300049584 | Ga0501068_0085158 | Ga0501068_0085158_113_1174 | 328 |
| 137 | 3300049585 | Ga0501069_0009547 | Ga0501069_0009547_3486_4547 | 328 |
| 138 | 3300049586 | Ga0501070_0070219 | Ga0501070_0070219_40_1101 | 328 |
| 139 | 3300049588 | Ga0501072_0197083 | Ga0501072_0197083_360_1421 | 328 |
| 140 | 3300049589 | Ga0501073_0059823 | Ga0501073_0059823_1339_2403 | 328 |
| 141 | 3300049593 | Ga0501077_0136906 | Ga0501077_0136906_450_1508 | 328 |
| 142 | 3300049593 | Ga0501077_0188865 | Ga0501077_0188865_186_1244 | 328 |
| 143 | 3300049742 | Ga0501080_0250923 | Ga0501080_0250923_374_1432 | 328 |
| 144 | 3300049744 | Ga0501083_0000208 | Ga0501083_0000208_16062_17120 | 328 |
| 145 | 3300049822 | Ga0501035_0040993 | Ga0501035_0040993_1050_2108 | 328 |
| 146 | 3300049822 | Ga0501035_0167675 | Ga0501035_0167675_207_1268 | 328 |
| 147 | 3300049823 | Ga0501044_0319498 | Ga0501044_0319498_94_1152 | 328 |
| 148 | 3300053093 | Ga0500651_0000004 | Ga0500651_0000004_170153_171292 | 328 |
| 149 | 3300054114 | Ga0501084_0023861 | Ga0501084_0023861_1987_3045 | 328 |
| 150 | 3300060353 | Ga0501082_0093886 | Ga0501082_0093886_38_1096 | 328 |
| 151 | iso_pu_bacteria | 2558860112 | 2558908760 | 328 |
| 152 | iso_pu_bacteria | 2870782633 | 2870786878 | 328 |
| 153 | iso_pu_bacteria | 8047710418 | 8047716774 | 328 |
| 154 | 3300001989 | JGI24739J22299_10010281 | JGI24739J22299_100102813 | 329 |
| 155 | 3300001990 | JGI24737J22298_10042568 | JGI24737J22298_100425682 | 329 |
| 156 | 3300002067 | JGI24735J21928_10028584 | JGI24735J21928_100285841 | 329 |
| 157 | 3300002067 | JGI24735J21928_10040147 | JGI24735J21928_100401472 | 329 |
| 158 | 3300002244 | JGI24742J22300_10011531 | JGI24742J22300_100115311 | 329 |
| 159 | 3300002987 | JGI25159J45721_1012079 | JGI25159J45721_10120793 | 329 |
| 160 | 3300003187 | JGI25151J46595_10000115 | JGI25151J46595_100001155 | 329 |
| 161 | 3300003214 | JGI25165J46597_1000254 | JGI25165J46597_10002544 | 329 |
| 162 | 3300003215 | JGI25153J46596_10006347 | JGI25153J46596_100063472 | 329 |
| 163 | 3300003771 | Ga0055526_1000476 | Ga0055526_100047612 | 329 |
| 164 | 3300003775 | Ga0055524_1000065 | Ga0055524_100006592 | 329 |
| 165 | 3300005262 | Ga0065165_1000234 | Ga0065165_100023411 | 329 |
| 166 | 3300005327 | Ga0070658_10084687 | Ga0070658_100846872 | 329 |
| 167 | 3300005329 | Ga0070683_100018116 | Ga0070683_1000181164 | 329 |
| 168 | 3300005336 | Ga0070680_100041343 | Ga0070680_1000413432 | 329 |
| 169 | 3300005337 | Ga0070682_100147618 | Ga0070682_1001476181 | 329 |
| 170 | 3300005339 | Ga0070660_100011370 | Ga0070660_1000113702 | 329 |
| 171 | 3300005339 | Ga0070660_100097419 | Ga0070660_1000974192 | 329 |
| 172 | 3300005347 | Ga0070668_100008027 | Ga0070668_1000080272 | 329 |
| 173 | 3300005347 | Ga0070668_100077419 | Ga0070668_1000774194 | 329 |
| 174 | 3300005347 | Ga0070668_100134473 | Ga0070668_1001344732 | 329 |
| 175 | 3300005353 | Ga0070669_100112287 | Ga0070669_1001122872 | 329 |
| 176 | 3300005354 | Ga0070675_100219364 | Ga0070675_1002193642 | 329 |
| 177 | 3300005355 | Ga0070671_100151891 | Ga0070671_1001518912 | 329 |
| 178 | 3300005356 | Ga0070674_100039327 | Ga0070674_1000393272 | 329 |
| 179 | 3300005356 | Ga0070674_100163758 | Ga0070674_1001637581 | 329 |
| 180 | 3300005366 | Ga0070659_100017643 | Ga0070659_1000176433 | 329 |
| 181 | 3300005434 | Ga0070709_10006797 | Ga0070709_100067978 | 329 |
| 182 | 3300005439 | Ga0070711_100023658 | Ga0070711_1000236582 | 329 |
| 183 | 3300005455 | Ga0070663_100014777 | Ga0070663_1000147773 | 329 |
| 184 | 3300005455 | Ga0070663_100027481 | Ga0070663_1000274812 | 329 |
| 185 | 3300005455 | Ga0070663_100027666 | Ga0070663_1000276662 | 329 |
| 186 | 3300005455 | Ga0070663_100034922 | Ga0070663_1000349222 | 329 |
| 187 | 3300005455 | Ga0070663_100061736 | Ga0070663_1000617362 | 329 |
| 188 | 3300005456 | Ga0070678_100037889 | Ga0070678_1000378892 | 329 |
| 189 | 3300005459 | Ga0068867_100074046 | Ga0068867_1000740462 | 329 |
| 190 | 3300005530 | Ga0070679_100021210 | Ga0070679_1000212105 | 329 |
| 191 | 3300005535 | Ga0070684_100126565 | Ga0070684_1001265652 | 329 |
| 192 | 3300005539 | Ga0068853_100067129 | Ga0068853_1000671292 | 329 |
| 193 | 3300005539 | Ga0068853_100210610 | Ga0068853_1002106102 | 329 |
| 194 | 3300005539 | Ga0068853_100339801 | Ga0068853_1003398012 | 329 |
| 195 | 3300005548 | Ga0070665_100057580 | Ga0070665_1000575802 | 329 |
| 196 | 3300005548 | Ga0070665_100459281 | Ga0070665_1004592811 | 329 |
| 197 | 3300005564 | Ga0070664_100049276 | Ga0070664_1000492762 | 329 |
| 198 | 3300005577 | Ga0068857_100006293 | Ga0068857_1000062932 | 329 |
| 199 | 3300005718 | Ga0068866_10118755 | Ga0068866_101187551 | 329 |
| 200 | 3300005937 | Ga0081455_10002181 | Ga0081455_100021816 | 329 |
| 201 | 3300005937 | Ga0081455_10017868 | Ga0081455_100178682 | 329 |
| 202 | 3300005937 | Ga0081455_10018740 | Ga0081455_100187402 | 329 |
| 203 | 3300005937 | Ga0081455_10214017 | Ga0081455_102140172 | 329 |
| 204 | 3300005981 | Ga0081538_10050827 | Ga0081538_100508272 | 329 |
| 205 | 3300005983 | Ga0081540_1002178 | Ga0081540_10021784 | 329 |
| 206 | 3300005983 | Ga0081540_1004228 | Ga0081540_10042289 | 329 |
| 207 | 3300005983 | Ga0081540_1007503 | Ga0081540_10075038 | 329 |
| 208 | 3300005983 | Ga0081540_1022713 | Ga0081540_10227132 | 329 |
| 209 | 3300006038 | Ga0075365_10195658 | Ga0075365_101956582 | 329 |
| 210 | 3300006048 | Ga0075363_100085491 | Ga0075363_1000854912 | 329 |
| 211 | 3300006051 | Ga0075364_10005813 | Ga0075364_100058136 | 329 |
| 212 | 3300006051 | Ga0075364_10096044 | Ga0075364_100960442 | 329 |
| 213 | 3300006051 | Ga0075364_10098650 | Ga0075364_100986502 | 329 |
| 214 | 3300006175 | Ga0070712_100014886 | Ga0070712_1000148862 | 329 |
| 215 | 3300006178 | Ga0075367_10092277 | Ga0075367_100922772 | 329 |
| 216 | 3300006195 | Ga0075366_10015875 | Ga0075366_100158752 | 329 |
| 217 | 3300006353 | Ga0075370_10005200 | Ga0075370_100052002 | 329 |
| 218 | 3300006358 | Ga0068871_100128779 | Ga0068871_1001287792 | 329 |
| 219 | 3300006844 | Ga0075428_100041074 | Ga0075428_1000410744 | 329 |
| 220 | 3300007788 | Ga0099795_10003131 | Ga0099795_100031312 | 329 |
| 221 | 3300009093 | Ga0105240_10076252 | Ga0105240_100762523 | 329 |
| 222 | 3300009147 | Ga0114129_10028277 | Ga0114129_100282772 | 329 |
| 223 | 3300009147 | Ga0114129_10262210 | Ga0114129_102622102 | 329 |
| 224 | 3300009148 | Ga0105243_10101259 | Ga0105243_101012592 | 329 |
| 225 | 3300009174 | Ga0105241_10169272 | Ga0105241_101692722 | 329 |
| 226 | 3300009177 | Ga0105248_10017437 | Ga0105248_100174374 | 329 |
| 227 | 3300009545 | Ga0105237_10022058 | Ga0105237_100220583 | 329 |
| 228 | 3300009545 | Ga0105237_10196225 | Ga0105237_101962252 | 329 |
| 229 | 3300009551 | Ga0105238_10033083 | Ga0105238_100330832 | 329 |
| 230 | 3300009553 | Ga0105249_10154760 | Ga0105249_101547601 | 329 |
| 231 | 3300010159 | Ga0099796_10005011 | Ga0099796_100050114 | 329 |
| 232 | 3300010375 | Ga0105239_10148647 | Ga0105239_101486472 | 329 |
| 233 | 3300011119 | Ga0105246_10237865 | Ga0105246_102378652 | 329 |
| 234 | 3300013102 | Ga0157371_10040186 | Ga0157371_100401862 | 329 |
| 235 | 3300013104 | Ga0157370_10146480 | Ga0157370_101464801 | 329 |
| 236 | 3300013105 | Ga0157369_10044262 | Ga0157369_100442624 | 329 |
| 237 | 3300013105 | Ga0157369_10059929 | Ga0157369_100599292 | 329 |
| 238 | 3300013105 | Ga0157369_10337134 | Ga0157369_103371341 | 329 |
| 239 | 3300013296 | Ga0157374_10085287 | Ga0157374_100852872 | 329 |
| 240 | 3300013306 | Ga0163162_10050689 | Ga0163162_100506892 | 329 |
| 241 | 3300014325 | Ga0163163_10073912 | Ga0163163_100739123 | 329 |
| 242 | 3300014325 | Ga0163163_10084396 | Ga0163163_100843962 | 329 |
| 243 | 3300014969 | Ga0157376_10046105 | Ga0157376_100461051 | 329 |
| 244 | 3300014969 | Ga0157376_10117973 | Ga0157376_101179732 | 329 |
| 245 | 3300015265 | Ga0182005_1028056 | Ga0182005_10280561 | 329 |
| 246 | 3300025261 | Ga0209233_1000028 | Ga0209233_1000028552 | 329 |
| 247 | 3300025284 | Ga0209130_1000090 | Ga0209130_1000090107 | 329 |
| 248 | 3300025284 | Ga0209130_1000609 | Ga0209130_100060912 | 329 |
| 249 | 3300025291 | Ga0209675_1001075 | Ga0209675_100107514 | 329 |
| 250 | 3300025294 | Ga0209025_1000084 | Ga0209025_1000084250 | 329 |
| 251 | 3300025295 | Ga0209564_1000059 | Ga0209564_1000059216 | 329 |
| 252 | 3300025295 | Ga0209564_1000971 | Ga0209564_100097115 | 329 |
| 253 | 3300025297 | Ga0209758_1001444 | Ga0209758_10014445 | 329 |
| 254 | 3300025297 | Ga0209758_1003954 | Ga0209758_10039547 | 329 |
| 255 | 3300025299 | Ga0209256_1000033 | Ga0209256_100003330 | 329 |
| 256 | 3300025302 | Ga0207426_1000113 | Ga0207426_1000113107 | 329 |
| 257 | 3300025898 | Ga0207692_10022820 | Ga0207692_100228204 | 329 |
| 258 | 3300025904 | Ga0207647_10000520 | Ga0207647_1000052010 | 329 |
| 259 | 3300025904 | Ga0207647_10013527 | Ga0207647_100135272 | 329 |
| 260 | 3300025904 | Ga0207647_10018948 | Ga0207647_100189485 | 329 |
| 261 | 3300025904 | Ga0207647_10080587 | Ga0207647_100805872 | 329 |
| 262 | 3300025906 | Ga0207699_10016578 | Ga0207699_100165784 | 329 |
| 263 | 3300025909 | Ga0207705_10000703 | Ga0207705_100007037 | 329 |
| 264 | 3300025913 | Ga0207695_10072417 | Ga0207695_100724172 | 329 |
| 265 | 3300025914 | Ga0207671_10073260 | Ga0207671_100732602 | 329 |
| 266 | 3300025914 | Ga0207671_10137920 | Ga0207671_101379202 | 329 |
| 267 | 3300025915 | Ga0207693_10011976 | Ga0207693_100119763 | 329 |
| 268 | 3300025916 | Ga0207663_10025887 | Ga0207663_100258872 | 329 |
| 269 | 3300025919 | Ga0207657_10045293 | Ga0207657_100452934 | 329 |
| 270 | 3300025921 | Ga0207652_10108381 | Ga0207652_101083811 | 329 |
| 271 | 3300025923 | Ga0207681_10111220 | Ga0207681_101112202 | 329 |
| 272 | 3300025924 | Ga0207694_10181841 | Ga0207694_101818412 | 329 |
| 273 | 3300025928 | Ga0207700_10213245 | Ga0207700_102132452 | 329 |
| 274 | 3300025929 | Ga0207664_10068142 | Ga0207664_100681422 | 329 |
| 275 | 3300025932 | Ga0207690_10039354 | Ga0207690_100393543 | 329 |
| 276 | 3300025933 | Ga0207706_10022060 | Ga0207706_100220602 | 329 |
| 277 | 3300025939 | Ga0207665_10015899 | Ga0207665_100158995 | 329 |
| 278 | 3300025940 | Ga0207691_10092757 | Ga0207691_100927572 | 329 |
| 279 | 3300025941 | Ga0207711_10051028 | Ga0207711_100510283 | 329 |
| 280 | 3300025944 | Ga0207661_10043270 | Ga0207661_100432703 | 329 |
| 281 | 3300025944 | Ga0207661_10063302 | Ga0207661_100633022 | 329 |
| 282 | 3300025949 | Ga0207667_10031905 | Ga0207667_100319052 | 329 |
| 283 | 3300025972 | Ga0207668_10009915 | Ga0207668_100099152 | 329 |
| 284 | 3300025972 | Ga0207668_10104521 | Ga0207668_101045212 | 329 |
| 285 | 3300026041 | Ga0207639_10206845 | Ga0207639_102068452 | 329 |
| 286 | 3300026067 | Ga0207678_10000350 | Ga0207678_1000035028 | 329 |
| 287 | 3300026067 | Ga0207678_10026232 | Ga0207678_100262324 | 329 |
| 288 | 3300026067 | Ga0207678_10047116 | Ga0207678_100471163 | 329 |
| 289 | 3300026067 | Ga0207678_10047386 | Ga0207678_100473862 | 329 |
| 290 | 3300026067 | Ga0207678_10050769 | Ga0207678_100507693 | 329 |
| 291 | 3300026118 | Ga0207675_100143059 | Ga0207675_1001430592 | 329 |
| 292 | 3300026118 | Ga0207675_100278048 | Ga0207675_1002780482 | 329 |
| 293 | 3300026121 | Ga0207683_10003385 | Ga0207683_1000338510 | 329 |
| 294 | 3300026121 | Ga0207683_10114405 | Ga0207683_101144052 | 329 |
| 295 | 3300026142 | Ga0207698_10028481 | Ga0207698_100284812 | 329 |
| 296 | 3300027512 | Ga0209179_1000277 | Ga0209179_10002775 | 329 |
| 297 | 3300027671 | Ga0209588_1008878 | Ga0209588_10088784 | 329 |
| 298 | 3300027866 | Ga0209813_10017050 | Ga0209813_100170502 | 329 |
| 299 | 3300028379 | Ga0268266_10001439 | Ga0268266_100014396 | 329 |
| 300 | 3300028379 | Ga0268266_10008469 | Ga0268266_100084693 | 329 |
| 301 | 3300028379 | Ga0268266_10010578 | Ga0268266_100105782 | 329 |
| 302 | 3300028380 | Ga0268265_10106089 | Ga0268265_101060892 | 329 |
| 303 | 3300028786 | Ga0307517_10000098 | Ga0307517_1000009887 | 329 |
| 304 | 3300028794 | Ga0307515_10052231 | Ga0307515_100522313 | 329 |
| 305 | 3300031250 | Ga0265331_10028985 | Ga0265331_100289851 | 329 |
| 306 | 3300031456 | Ga0307513_10061771 | Ga0307513_100617713 | 329 |
| 307 | 3300031456 | Ga0307513_10085474 | Ga0307513_100854742 | 329 |
| 308 | 3300031507 | Ga0307509_10064501 | Ga0307509_100645012 | 329 |
| 309 | 3300031507 | Ga0307509_10299862 | Ga0307509_102998622 | 329 |
| 310 | 3300031711 | Ga0265314_10032920 | Ga0265314_100329204 | 329 |
| 311 | 3300031911 | Ga0307412_10013585 | Ga0307412_100135852 | 329 |
| 312 | 3300033179 | Ga0307507_10008496 | Ga0307507_100084961 | 329 |
| 313 | 3300034957 | Ga0373938_0024743 | Ga0373938_0024743_21_1151 | 329 |
| 314 | 3300035170 | Ga0373943_0090859 | Ga0373943_0090859_130_1260 | 329 |
| 315 | 3300035691 | Ga0373931_0001367 | Ga0373931_0001367_1038_2213 | 329 |
| 316 | 3300037312 | Ga0395899_0000030 | Ga0395899_0000030_84559_85680 | 329 |
| 317 | 3300037418 | Ga0395900_0000023 | Ga0395900_0000023_90965_92086 | 329 |
| 318 | 3300037418 | Ga0395900_0214183 | Ga0395900_0214183_599_1723 | 329 |
| 319 | 3300037466 | Ga0395898_0000038 | Ga0395898_0000038_84559_85680 | 329 |
| 320 | 3300037466 | Ga0395898_0231982 | Ga0395898_0231982_620_1744 | 329 |
| 321 | 3300037471 | Ga0395905_0000021 | Ga0395905_0000021_84559_85680 | 329 |
| 322 | 3300038443 | Ga0395901_0000018 | Ga0395901_0000018_90965_92086 | 329 |
| 323 | 3300038443 | Ga0395901_0020495 | Ga0395901_0020495_2271_3395 | 329 |
| 324 | 3300038705 | Ga0237819_07090 | Ga0237819_07090_502_1620 | 329 |
| 325 | 3300039437 | Ga0436365_1623535 | Ga0436365_1623535_1000_2178 | 329 |
| 326 | 3300041452 | Ga0451793_0104272 | Ga0451793_0104272_523_1764 | 329 |
| 327 | 3300041509 | Ga0451843_1428360 | Ga0451843_1428360_266_1507 | 329 |
| 328 | 3300042013 | Ga0439456_000061 | Ga0439456_000061_30737_31888 | 329 |
| 329 | 3300045976 | Ga0466967_0013725 | Ga0466967_0013725_3687_4751 | 329 |
| 330 | 3300046455 | Ga0495603_0008610 | Ga0495603_0008610_3460_4590 | 329 |
| 331 | 3300046459 | Ga0495629_0033615 | Ga0495629_0033615_2071_3243 | 329 |
| 332 | 3300046460 | Ga0495638_0007762 | Ga0495638_0007762_11_1135 | 329 |
| 333 | 3300046471 | Ga0495650_0000009 | Ga0495650_0000009_644774_645964 | 329 |
| 334 | 3300046471 | Ga0495650_0003587 | Ga0495650_0003587_6272_7414 | 329 |
| 335 | 3300046512 | Ga0495610_0029570 | Ga0495610_0029570_1371_2501 | 329 |
| 336 | 3300046518 | Ga0495631_0076804 | Ga0495631_0076804_14_1144 | 329 |
| 337 | 3300046519 | Ga0495632_0032085 | Ga0495632_0032085_41_1171 | 329 |
| 338 | 3300046557 | Ga0495622_0070746 | Ga0495622_0070746_80_1210 | 329 |
| 339 | 3300046660 | Ga0495625_0001312 | Ga0495625_0001312_21295_22440 | 329 |
| 340 | 3300046660 | Ga0495625_0104136 | Ga0495625_0104136_83_1213 | 329 |
| 341 | 3300046664 | Ga0495659_0018054 | Ga0495659_0018054_348_1478 | 329 |
| 342 | 3300047320 | Ga0495672_0026387 | Ga0495672_0026387_570_1688 | 329 |
| 343 | 3300047320 | Ga0495672_0068685 | Ga0495672_0068685_360_1496 | 329 |
| 344 | 3300047469 | Ga0495673_0036699 | Ga0495673_0036699_902_2035 | 329 |
| 345 | 3300047472 | Ga0495686_0051322 | Ga0495686_0051322_1316_2440 | 329 |
| 346 | 3300047472 | Ga0495686_0055567 | Ga0495686_0055567_104_1231 | 329 |
| 347 | 3300048903 | Ga0496100_0042584 | Ga0496100_0042584_523_1653 | 329 |
| 348 | 3300048904 | Ga0496101_0093781 | Ga0496101_0093781_863_1993 | 329 |
| 349 | 3300048904 | Ga0496101_0104927 | Ga0496101_0104927_277_1452 | 329 |
| 350 | 3300048905 | Ga0496102_0112028 | Ga0496102_0112028_414_1544 | 329 |
| 351 | 3300048905 | Ga0496102_0291451 | Ga0496102_0291451_326_1501 | 329 |
| 352 | 3300048905 | Ga0496102_0494228 | Ga0496102_0494228_69_1109 | 329 |
| 353 | 3300048907 | Ga0496104_0008854 | Ga0496104_0008854_3020_4150 | 329 |
| 354 | 3300048907 | Ga0496104_0022051 | Ga0496104_0022051_4108_5268 | 329 |
| 355 | 3300048907 | Ga0496104_0027826 | Ga0496104_0027826_3187_4362 | 329 |
| 356 | 3300048907 | Ga0496104_0145144 | Ga0496104_0145144_316_1449 | 329 |
| 357 | 3300048908 | Ga0496105_0014982 | Ga0496105_0014982_3531_4706 | 329 |
| 358 | 3300048908 | Ga0496105_0029646 | Ga0496105_0029646_3290_4420 | 329 |
| 359 | 3300048908 | Ga0496105_0144040 | Ga0496105_0144040_442_1575 | 329 |
| 360 | 3300048909 | Ga0496106_0014503 | Ga0496106_0014503_2544_3674 | 329 |
| 361 | 3300048910 | Ga0496107_0005083 | Ga0496107_0005083_7405_8535 | 329 |
| 362 | 3300048910 | Ga0496107_0043881 | Ga0496107_0043881_1719_2849 | 329 |
| 363 | 3300048911 | Ga0496108_0012405 | Ga0496108_0012405_4796_5926 | 329 |
| 364 | 3300048911 | Ga0496108_0085153 | Ga0496108_0085153_1279_2412 | 329 |
| 365 | 3300048911 | Ga0496108_0195006 | Ga0496108_0195006_258_1433 | 329 |
| 366 | 3300048911 | Ga0496108_0211516 | Ga0496108_0211516_504_1634 | 329 |
| 367 | 3300048913 | Ga0496110_0006254 | Ga0496110_0006254_2423_3553 | 329 |
| 368 | 3300048913 | Ga0496110_0029624 | Ga0496110_0029624_1535_2710 | 329 |
| 369 | 3300048913 | Ga0496110_0169332 | Ga0496110_0169332_817_1947 | 329 |
| 370 | 3300048913 | Ga0496110_0405915 | Ga0496110_0405915_190_1230 | 329 |
| 371 | 3300048914 | Ga0496111_0021599 | Ga0496111_0021599_2149_3279 | 329 |
| 372 | 3300048914 | Ga0496111_0070617 | Ga0496111_0070617_498_1673 | 329 |
| 373 | 3300048915 | Ga0496112_0073963 | Ga0496112_0073963_2107_3267 | 329 |
| 374 | 3300048915 | Ga0496112_0100598 | Ga0496112_0100598_1519_2649 | 329 |
| 375 | 3300048915 | Ga0496112_0215931 | Ga0496112_0215931_137_1270 | 329 |
| 376 | 3300048916 | Ga0496113_0039249 | Ga0496113_0039249_604_1779 | 329 |
| 377 | 3300048917 | Ga0496114_0005433 | Ga0496114_0005433_1742_2872 | 329 |
| 378 | 3300048917 | Ga0496114_0072517 | Ga0496114_0072517_471_1646 | 329 |
| 379 | 3300048917 | Ga0496114_0137647 | Ga0496114_0137647_639_1769 | 329 |
| 380 | 3300048918 | Ga0496115_0000662 | Ga0496115_0000662_6040_7170 | 329 |
| 381 | 3300048919 | Ga0496116_0009986 | Ga0496116_0009986_3676_4800 | 329 |
| 382 | 3300048919 | Ga0496116_0049085 | Ga0496116_0049085_212_1372 | 329 |
| 383 | 3300048920 | Ga0496117_0043947 | Ga0496117_0043947_1609_2733 | 329 |
| 384 | 3300048920 | Ga0496117_0067982 | Ga0496117_0067982_38_1168 | 329 |
| 385 | 3300048920 | Ga0496117_0082914 | Ga0496117_0082914_903_2027 | 329 |
| 386 | 3300048921 | Ga0496118_0139097 | Ga0496118_0139097_275_1429 | 329 |
| 387 | 3300048922 | Ga0496119_0021633 | Ga0496119_0021633_1516_2646 | 329 |
| 388 | 3300048923 | Ga0496120_0087944 | Ga0496120_0087944_80_1243 | 329 |
| 389 | 3300048924 | Ga0496121_0000265 | Ga0496121_0000265_83103_84230 | 329 |
| 390 | 3300048924 | Ga0496121_0004306 | Ga0496121_0004306_7953_9083 | 329 |
| 391 | 3300048924 | Ga0496121_0007746 | Ga0496121_0007746_11016_12143 | 329 |
| 392 | 3300048924 | Ga0496121_0010192 | Ga0496121_0010192_8638_9762 | 329 |
| 393 | 3300048925 | Ga0496122_0003946 | Ga0496122_0003946_7962_9113 | 329 |
| 394 | 3300048926 | Ga0496123_0002697 | Ga0496123_0002697_9150_10301 | 329 |
| 395 | 3300048926 | Ga0496123_0063434 | Ga0496123_0063434_1051_2175 | 329 |
| 396 | 3300048927 | Ga0496124_0093856 | Ga0496124_0093856_272_1435 | 329 |
| 397 | 3300048927 | Ga0496124_0179137 | Ga0496124_0179137_354_1478 | 329 |
| 398 | 3300048927 | Ga0496124_0253182 | Ga0496124_0253182_106_1281 | 329 |
| 399 | 3300048928 | Ga0496125_0002054 | Ga0496125_0002054_6868_8031 | 329 |
| 400 | 3300048929 | Ga0496126_0009405 | Ga0496126_0009405_3858_4988 | 329 |
| 401 | 3300048929 | Ga0496126_0040565 | Ga0496126_0040565_263_1405 | 329 |
| 402 | 3300048929 | Ga0496126_0090963 | Ga0496126_0090963_462_1589 | 329 |
| 403 | 3300048929 | Ga0496126_0197635 | Ga0496126_0197635_284_1414 | 329 |
| 404 | 3300048929 | Ga0496126_0261445 | Ga0496126_0261445_14_1063 | 329 |
| 405 | 3300049568 | Ga0501031_0001626 | Ga0501031_0001626_983_2158 | 329 |
| 406 | 3300049568 | Ga0501031_0003394 | Ga0501031_0003394_6175_7257 | 329 |
| 407 | 3300049568 | Ga0501031_0033746 | Ga0501031_0033746_395_1531 | 329 |
| 408 | 3300049568 | Ga0501031_0078537 | Ga0501031_0078537_75_1244 | 329 |
| 409 | 3300049568 | Ga0501031_0158696 | Ga0501031_0158696_128_1303 | 329 |
| 410 | 3300049569 | Ga0501032_0000005 | Ga0501032_0000005_149807_150955 | 329 |
| 411 | 3300049569 | Ga0501032_0004418 | Ga0501032_0004418_2002_3084 | 329 |
| 412 | 3300049569 | Ga0501032_0009241 | Ga0501032_0009241_4483_5652 | 329 |
| 413 | 3300049569 | Ga0501032_0025530 | Ga0501032_0025530_639_1814 | 329 |
| 414 | 3300049570 | Ga0501033_0001174 | Ga0501033_0001174_11403_12578 | 329 |
| 415 | 3300049570 | Ga0501033_0001918 | Ga0501033_0001918_7777_8898 | 329 |
| 416 | 3300049570 | Ga0501033_0006909 | Ga0501033_0006909_704_1786 | 329 |
| 417 | 3300049570 | Ga0501033_0007700 | Ga0501033_0007700_5336_6412 | 329 |
| 418 | 3300049570 | Ga0501033_0011510 | Ga0501033_0011510_3569_4702 | 329 |
| 419 | 3300049570 | Ga0501033_0014091 | Ga0501033_0014091_4004_5173 | 329 |
| 420 | 3300049570 | Ga0501033_0103944 | Ga0501033_0103944_205_1275 | 329 |
| 421 | 3300049570 | Ga0501033_0159196 | Ga0501033_0159196_186_1361 | 329 |
| 422 | 3300049571 | Ga0501034_0000027 | Ga0501034_0000027_111971_113119 | 329 |
| 423 | 3300049571 | Ga0501034_0043172 | Ga0501034_0043172_2801_3871 | 329 |
| 424 | 3300049571 | Ga0501034_0048394 | Ga0501034_0048394_310_1458 | 329 |
| 425 | 3300049571 | Ga0501034_0069581 | Ga0501034_0069581_1530_2666 | 329 |
| 426 | 3300049571 | Ga0501034_0069856 | Ga0501034_0069856_2302_3477 | 329 |
| 427 | 3300049571 | Ga0501034_0094596 | Ga0501034_0094596_29_1018 | 329 |
| 428 | 3300049571 | Ga0501034_0178099 | Ga0501034_0178099_580_1662 | 329 |
| 429 | 3300049571 | Ga0501034_0218387 | Ga0501034_0218387_190_1275 | 329 |
| 430 | 3300049571 | Ga0501034_0317015 | Ga0501034_0317015_346_1422 | 329 |
| 431 | 3300049572 | Ga0501036_0003212 | Ga0501036_0003212_8086_9168 | 329 |
| 432 | 3300049572 | Ga0501036_0003777 | Ga0501036_0003777_6483_7568 | 329 |
| 433 | 3300049572 | Ga0501036_0014934 | Ga0501036_0014934_493_1620 | 329 |
| 434 | 3300049572 | Ga0501036_0038227 | Ga0501036_0038227_2486_3655 | 329 |
| 435 | 3300049572 | Ga0501036_0111337 | Ga0501036_0111337_314_1450 | 329 |
| 436 | 3300049573 | Ga0501037_0000125 | Ga0501037_0000125_19060_20208 | 329 |
| 437 | 3300049573 | Ga0501037_0001255 | Ga0501037_0001255_16187_17362 | 329 |
| 438 | 3300049573 | Ga0501037_0003998 | Ga0501037_0003998_1062_2144 | 329 |
| 439 | 3300049573 | Ga0501037_0024632 | Ga0501037_0024632_808_1983 | 329 |
| 440 | 3300049573 | Ga0501037_0027629 | Ga0501037_0027629_2265_3401 | 329 |
| 441 | 3300049573 | Ga0501037_0031308 | Ga0501037_0031308_538_1707 | 329 |
| 442 | 3300049574 | Ga0501038_0000053 | Ga0501038_0000053_52142_53290 | 329 |
| 443 | 3300049574 | Ga0501038_0001348 | Ga0501038_0001348_13458_14579 | 329 |
| 444 | 3300049574 | Ga0501038_0002739 | Ga0501038_0002739_7814_8896 | 329 |
| 445 | 3300049574 | Ga0501038_0009152 | Ga0501038_0009152_2257_3489 | 329 |
| 446 | 3300049574 | Ga0501038_0010268 | Ga0501038_0010268_294_1469 | 329 |
| 447 | 3300049574 | Ga0501038_0010552 | Ga0501038_0010552_1260_2435 | 329 |
| 448 | 3300049574 | Ga0501038_0021002 | Ga0501038_0021002_4722_5807 | 329 |
| 449 | 3300049574 | Ga0501038_0025672 | Ga0501038_0025672_1266_2336 | 329 |
| 450 | 3300049574 | Ga0501038_0034203 | Ga0501038_0034203_222_1349 | 329 |
| 451 | 3300049574 | Ga0501038_0037038 | Ga0501038_0037038_900_2069 | 329 |
| 452 | 3300049574 | Ga0501038_0084110 | Ga0501038_0084110_668_1804 | 329 |
| 453 | 3300049574 | Ga0501038_0275214 | Ga0501038_0275214_52_1185 | 329 |
| 454 | 3300049575 | Ga0501039_0001416 | Ga0501039_0001416_6962_8083 | 329 |
| 455 | 3300049575 | Ga0501039_0001417 | Ga0501039_0001417_9576_10751 | 329 |
| 456 | 3300049575 | Ga0501039_0070553 | Ga0501039_0070553_277_1452 | 329 |
| 457 | 3300049575 | Ga0501039_0082655 | Ga0501039_0082655_978_2210 | 329 |
| 458 | 3300049575 | Ga0501039_0105324 | Ga0501039_0105324_361_1497 | 329 |
| 459 | 3300049575 | Ga0501039_0174663 | Ga0501039_0174663_250_1425 | 329 |
| 460 | 3300049575 | Ga0501039_0194065 | Ga0501039_0194065_407_1576 | 329 |
| 461 | 3300049578 | Ga0501042_0006938 | Ga0501042_0006938_4991_6160 | 329 |
| 462 | 3300049578 | Ga0501042_0015677 | Ga0501042_0015677_1324_2445 | 329 |
| 463 | 3300049578 | Ga0501042_0021926 | Ga0501042_0021926_2134_3216 | 329 |
| 464 | 3300049578 | Ga0501042_0091435 | Ga0501042_0091435_79_1164 | 329 |
| 465 | 3300049579 | Ga0501043_0000011 | Ga0501043_0000011_147464_148612 | 329 |
| 466 | 3300049579 | Ga0501043_0003502 | Ga0501043_0003502_10659_11834 | 329 |
| 467 | 3300049579 | Ga0501043_0003989 | Ga0501043_0003989_4864_5985 | 329 |
| 468 | 3300049579 | Ga0501043_0007977 | Ga0501043_0007977_2936_4168 | 329 |
| 469 | 3300049579 | Ga0501043_0010777 | Ga0501043_0010777_966_2048 | 329 |
| 470 | 3300049579 | Ga0501043_0023994 | Ga0501043_0023994_942_2027 | 329 |
| 471 | 3300049579 | Ga0501043_0041137 | Ga0501043_0041137_1403_2539 | 329 |
| 472 | 3300049579 | Ga0501043_0044293 | Ga0501043_0044293_57_1226 | 329 |
| 473 | 3300049579 | Ga0501043_0052745 | Ga0501043_0052745_618_1745 | 329 |
| 474 | 3300049580 | Ga0501046_0004167 | Ga0501046_0004167_4297_5418 | 329 |
| 475 | 3300049580 | Ga0501046_0010460 | Ga0501046_0010460_1531_2667 | 329 |
| 476 | 3300049580 | Ga0501046_0021539 | Ga0501046_0021539_995_2170 | 329 |
| 477 | 3300049580 | Ga0501046_0024230 | Ga0501046_0024230_2821_3903 | 329 |
| 478 | 3300049580 | Ga0501046_0038705 | Ga0501046_0038705_1144_2220 | 329 |
| 479 | 3300049580 | Ga0501046_0042039 | Ga0501046_0042039_2271_3392 | 329 |
| 480 | 3300049580 | Ga0501046_0132664 | Ga0501046_0132664_185_1354 | 329 |
| 481 | 3300049580 | Ga0501046_0221858 | Ga0501046_0221858_162_1232 | 329 |
| 482 | 3300049581 | Ga0501047_0004223 | Ga0501047_0004223_9759_10829 | 329 |
| 483 | 3300049581 | Ga0501047_0009350 | Ga0501047_0009350_203_1285 | 329 |
| 484 | 3300049581 | Ga0501047_0026424 | Ga0501047_0026424_3509_4678 | 329 |
| 485 | 3300049581 | Ga0501047_0036757 | Ga0501047_0036757_194_1321 | 329 |
| 486 | 3300049581 | Ga0501047_0084287 | Ga0501047_0084287_1658_2794 | 329 |
| 487 | 3300049581 | Ga0501047_0301651 | Ga0501047_0301651_194_1318 | 329 |
| 488 | 3300049582 | Ga0501048_0002011 | Ga0501048_0002011_4218_5354 | 329 |
| 489 | 3300049582 | Ga0501048_0005098 | Ga0501048_0005098_594_1715 | 329 |
| 490 | 3300049582 | Ga0501048_0010180 | Ga0501048_0010180_3443_4612 | 329 |
| 491 | 3300049582 | Ga0501048_0011775 | Ga0501048_0011775_3751_4833 | 329 |
| 492 | 3300049582 | Ga0501048_0029682 | Ga0501048_0029682_999_2084 | 329 |
| 493 | 3300049582 | Ga0501048_0031071 | Ga0501048_0031071_2169_3239 | 329 |
| 494 | 3300049583 | Ga0501067_0004621 | Ga0501067_0004621_1069_2238 | 329 |
| 495 | 3300049583 | Ga0501067_0008285 | Ga0501067_0008285_3940_5022 | 329 |
| 496 | 3300049583 | Ga0501067_0025467 | Ga0501067_0025467_549_1634 | 329 |
| 497 | 3300049583 | Ga0501067_0062471 | Ga0501067_0062471_666_1802 | 329 |
| 498 | 3300049584 | Ga0501068_0002752 | Ga0501068_0002752_7815_8936 | 329 |
| 499 | 3300049584 | Ga0501068_0016002 | Ga0501068_0016002_1367_2452 | 329 |
| 500 | 3300049584 | Ga0501068_0016689 | Ga0501068_0016689_1849_2931 | 329 |
| 501 | 3300049584 | Ga0501068_0020455 | Ga0501068_0020455_2590_3759 | 329 |
| 502 | 3300049585 | Ga0501069_0001078 | Ga0501069_0001078_1704_2840 | 329 |
| 503 | 3300049585 | Ga0501069_0002656 | Ga0501069_0002656_6013_7095 | 329 |
| 504 | 3300049585 | Ga0501069_0006483 | Ga0501069_0006483_2662_3831 | 329 |
| 505 | 3300049586 | Ga0501070_0008169 | Ga0501070_0008169_63_1121 | 329 |
| 506 | 3300049586 | Ga0501070_0015441 | Ga0501070_0015441_2887_3972 | 329 |
| 507 | 3300049586 | Ga0501070_0074318 | Ga0501070_0074318_527_1696 | 329 |
| 508 | 3300049586 | Ga0501070_0227273 | Ga0501070_0227273_137_1273 | 329 |
| 509 | 3300049587 | Ga0501071_0014348 | Ga0501071_0014348_1202_2287 | 329 |
| 510 | 3300049587 | Ga0501071_0086994 | Ga0501071_0086994_126_1262 | 329 |
| 511 | 3300049589 | Ga0501073_0003878 | Ga0501073_0003878_8106_9188 | 329 |
| 512 | 3300049589 | Ga0501073_0019733 | Ga0501073_0019733_407_1576 | 329 |
| 513 | 3300049589 | Ga0501073_0019784 | Ga0501073_0019784_2747_3832 | 329 |
| 514 | 3300049589 | Ga0501073_0048125 | Ga0501073_0048125_346_1467 | 329 |
| 515 | 3300049589 | Ga0501073_0109947 | Ga0501073_0109947_640_1764 | 329 |
| 516 | 3300049590 | Ga0501074_0004446 | Ga0501074_0004446_8606_9724 | 329 |
| 517 | 3300049590 | Ga0501074_0005779 | Ga0501074_0005779_1911_3080 | 329 |
| 518 | 3300049590 | Ga0501074_0008800 | Ga0501074_0008800_865_2001 | 329 |
| 519 | 3300049590 | Ga0501074_0028821 | Ga0501074_0028821_705_1826 | 329 |
| 520 | 3300049592 | Ga0501076_0042168 | Ga0501076_0042168_1585_2754 | 329 |
| 521 | 3300049741 | Ga0501079_0089088 | Ga0501079_0089088_1096_2178 | 329 |
| 522 | 3300049741 | Ga0501079_0199788 | Ga0501079_0199788_280_1416 | 329 |
| 523 | 3300049742 | Ga0501080_0001694 | Ga0501080_0001694_7810_8928 | 329 |
| 524 | 3300049742 | Ga0501080_0005649 | Ga0501080_0005649_4190_5317 | 329 |
| 525 | 3300049742 | Ga0501080_0008204 | Ga0501080_0008204_6729_7850 | 329 |
| 526 | 3300049742 | Ga0501080_0015542 | Ga0501080_0015542_5038_6174 | 329 |
| 527 | 3300049742 | Ga0501080_0020346 | Ga0501080_0020346_1491_2576 | 329 |
| 528 | 3300049742 | Ga0501080_0030751 | Ga0501080_0030751_3183_4265 | 329 |
| 529 | 3300049742 | Ga0501080_0048187 | Ga0501080_0048187_535_1704 | 329 |
| 530 | 3300049742 | Ga0501080_0090332 | Ga0501080_0090332_416_1492 | 329 |
| 531 | 3300049742 | Ga0501080_0213891 | Ga0501080_0213891_342_1481 | 329 |
| 532 | 3300049744 | Ga0501083_0057951 | Ga0501083_0057951_257_1426 | 329 |
| 533 | 3300049744 | Ga0501083_0108254 | Ga0501083_0108254_404_1489 | 329 |
| 534 | 3300049822 | Ga0501035_0000589 | Ga0501035_0000589_33805_34923 | 329 |
| 535 | 3300049822 | Ga0501035_0000755 | Ga0501035_0000755_7559_8644 | 329 |
| 536 | 3300049822 | Ga0501035_0001704 | Ga0501035_0001704_14473_15648 | 329 |
| 537 | 3300049822 | Ga0501035_0004158 | Ga0501035_0004158_8180_9262 | 329 |
| 538 | 3300049822 | Ga0501035_0022979 | Ga0501035_0022979_3907_5028 | 329 |
| 539 | 3300049822 | Ga0501035_0039124 | Ga0501035_0039124_1319_2488 | 329 |
| 540 | 3300049822 | Ga0501035_0045961 | Ga0501035_0045961_446_1516 | 329 |
| 541 | 3300049822 | Ga0501035_0046601 | Ga0501035_0046601_1332_2453 | 329 |
| 542 | 3300049822 | Ga0501035_0071855 | Ga0501035_0071855_1565_2740 | 329 |
| 543 | 3300049822 | Ga0501035_0099665 | Ga0501035_0099665_28_1017 | 329 |
| 544 | 3300049822 | Ga0501035_0105297 | Ga0501035_0105297_136_1311 | 329 |
| 545 | 3300049822 | Ga0501035_0159802 | Ga0501035_0159802_234_1355 | 329 |
| 546 | 3300049822 | Ga0501035_0217812 | Ga0501035_0217812_487_1614 | 329 |
| 547 | 3300049823 | Ga0501044_0013659 | Ga0501044_0013659_545_1681 | 329 |
| 548 | 3300049823 | Ga0501044_0026369 | Ga0501044_0026369_557_1627 | 329 |
| 549 | 3300049823 | Ga0501044_0056105 | Ga0501044_0056105_1761_2993 | 329 |
| 550 | 3300049823 | Ga0501044_0060429 | Ga0501044_0060429_907_2076 | 329 |
| 551 | 3300049823 | Ga0501044_0081195 | Ga0501044_0081195_1479_2615 | 329 |
| 552 | 3300049823 | Ga0501044_0161190 | Ga0501044_0161190_708_1790 | 329 |
| 553 | 3300049823 | Ga0501044_0176342 | Ga0501044_0176342_113_1246 | 329 |
| 554 | 3300049823 | Ga0501044_0211891 | Ga0501044_0211891_649_1770 | 329 |
| 555 | 3300049823 | Ga0501044_0237105 | Ga0501044_0237105_71_1156 | 329 |
| 556 | 3300049823 | Ga0501044_0365042 | Ga0501044_0365042_103_1221 | 329 |
| 557 | 3300049824 | Ga0501045_0005507 | Ga0501045_0005507_5221_6342 | 329 |
| 558 | 3300049824 | Ga0501045_0014258 | Ga0501045_0014258_2597_3766 | 329 |
| 559 | 3300049824 | Ga0501045_0085901 | Ga0501045_0085901_272_1354 | 329 |
| 560 | 3300050490 | nmdc:mga03n38_59697_c1 | nmdc:mga03n38_59697_c1_194_1366 | 329 |
| 561 | 3300050491 | nmdc:mga00v17_78829_c1 | nmdc:mga00v17_78829_c1_482_1654 | 329 |
| 562 | 3300050492 | nmdc:mga0yw44_72617_c1 | nmdc:mga0yw44_72617_c1_819_1943 | 329 |
| 563 | 3300050495 | nmdc:mga04h51_5197_c1 | nmdc:mga04h51_5197_c1_515_1687 | 329 |
| 564 | 3300050496 | nmdc:mga07m45_7313_c1 | nmdc:mga07m45_7313_c1_1896_3068 | 329 |
| 565 | 3300050507 | nmdc:mga05p37_395962_c1 | nmdc:mga05p37_395962_c1_101_1231 | 329 |
| 566 | 3300050510 | nmdc:mga06r32_188771_c1 | nmdc:mga06r32_188771_c1_46_1182 | 329 |
| 567 | 3300053088 | Ga0500644_0000325 | Ga0500644_0000325_1678_2802 | 329 |
| 568 | 3300053088 | Ga0500644_0023547 | Ga0500644_0023547_490_1647 | 329 |
| 569 | 3300053093 | Ga0500651_0001377 | Ga0500651_0001377_9897_11027 | 329 |
| 570 | 3300053093 | Ga0500651_0003048 | Ga0500651_0003048_687_1811 | 329 |
| 571 | 3300053094 | Ga0500566_0003537 | Ga0500566_0003537_1314_2501 | 329 |
| 572 | 3300053096 | Ga0500641_0005170 | Ga0500641_0005170_615_1778 | 329 |
| 573 | 3300053096 | Ga0500641_0022724 | Ga0500641_0022724_649_1779 | 329 |
| 574 | 3300053098 | Ga0500650_0011126 | Ga0500650_0011126_457_1620 | 329 |
| 575 | 3300053104 | Ga0500556_0000017 | Ga0500556_0000017_95182_96342 | 329 |
| 576 | 3300053104 | Ga0500556_0000195 | Ga0500556_0000195_34584_35741 | 329 |
| 577 | 3300053116 | Ga0500592_000349 | Ga0500592_000349_5475_6632 | 329 |
| 578 | 3300053117 | Ga0500593_000006 | Ga0500593_000006_73939_75078 | 329 |
| 579 | 3300053119 | Ga0500595_000001 | Ga0500595_000001_241403_242533 | 329 |
| 580 | 3300053119 | Ga0500595_002917 | Ga0500595_002917_908_2035 | 329 |
| 581 | 3300053119 | Ga0500595_002948 | Ga0500595_002948_3525_4655 | 329 |
| 582 | 3300053119 | Ga0500595_006998 | Ga0500595_006998_1291_2421 | 329 |
| 583 | 3300053121 | Ga0500607_088437 | Ga0500607_088437_139_1263 | 329 |
| 584 | 3300053122 | Ga0500608_012354 | Ga0500608_012354_2558_3682 | 329 |
| 585 | 3300053130 | Ga0500642_0000012 | Ga0500642_0000012_34590_35714 | 329 |
| 586 | 3300053131 | Ga0500652_000146 | Ga0500652_000146_10737_11894 | 329 |
| 587 | 3300053131 | Ga0500652_012191 | Ga0500652_012191_381_1511 | 329 |
| 588 | 3300053134 | Ga0500658_0006611 | Ga0500658_0006611_1056_2180 | 329 |
| 589 | 3300053134 | Ga0500658_0015652 | Ga0500658_0015652_1156_2286 | 329 |
| 590 | 3300053136 | Ga0500559_0000848 | Ga0500559_0000848_6056_7243 | 329 |
| 591 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_385962_387101 | 329 |
| 592 | 3300053139 | Ga0500568_0010600 | Ga0500568_0010600_570_1697 | 329 |
| 593 | 3300053139 | Ga0500568_0011318 | Ga0500568_0011318_814_1938 | 329 |
| 594 | 3300053142 | Ga0500577_0006426 | Ga0500577_0006426_480_1607 | 329 |
| 595 | 3300053145 | Ga0500586_002295 | Ga0500586_002295_1698_2822 | 329 |
| 596 | 3300053151 | Ga0500604_0023785 | Ga0500604_0023785_92_1216 | 329 |
| 597 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_1736140_1737270 | 329 |
| 598 | 3300053153 | Ga0500616_0001093 | Ga0500616_0001093_22764_23888 | 329 |
| 599 | 3300053153 | Ga0500616_0023146 | Ga0500616_0023146_366_1535 | 329 |
| 600 | 3300053156 | Ga0500622_0001963 | Ga0500622_0001963_10475_11599 | 329 |
| 601 | 3300053156 | Ga0500622_0031719 | Ga0500622_0031719_494_1624 | 329 |
| 602 | 3300053158 | Ga0500627_0038807 | Ga0500627_0038807_275_1432 | 329 |
| 603 | 3300053161 | Ga0500634_0000014 | Ga0500634_0000014_56668_57759 | 329 |
| 604 | 3300053177 | Ga0500636_0000495 | Ga0500636_0000495_5861_6985 | 329 |
| 605 | 3300053730 | Ga0500645_000629 | Ga0500645_000629_18323_19453 | 329 |
| 606 | 3300053730 | Ga0500645_024648 | Ga0500645_024648_544_1719 | 329 |
| 607 | 3300054114 | Ga0501084_0009969 | Ga0501084_0009969_4777_5946 | 329 |
| 608 | 3300054114 | Ga0501084_0024592 | Ga0501084_0024592_1861_2943 | 329 |
| 609 | 3300060353 | Ga0501082_0013202 | Ga0501082_0013202_47_1129 | 329 |
| 610 | iso_pu_bacteria | 2513237094 | 2513644736 | 329 |
| 611 | iso_pu_bacteria | 2513237098 | 2513673275 | 329 |
| 612 | iso_pu_bacteria | 2513237141 | 2513894800 | 329 |
| 613 | iso_pu_bacteria | 2515154155 | 2515851185 | 329 |
| 614 | iso_pu_bacteria | 2524023205 | 2524442354 | 329 |
| 615 | iso_pu_bacteria | 2582580736 | 2583150517 | 329 |
| 616 | iso_pu_bacteria | 2585427649 | 2586062218 | 329 |
| 617 | iso_pu_bacteria | 2602042107 | 2603857449 | 329 |
| 618 | iso_pu_bacteria | 2643221629 | 2644168401 | 329 |
| 619 | iso_pu_bacteria | 2643221651 | 2644291216 | 329 |
| 620 | iso_pu_bacteria | 2643221662 | 2644349935 | 329 |
| 621 | iso_pu_bacteria | 2643221733 | 2644732373 | 329 |
| 622 | iso_pu_bacteria | 2643221736 | 2644743164 | 329 |
| 623 | iso_pu_bacteria | 2675903058 | 2676478951 | 329 |
| 624 | iso_pu_bacteria | 2721755755 | 2723848813 | 329 |
| 625 | iso_pu_bacteria | 2728368998 | 2728749778 | 329 |
| 626 | iso_pu_bacteria | 2744054633 | 2745075199 | 329 |
| 627 | iso_pu_bacteria | 2773857925 | 2774870097 | 329 |
| 628 | iso_pu_bacteria | 2775506902 | 2776273016 | 329 |
| 629 | iso_pu_bacteria | 2775506904 | 2776282141 | 329 |
| 630 | iso_pu_bacteria | 2775506925 | 2776373507 | 329 |
| 631 | iso_pu_bacteria | 2808606522 | 2809588609 | 329 |
| 632 | iso_pu_bacteria | 2816332119 | 2816427435 | 329 |
| 633 | iso_pu_bacteria | 2816332139 | 2816509740 | 329 |
| 634 | iso_pu_bacteria | 2818991467 | 2819717505 | 329 |
| 635 | iso_pu_bacteria | 2821443989 | 2821446770 | 329 |
| 636 | iso_pu_bacteria | 2827628540 | 2827630266 | 329 |
| 637 | iso_pu_bacteria | 2841760612 | 2841762969 | 329 |
| 638 | iso_pu_bacteria | 2842775625 | 2842775717 | 329 |
| 639 | iso_pu_bacteria | 2844104063 | 2844109161 | 329 |
| 640 | iso_pu_bacteria | 2844533157 | 2844536162 | 329 |
| 641 | iso_pu_bacteria | 2851246043 | 2851251268 | 329 |
| 642 | iso_pu_bacteria | 2857524615 | 2857526829 | 329 |
| 643 | iso_pu_bacteria | 2863067949 | 2863068689 | 329 |
| 644 | iso_pu_bacteria | 2866552031 | 2866554601 | 329 |
| 645 | iso_pu_bacteria | 2866612099 | 2866614607 | 329 |
| 646 | iso_pu_bacteria | 2874604998 | 2874606064 | 329 |
| 647 | iso_pu_bacteria | 2876761206 | 2876768065 | 329 |
| 648 | iso_pu_bacteria | 2876808645 | 2876809134 | 329 |
| 649 | iso_pu_bacteria | 2879083081 | 2879090442 | 329 |
| 650 | iso_pu_bacteria | 2879099564 | 2879108117 | 329 |
| 651 | iso_pu_bacteria | 2879110137 | 2879116773 | 329 |
| 652 | iso_pu_bacteria | 2882456835 | 2882461683 | 329 |
| 653 | iso_pu_bacteria | 2885374607 | 2885374636 | 329 |
| 654 | iso_pu_bacteria | 2885383462 | 2885386759 | 329 |
| 655 | iso_pu_bacteria | 2891326441 | 2891329038 | 329 |
| 656 | iso_pu_bacteria | 2893066018 | 2893069992 | 329 |
| 657 | iso_pu_bacteria | 2899359706 | 2899368211 | 329 |
| 658 | iso_pu_bacteria | 2903768456 | 2903775843 | 329 |
| 659 | iso_pu_bacteria | 2906610324 | 2906612496 | 329 |
| 660 | iso_pu_bacteria | 2915768154 | 2915775314 | 329 |
| 661 | iso_pu_bacteria | 2917736166 | 2917739425 | 329 |
| 662 | iso_pu_bacteria | 2919073203 | 2919077954 | 329 |
| 663 | iso_pu_bacteria | 2922361189 | 2922363447 | 329 |
| 664 | iso_pu_bacteria | 2922368715 | 2922375084 | 329 |
| 665 | iso_pu_bacteria | 2922386360 | 2922389563 | 329 |
| 666 | iso_pu_bacteria | 2932401849 | 2932404374 | 329 |
| 667 | iso_pu_bacteria | 2932784394 | 2932787558 | 329 |
| 668 | iso_pu_bacteria | 2932809354 | 2932813261 | 329 |
| 669 | iso_pu_bacteria | 2932818245 | 2932820819 | 329 |
| 670 | iso_pu_bacteria | 2932828146 | 2932834809 | 329 |
| 671 | iso_pu_bacteria | 2935616580 | 2935621774 | 329 |
| 672 | iso_pu_bacteria | 2935638405 | 2935642718 | 329 |
| 673 | iso_pu_bacteria | 2935665750 | 2935667820 | 329 |
| 674 | iso_pu_bacteria | 2935675223 | 2935682311 | 329 |
| 675 | iso_pu_bacteria | 2935694250 | 2935695922 | 329 |
| 676 | iso_pu_bacteria | 2935703347 | 2935706660 | 329 |
| 677 | iso_pu_bacteria | 2935760218 | 2935763215 | 329 |
| 678 | iso_pu_bacteria | 2935801545 | 2935806364 | 329 |
| 679 | iso_pu_bacteria | 2935810662 | 2935812965 | 329 |
| 680 | iso_pu_bacteria | 2935827899 | 2935830617 | 329 |
| 681 | iso_pu_bacteria | 2935837841 | 2935840646 | 329 |
| 682 | iso_pu_bacteria | 2935855204 | 2935860021 | 329 |
| 683 | iso_pu_bacteria | 2935864058 | 2935869344 | 329 |
| 684 | iso_pu_bacteria | 2935873716 | 2935880495 | 329 |
| 685 | iso_pu_bacteria | 2935992306 | 2935999543 | 329 |
| 686 | iso_pu_bacteria | 2936002035 | 2936006473 | 329 |
| 687 | iso_pu_bacteria | 2936037263 | 2936041553 | 329 |
| 688 | iso_pu_bacteria | 2939669807 | 2939674096 | 329 |
| 689 | iso_pu_bacteria | 2941538514 | 2941541224 | 329 |
| 690 | iso_pu_bacteria | 3002141150 | 3002145399 | 329 |
| 691 | iso_pu_bacteria | 8001845381 | 8001848370 | 329 |
| 692 | iso_pu_bacteria | 8002285264 | 8002291026 | 329 |
| 693 | iso_pu_bacteria | 8003314358 | 8003323805 | 329 |
| 694 | iso_pu_bacteria | 8006933436 | 8006941067 | 329 |
| 695 | iso_pu_bacteria | 8006964411 | 8006970048 | 329 |
| 696 | iso_pu_bacteria | 8006973647 | 8006980719 | 329 |
| 697 | iso_pu_bacteria | 8006984368 | 8006986261 | 329 |
| 698 | iso_pu_bacteria | 8006994254 | 8006998937 | 329 |
| 699 | iso_pu_bacteria | 8016511872 | 8016514006 | 329 |
| 700 | iso_pu_bacteria | 8017057580 | 8017062402 | 329 |
| 701 | iso_pu_bacteria | 8019576017 | 8019581863 | 329 |
| 702 | iso_pu_bacteria | 8019586578 | 8019589540 | 329 |
| 703 | iso_pu_bacteria | 8019597564 | 8019601726 | 329 |
| 704 | iso_pu_bacteria | 8019608314 | 8019616825 | 329 |
| 705 | iso_pu_bacteria | 8054563764 | 8054564015 | 329 |
| 706 | iso_pu_bacteria | 8056060235 | 8056064722 | 329 |
| 707 | iso_pu_bacteria | 8056207758 | 8056213631 | 329 |
| 708 | iso_pu_bacteria | 8056673599 | 8056675398 | 329 |
| 709 | iso_pu_bacteria | 8056681323 | 8056681756 | 329 |
| 710 | iso_pu_bacteria | 8057160832 | 8057162792 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ani-assembly1.cif.gz_A-2 | crystal structure of the f127y mutant of ribonucleotide reductase r2 from chlamydia trachomatis | 0.8771 | 3 | 299 |
| 8dq4-assembly1.cif.gz_B | x-ray crystal structure of flavobacterium johnsoniae dimanganese(ii) class id ribonucleotide reductase beta subunit k71r variant | 0.8726 | 22 | 283 |
| 4d8g-assembly2.cif.gz_D | chlamydia trachomatis nrdb with a mn/fe cofactor (procedure 2 - low mn) | 0.8712 | 3 | 307 |
| 2rcc-assembly1.cif.gz_B | crystal structure of putative class i ribonucleotide reductase (np_241368.1) from bacillus halodurans at 1.90 a resolution | 0.8677 | 17 | 298 |
| 7aik-assembly1.cif.gz_A | ribonucleotide reductase r2 protein from aquifex aeolicus | 0.8666 | 15 | 298 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4d8gD00 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A | 0.8712 | 3 | 307 | 1.10.620.20 |
| 2rccC01 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A | 0.8607 | 18 | 284 | 1.10.620.20 |
| 2rccC01 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A | 0.8542 | 18 | 284 | 1.10.620.20 |
| 3hf1A00 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A | 0.8376 | 20 | 296 | 1.10.620.20 |
| 2vuxB00 | Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A | 0.8233 | 11 | 299 | 1.10.620.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2B4ME11-F1-model_v4 | deleted | 0.9903 | 159 | 264 |
|
| AF-A0A3M4FNA3-F1-model_v4 | deleted | 0.974 | 126 | 281 |
|
| AF-A0A2B4ME11-F1-model_v4 | deleted | 0.9632 | 159 | 264 |
|
| AF-F8XWD2-F1-model_v4 | deleted | 0.9622 | 36 | 307 |
|
| AF-A0A3M4FNA3-F1-model_v4 | deleted | 0.956 | 126 | 281 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar