F476703

General Info

Members Datasets Scaffolds Average Seq Length
710 387 596 367

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10146480|Ga0157370_101464801
Length 394
Sequence MIPPAKHANNDCDRGEDEMLDWSEAVIDNSSDLVLTPPPIREDSDATDLGKIARGAARVRVDDKAMINCRADVNQLLPLKYRWAWEKYLSGCSNHWMPTEISMQADIALWKSPDGVTTDERRAIKRNLGFFASSESLVANNIVLAIYRHLTNPECRQYLLRQAFEEAVHTHTFQYIVESLGLDEGELFNMYREVPSITEKAAWAIQYTQNLSDPSFVTGSSAADRAFLRDLIAFYVVFEGMWFYTGFAQILSLGRRNKMVGIAEQYQYILRDESIHLNFGIDVINQIKIENPHLWSEPFQQEVRGMLQNAAELEAAYGRDTMPNGFLGLSAGLCEQYMHFIANRRCSQLGLEAVFPPTDNPFPWMSEAMDLKKEKNFFETRVIEYQNGGSLTWE

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
4 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
5 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
6 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
7 2582580736 Prauserella sp. Am3 Isolate Unclassified
8 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
9 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
10 2643221629 Devosia sp. Root105 Isolate Unclassified
11 2643221651 Afipia sp. Root123D2 Isolate Unclassified
12 2643221662 Devosia sp. Root413D1 Isolate Unclassified
13 2643221733 Bosea sp. Root381 Isolate Unclassified
14 2643221736 Bosea sp. Root483D1 Isolate Unclassified
15 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
16 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
17 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
18 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
19 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
20 2773857925 Microvirga vignae BR3299 Isolate Unclassified
21 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
22 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
23 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
24 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
25 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
26 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
27 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
28 2818991467 Bosea vestrisii 3192 Isolate Unclassified
29 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
30 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
31 2841760612 Bosea sp. Tri-49 Isolate Nodule
32 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
33 2844104063 Bosea sp. Tri-39 Isolate Nodule
34 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
35 2851246043 Bosea sp. Tri-54 Isolate Nodule
36 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
37 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
38 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
39 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
40 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
41 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
42 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
43 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
44 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
45 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
46 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
47 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
48 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
49 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
50 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
51 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
52 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
53 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
54 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
55 2906610324
56 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
57 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
58 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
59 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
60 2922368715
61 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
62 2932401849 Devosia sp. 2618 Isolate Rhizosphere
63 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
64 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
65 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
66 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
67 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
68 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
69 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
70 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
71 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
72 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
73 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
74 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
75 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
76 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
77 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
78 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
79 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
80 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
81 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
82 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
83 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
84 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
85 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
86 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
87 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
88 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
89 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
90 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
91 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
92 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
93 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
94 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
95 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
96 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
97 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
98 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
99 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
100 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
101 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
102 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
103 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
104 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
105 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
106 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
107 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
108 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
109 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
110 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
111 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
112 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
113 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
114 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
115 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
120 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
121 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
122 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
123 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
124 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
125 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
126 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
127 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
128 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
129 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
132 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
133 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
134 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
135 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
136 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
137 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
138 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
139 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
140 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
141 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
142 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
143 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
144 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
145 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
146 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
147 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
148 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
149 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
150 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
151 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
155 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
156 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
161 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
165 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
166 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
167 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
170 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
171 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
172 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
173 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
174 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
177 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
179 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
181 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
219 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
222 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
223 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
224 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
230 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
231 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
242 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
243 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
244 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
245 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
246 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
249 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
262 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
274 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
275 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
285 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
286 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
338 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
339 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
340 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
341 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
342 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
343 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
344 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
345 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
346 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
347 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
348 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
349 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
350 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
351 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
354 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
355 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
356 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
357 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
360 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
361 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
362 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
363 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
364 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
368 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
369 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
370 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
371 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
372 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
373 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
374 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
375 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
376 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
377 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
378 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
379 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
380 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
381 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
382 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
383 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
384 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
385 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
386 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
387 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.18
Metatranscriptomes 0
Isolates 15.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.39
Nodule 7.89
Rhizoplane 5.35
Rhizosphere 62.54
Stem 0
Stem Tuber 0.14
Unclassified 11.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010281 3300001989 Bacteria 3475
2 JGI24737J22298_10042568 3300001990 Bacteria 1391
3 JGI24735J21928_10028584 3300002067 Bacteria 1664
4 JGI24735J21928_10040147 3300002067 Bacteria 1367
5 JGI24742J22300_10011531 3300002244 Bacteria 1468
6 JGI25159J45721_1012079 3300002987 Bacteria 2079
7 JGI25151J46595_10000115 3300003187 Bacteria 107493
8 JGI25165J46597_1000254 3300003214 Bacteria 71635
9 JGI25153J46596_10006347 3300003215 Bacteria 6006
10 rootH2_10004835 3300003320 Bacteria 6667
11 Ga0055526_1000476 3300003771 Bacteria 31852
12 Ga0055524_1000065 3300003775 Bacteria 132117
13 Ga0065165_1000234 3300005262 Bacteria 96709
14 Ga0070658_10084687 3300005327 Bacteria 2607
15 Ga0070658_10329615 3300005327 Bacteria 1304
16 Ga0070683_100018116 3300005329 Bacteria 6232
17 Ga0070680_100041343 3300005336 Bacteria 3738
18 Ga0070680_100042419 3300005336 Bacteria 3692
19 Ga0070682_100147618 3300005337 Bacteria 1610
20 Ga0070660_100011370 3300005339 Bacteria 6320
21 Ga0070660_100097419 3300005339 Bacteria 2327
22 Ga0070668_100008027 3300005347 Bacteria 7842
23 Ga0070668_100077419 3300005347 Bacteria 2600
24 Ga0070668_100134473 3300005347 Bacteria 1987
25 Ga0070669_100112287 3300005353 Bacteria 2069
26 Ga0070675_100219364 3300005354 Bacteria 1656
27 Ga0070671_100151891 3300005355 Bacteria 1955
28 Ga0070674_100039327 3300005356 Bacteria 3193
29 Ga0070674_100163758 3300005356 Bacteria 1690
30 Ga0070659_100017643 3300005366 Bacteria 5376
31 Ga0070709_10006797 3300005434 Bacteria 6243
32 Ga0070714_100477322 3300005435 Bacteria 1187
33 Ga0070710_10003372 3300005437 Bacteria 7576
34 Ga0070711_100023658 3300005439 Bacteria 3999
35 Ga0070663_100014777 3300005455 Bacteria 5019
36 Ga0070663_100027481 3300005455 Bacteria 3865
37 Ga0070663_100027666 3300005455 Bacteria 3852
38 Ga0070663_100034922 3300005455 Bacteria 3485
39 Ga0070663_100061736 3300005455 Bacteria 2699
40 Ga0070678_100037889 3300005456 Bacteria 3390
41 Ga0070681_10077741 3300005458 Bacteria 3276
42 Ga0068867_100074046 3300005459 Bacteria 2551
43 Ga0070707_100127385 3300005468 Bacteria 2474
44 Ga0070679_100021210 3300005530 Bacteria 6339
45 Ga0070679_100034031 3300005530 Bacteria 5048
46 Ga0070679_100387958 3300005530 Bacteria 1343
47 Ga0070684_100126565 3300005535 Bacteria 2302
48 Ga0068853_100067129 3300005539 Bacteria 3116
49 Ga0068853_100210610 3300005539 Bacteria 1771
50 Ga0068853_100339801 3300005539 Bacteria 1395
51 Ga0070696_100026747 3300005546 Bacteria 3926
52 Ga0070665_100057580 3300005548 Bacteria 3896
53 Ga0070665_100078620 3300005548 Bacteria 3305
54 Ga0070665_100459281 3300005548 Bacteria 1283
55 Ga0068855_100178166 3300005563 Bacteria 2404
56 Ga0070664_100049276 3300005564 Bacteria 3562
57 Ga0068857_100006293 3300005577 Bacteria 10158
58 Ga0068856_100004432 3300005614 Bacteria 13977
59 Ga0068856_100054240 3300005614 Bacteria 3953
60 Ga0068852_100130918 3300005616 Bacteria 2310
61 Ga0068866_10000352 3300005718 Bacteria 21609
62 Ga0068866_10118755 3300005718 Bacteria 1487
63 Ga0068858_100250787 3300005842 Bacteria 1681
64 Ga0081455_10002181 3300005937 Bacteria 23343
65 Ga0081455_10017868 3300005937 Bacteria 6779
66 Ga0081455_10018740 3300005937 Bacteria 6570
67 Ga0081455_10214017 3300005937 Bacteria 1434
68 Ga0081538_10050827 3300005981 Bacteria 2497
69 Ga0081540_1002178 3300005983 Bacteria 16217
70 Ga0081540_1004228 3300005983 Bacteria 11030
71 Ga0081540_1007503 3300005983 Bacteria 7765
72 Ga0081540_1022713 3300005983 Bacteria 3698
73 Ga0075365_10195658 3300006038 Bacteria 1415
74 Ga0075363_100000054 3300006048 Bacteria 22658
75 Ga0075363_100085491 3300006048 Bacteria 1730
76 Ga0075364_10005813 3300006051 Bacteria 7200
77 Ga0075364_10006576 3300006051 Bacteria 6840
78 Ga0075364_10096044 3300006051 Bacteria 1971
79 Ga0075364_10098650 3300006051 Bacteria 1943
80 Ga0070712_100014886 3300006175 Bacteria 4999
81 Ga0075362_10000010 3300006177 Bacteria 109823
82 Ga0075367_10015014 3300006178 Bacteria 4199
83 Ga0075367_10092277 3300006178 Bacteria 1843
84 Ga0075366_10015875 3300006195 Bacteria 4322
85 Ga0075370_10005200 3300006353 Bacteria 6436
86 Ga0075370_10017896 3300006353 Bacteria 3834
87 Ga0068871_100128779 3300006358 Bacteria 2144
88 Ga0075428_100041074 3300006844 Bacteria 5087
89 Ga0075428_100137254 3300006844 Bacteria 2659
90 Ga0099795_10003131 3300007788 Bacteria 4053
91 Ga0105240_10008978 3300009093 Bacteria 14208
92 Ga0105240_10076252 3300009093 Bacteria 4133
93 Ga0105240_10144047 3300009093 Bacteria 2845
94 Ga0105240_10187683 3300009093 Bacteria 2433
95 Ga0105240_10287702 3300009093 Bacteria 1885
96 Ga0114129_10028277 3300009147 Bacteria 7943
97 Ga0114129_10262210 3300009147 Bacteria 2315
98 Ga0105243_10101259 3300009148 Bacteria 2392
99 Ga0105241_10000040 3300009174 Bacteria 111228
100 Ga0105241_10169272 3300009174 Bacteria 1803
101 Ga0105242_10000863 3300009176 Bacteria 23516
102 Ga0105242_10199507 3300009176 Bacteria 1776
103 Ga0105248_10017437 3300009177 Bacteria 7917
104 Ga0105237_10012602 3300009545 Bacteria 8905
105 Ga0105237_10022058 3300009545 Bacteria 6536
106 Ga0105237_10072488 3300009545 Bacteria 3437
107 Ga0105237_10196225 3300009545 Bacteria 2019
108 Ga0105238_10017854 3300009551 Bacteria 7213
109 Ga0105238_10033083 3300009551 Bacteria 5261
110 Ga0105238_10082103 3300009551 Bacteria 3213
111 Ga0105238_10258675 3300009551 Bacteria 1720
112 Ga0105238_10279469 3300009551 Bacteria 1651
113 Ga0105249_10006316 3300009553 Bacteria 10298
114 Ga0105249_10154760 3300009553 Bacteria 2210
115 Ga0099796_10005011 3300010159 Bacteria 3267
116 Ga0105239_10002481 3300010375 Bacteria 23516
117 Ga0105239_10025567 3300010375 Bacteria 6499
118 Ga0105239_10036746 3300010375 Bacteria 5374
119 Ga0105239_10147181 3300010375 Bacteria 2628
120 Ga0105239_10148647 3300010375 Bacteria 2614
121 Ga0105246_10237865 3300011119 Bacteria 1438
122 Ga0157371_10040186 3300013102 Bacteria 3342
123 Ga0157370_10146480 3300013104 Bacteria 2199
124 Ga0157369_10044262 3300013105 Bacteria 4847
125 Ga0157369_10059929 3300013105 Bacteria 4105
126 Ga0157369_10337134 3300013105 Bacteria 1566
127 Ga0157374_10085287 3300013296 Bacteria 3003
128 Ga0157374_10386595 3300013296 Bacteria 1394
129 Ga0163162_10050689 3300013306 Bacteria 4163
130 Ga0163163_10073912 3300014325 Bacteria 3400
131 Ga0163163_10084396 3300014325 Bacteria 3182
132 Ga0157376_10012422 3300014969 Bacteria 6322
133 Ga0157376_10046105 3300014969 Bacteria 3593
134 Ga0157376_10117973 3300014969 Bacteria 2347
135 Ga0157376_10285287 3300014969 Bacteria 1557
136 Ga0182007_10000051 3300015262 Bacteria 99393
137 Ga0182007_10016874 3300015262 Bacteria 2683
138 Ga0182005_1028056 3300015265 Bacteria 1535
139 Ga0209233_1000028 3300025261 Bacteria 642062
140 Ga0209130_1000090 3300025284 Bacteria 151512
141 Ga0209130_1000609 3300025284 Bacteria 34548
142 Ga0209675_1001075 3300025291 Bacteria 16889
143 Ga0209025_1000084 3300025294 Bacteria 263812
144 Ga0209564_1000059 3300025295 Bacteria 328782
145 Ga0209564_1000971 3300025295 Bacteria 36259
146 Ga0209758_1001444 3300025297 Bacteria 28002
147 Ga0209758_1003954 3300025297 Bacteria 12863
148 Ga0209256_1000033 3300025299 Bacteria 393924
149 Ga0207426_1000113 3300025302 Bacteria 228304
150 Ga0207692_10001968 3300025898 Bacteria 7838
151 Ga0207692_10022820 3300025898 Bacteria 2886
152 Ga0207642_10000092 3300025899 Bacteria 23522
153 Ga0207647_10000520 3300025904 Bacteria 30739
154 Ga0207647_10013527 3300025904 Bacteria 5652
155 Ga0207647_10018948 3300025904 Bacteria 4637
156 Ga0207647_10080587 3300025904 Bacteria 1952
157 Ga0207699_10016578 3300025906 Bacteria 3857
158 Ga0207705_10000703 3300025909 Bacteria 27614
159 Ga0207654_10000060 3300025911 Bacteria 74426
160 Ga0207707_10061643 3300025912 Bacteria 3264
161 Ga0207695_10022662 3300025913 Bacteria 7120
162 Ga0207695_10072417 3300025913 Bacteria 3516
163 Ga0207695_10310666 3300025913 Bacteria 1466
164 Ga0207671_10008185 3300025914 Bacteria 8914
165 Ga0207671_10022133 3300025914 Bacteria 4810
166 Ga0207671_10073260 3300025914 Bacteria 2558
167 Ga0207671_10137920 3300025914 Bacteria 1877
168 Ga0207693_10011976 3300025915 Bacteria 7013
169 Ga0207663_10025887 3300025916 Bacteria 3399
170 Ga0207657_10045293 3300025919 Bacteria 3862
171 Ga0207652_10005516 3300025921 Bacteria 10254
172 Ga0207652_10108381 3300025921 Bacteria 2461
173 Ga0207652_10335493 3300025921 Bacteria 1365
174 Ga0207681_10111220 3300025923 Bacteria 1993
175 Ga0207694_10003718 3300025924 Bacteria 12086
176 Ga0207694_10009881 3300025924 Bacteria 7202
177 Ga0207694_10073457 3300025924 Bacteria 2676
178 Ga0207694_10140387 3300025924 Bacteria 1943
179 Ga0207694_10181841 3300025924 Bacteria 1705
180 Ga0207694_10206129 3300025924 Bacteria 1601
181 Ga0207700_10213245 3300025928 Bacteria 1634
182 Ga0207664_10068142 3300025929 Bacteria 2858
183 Ga0207690_10039354 3300025932 Bacteria 3084
184 Ga0207706_10022060 3300025933 Bacteria 5715
185 Ga0207686_10000304 3300025934 Bacteria 35773
186 Ga0207686_10124467 3300025934 Bacteria 1760
187 Ga0207665_10015899 3300025939 Bacteria 4941
188 Ga0207691_10092757 3300025940 Bacteria 2704
189 Ga0207711_10051028 3300025941 Bacteria 3542
190 Ga0207661_10043270 3300025944 Bacteria 3554
191 Ga0207661_10063302 3300025944 Bacteria 2995
192 Ga0207667_10031905 3300025949 Bacteria 5681
193 Ga0207667_10152217 3300025949 Bacteria 2380
194 Ga0207667_10225043 3300025949 Bacteria 1922
195 Ga0207668_10009915 3300025972 Bacteria 5728
196 Ga0207668_10104521 3300025972 Bacteria 2111
197 Ga0207639_10206845 3300026041 Bacteria 1687
198 Ga0207678_10000350 3300026067 Bacteria 41955
199 Ga0207678_10026232 3300026067 Bacteria 5084
200 Ga0207678_10047116 3300026067 Bacteria 3728
201 Ga0207678_10047386 3300026067 Bacteria 3717
202 Ga0207678_10050769 3300026067 Bacteria 3583
203 Ga0207702_10000452 3300026078 Bacteria 46403
204 Ga0207702_10000795 3300026078 Bacteria 33510
205 Ga0207702_10146107 3300026078 Bacteria 2146
206 Ga0207675_100143059 3300026118 Bacteria 2273
207 Ga0207675_100278048 3300026118 Bacteria 1626
208 Ga0207683_10003385 3300026121 Bacteria 13900
209 Ga0207683_10114405 3300026121 Bacteria 2418
210 Ga0207698_10028481 3300026142 Bacteria 3983
211 Ga0209179_1000277 3300027512 Bacteria 4922
212 Ga0209588_1008878 3300027671 Bacteria 2990
213 Ga0209813_10017050 3300027866 Bacteria 1989
214 Ga0268266_10001439 3300028379 Bacteria 28336
215 Ga0268266_10008469 3300028379 Bacteria 9141
216 Ga0268266_10010578 3300028379 Bacteria 8048
217 Ga0268266_10114685 3300028379 Bacteria 2391
218 Ga0268266_10355042 3300028379 Bacteria 1378
219 Ga0268265_10106089 3300028380 Bacteria 2281
220 Ga0307517_10000098 3300028786 Bacteria 126044
221 Ga0307515_10052231 3300028794 Bacteria 6068
222 Ga0265338_10015712 3300028800 Bacteria 8295
223 Ga0316177_1184578 3300030731 Bacteria 2943
224 Ga0265331_10028985 3300031250 Bacteria 2766
225 Ga0307513_10061771 3300031456 Bacteria 3964
226 Ga0307513_10085474 3300031456 Bacteria 3237
227 Ga0307509_10064501 3300031507 Bacteria 3852
228 Ga0307509_10299862 3300031507 Bacteria 1356
229 Ga0265314_10032920 3300031711 Bacteria 3807
230 Ga0307412_10013585 3300031911 Bacteria 4779
231 Ga0307412_10171950 3300031911 Bacteria 1621
232 Ga0307416_100144355 3300032002 Bacteria 2170
233 Ga0307507_10008496 3300033179 Bacteria 14162
234 Ga0373938_0024743 3300034957 Bacteria 1244
235 Ga0373954_0003833 3300035118 Bacteria 6429
236 Ga0373956_0002705 3300035119 Bacteria 7177
237 Ga0373943_0090859 3300035170 Bacteria 1581
238 Ga0373931_0001367 3300035691 Bacteria 10427
239 Ga0373931_0084727 3300035691 Bacteria 1756
240 Ga0373933_0092173 3300035724 Bacteria 1871
241 Ga0373925_0014095 3300037068 Bacteria 5785
242 Ga0395899_0000030 3300037312 Bacteria 329063
243 Ga0395900_0000023 3300037418 Bacteria 336048
244 Ga0395900_0214183 3300037418 Bacteria 1944
245 Ga0395898_0000038 3300037466 Bacteria 329063
246 Ga0395898_0231982 3300037466 Bacteria 1760
247 Ga0395905_0000021 3300037471 Bacteria 329054
248 Ga0395901_0000018 3300038443 Bacteria 336048
249 Ga0395901_0020495 3300038443 Bacteria 6766
250 Ga0237819_07090 3300038705 Bacteria 1633
251 Ga0436365_0395979 3300039437 Bacteria 10769
252 Ga0436365_0472674 3300039437 Bacteria 1794
253 Ga0436365_0722766 3300039437 Bacteria 4324
254 Ga0436365_1623535 3300039437 Bacteria 2188
255 Ga0451793_0104272 3300041452 Bacteria 2090
256 Ga0451843_1428360 3300041509 Bacteria 2398
257 Ga0439456_000061 3300042013 Bacteria 39035
258 Ga0466972_0052974 3300044658 Bacteria 1954
259 Ga0466965_0003030 3300044683 Bacteria 7301
260 Ga0466960_0001054 3300044901 Bacteria 9868
261 Ga0466959_0091662 3300045049 Bacteria 2182
262 Ga0451576_0404833 3300045051 Bacteria 1431
263 Ga0466958_0200855 3300045836 Bacteria 1269
264 Ga0466967_0013725 3300045976 Bacteria 6276
265 Ga0495603_0008610 3300046455 Bacteria 6166
266 Ga0495629_0033615 3300046459 Bacteria 3627
267 Ga0495629_0038136 3300046459 Bacteria 3386
268 Ga0495638_0007762 3300046460 Bacteria 7659
269 Ga0495650_0000009 3300046471 Bacteria 653845
270 Ga0495650_0003587 3300046471 Bacteria 11211
271 Ga0495580_0005598 3300046472 Bacteria 10353
272 Ga0495582_0006316 3300046473 Bacteria 6593
273 Ga0495594_0003253 3300046499 Bacteria 8418
274 Ga0495610_0029570 3300046512 Bacteria 2883
275 Ga0495631_0076804 3300046518 Bacteria 1441
276 Ga0495632_0032085 3300046519 Bacteria 2709
277 Ga0495665_0142380 3300046531 Unclassified 1253
278 Ga0495622_0070746 3300046557 Bacteria 1610
279 Ga0495633_0012077 3300046558 Bacteria 4611
280 Ga0495625_0001312 3300046660 Bacteria 30956
281 Ga0495625_0104136 3300046660 Bacteria 1945
282 Ga0495659_0018054 3300046664 Bacteria 2346
283 Ga0495661_0000017 3300046665 Bacteria 208119
284 Ga0495658_0008414 3300046683 Bacteria 5113
285 Ga0495672_0002365 3300047320 Bacteria 17421
286 Ga0495672_0026387 3300047320 Bacteria 3707
287 Ga0495672_0068685 3300047320 Bacteria 2014
288 Ga0495673_0036699 3300047469 Bacteria 2245
289 Ga0495686_0051322 3300047472 Bacteria 2588
290 Ga0495686_0055567 3300047472 Bacteria 2475
291 Ga0496100_0042584 3300048903 Bacteria 2900
292 Ga0496101_0093781 3300048904 Bacteria 2236
293 Ga0496101_0104927 3300048904 Bacteria 2120
294 Ga0496102_0112028 3300048905 Bacteria 2544
295 Ga0496102_0291451 3300048905 Bacteria 1538
296 Ga0496102_0494228 3300048905 Bacteria 1145
297 Ga0496104_0008854 3300048907 Bacteria 8945
298 Ga0496104_0022051 3300048907 Bacteria 5853
299 Ga0496104_0027826 3300048907 Bacteria 5233
300 Ga0496104_0145144 3300048907 Bacteria 2279
301 Ga0496105_0014982 3300048908 Bacteria 6170
302 Ga0496105_0029646 3300048908 Bacteria 4479
303 Ga0496105_0144040 3300048908 Bacteria 1960
304 Ga0496106_0014503 3300048909 Bacteria 5822
305 Ga0496107_0005083 3300048910 Bacteria 8967
306 Ga0496107_0043881 3300048910 Bacteria 3213
307 Ga0496108_0012405 3300048911 Bacteria 6934
308 Ga0496108_0085153 3300048911 Bacteria 2683
309 Ga0496108_0195006 3300048911 Bacteria 1756
310 Ga0496108_0211516 3300048911 Bacteria 1684
311 Ga0496110_0006254 3300048913 Bacteria 9392
312 Ga0496110_0029624 3300048913 Bacteria 4713
313 Ga0496110_0169332 3300048913 Bacteria 1981
314 Ga0496110_0405915 3300048913 Bacteria 1242
315 Ga0496111_0021599 3300048914 Bacteria 4498
316 Ga0496111_0070617 3300048914 Bacteria 2540
317 Ga0496112_0073963 3300048915 Bacteria 3369
318 Ga0496112_0100598 3300048915 Bacteria 2860
319 Ga0496112_0215931 3300048915 Bacteria 1874
320 Ga0496113_0039249 3300048916 Bacteria 3484
321 Ga0496114_0005433 3300048917 Bacteria 9970
322 Ga0496114_0072517 3300048917 Bacteria 2896
323 Ga0496114_0137647 3300048917 Bacteria 2112
324 Ga0496115_0000662 3300048918 Bacteria 25511
325 Ga0496115_0014023 3300048918 Bacteria 6066
326 Ga0496116_0009986 3300048919 Bacteria 8018
327 Ga0496116_0049085 3300048919 Bacteria 2826
328 Ga0496117_0043947 3300048920 Bacteria 3241
329 Ga0496117_0067982 3300048920 Bacteria 2408
330 Ga0496117_0082914 3300048920 Bacteria 2098
331 Ga0496118_0139097 3300048921 Bacteria 1543
332 Ga0496119_0021633 3300048922 Bacteria 4638
333 Ga0496120_0087944 3300048923 Bacteria 1667
334 Ga0496121_0000265 3300048924 Bacteria 109251
335 Ga0496121_0004306 3300048924 Bacteria 19282
336 Ga0496121_0007746 3300048924 Bacteria 12872
337 Ga0496121_0010192 3300048924 Bacteria 10642
338 Ga0496122_0003946 3300048925 Bacteria 18964
339 Ga0496123_0002697 3300048926 Bacteria 21346
340 Ga0496123_0063434 3300048926 Bacteria 2360
341 Ga0496124_0093856 3300048927 Bacteria 2442
342 Ga0496124_0179137 3300048927 Bacteria 1633
343 Ga0496124_0253182 3300048927 Bacteria 1301
344 Ga0496125_0002054 3300048928 Bacteria 27194
345 Ga0496126_0009405 3300048929 Bacteria 10380
346 Ga0496126_0040565 3300048929 Bacteria 4314
347 Ga0496126_0090963 3300048929 Bacteria 2684
348 Ga0496126_0197635 3300048929 Bacteria 1700
349 Ga0496126_0261445 3300048929 Bacteria 1439
350 Ga0501031_0001626 3300049568 Bacteria 14067
351 Ga0501031_0003394 3300049568 Bacteria 10221
352 Ga0501031_0033746 3300049568 Bacteria 3340
353 Ga0501031_0078537 3300049568 Bacteria 2150
354 Ga0501031_0087122 3300049568 Bacteria 2036
355 Ga0501031_0158696 3300049568 Bacteria 1478
356 Ga0501032_0000005 3300049569 Bacteria 262926
357 Ga0501032_0004418 3300049569 Bacteria 10613
358 Ga0501032_0009241 3300049569 Bacteria 7145
359 Ga0501032_0015782 3300049569 Bacteria 5326
360 Ga0501032_0025530 3300049569 Bacteria 4072
361 Ga0501033_0001174 3300049570 Bacteria 23619
362 Ga0501033_0001918 3300049570 Bacteria 18103
363 Ga0501033_0006909 3300049570 Bacteria 8861
364 Ga0501033_0007700 3300049570 Bacteria 8356
365 Ga0501033_0011510 3300049570 Bacteria 6770
366 Ga0501033_0014091 3300049570 Bacteria 6079
367 Ga0501033_0103944 3300049570 Bacteria 2071
368 Ga0501033_0159196 3300049570 Bacteria 1626
369 Ga0501034_0000027 3300049571 Bacteria 260512
370 Ga0501034_0006928 3300049571 Bacteria 12113
371 Ga0501034_0043172 3300049571 Bacteria 4564
372 Ga0501034_0048394 3300049571 Bacteria 4291
373 Ga0501034_0069581 3300049571 Bacteria 3530
374 Ga0501034_0069856 3300049571 Bacteria 3523
375 Ga0501034_0094596 3300049571 Bacteria 2985
376 Ga0501034_0178099 3300049571 Bacteria 2091
377 Ga0501034_0195433 3300049571 Bacteria 1983
378 Ga0501034_0218387 3300049571 Bacteria 1859
379 Ga0501034_0317015 3300049571 Bacteria 1492
380 Ga0501036_0003212 3300049572 Bacteria 13040
381 Ga0501036_0003777 3300049572 Bacteria 12139
382 Ga0501036_0014934 3300049572 Bacteria 6478
383 Ga0501036_0038227 3300049572 Bacteria 4061
384 Ga0501036_0111337 3300049572 Bacteria 2313
385 Ga0501037_0000125 3300049573 Bacteria 71187
386 Ga0501037_0001255 3300049573 Bacteria 18688
387 Ga0501037_0001881 3300049573 Bacteria 15257
388 Ga0501037_0003998 3300049573 Bacteria 10688
389 Ga0501037_0024632 3300049573 Bacteria 4449
390 Ga0501037_0027629 3300049573 Bacteria 4192
391 Ga0501037_0031308 3300049573 Bacteria 3927
392 Ga0501037_0246800 3300049573 Bacteria 1250
393 Ga0501038_0000053 3300049574 Bacteria 94583
394 Ga0501038_0001348 3300049574 Bacteria 22355
395 Ga0501038_0002739 3300049574 Bacteria 16418
396 Ga0501038_0009152 3300049574 Bacteria 9088
397 Ga0501038_0010268 3300049574 Bacteria 8568
398 Ga0501038_0010552 3300049574 Bacteria 8448
399 Ga0501038_0021002 3300049574 Bacteria 5866
400 Ga0501038_0025672 3300049574 Bacteria 5249
401 Ga0501038_0034203 3300049574 Bacteria 4471
402 Ga0501038_0037038 3300049574 Bacteria 4279
403 Ga0501038_0084110 3300049574 Bacteria 2677
404 Ga0501038_0275214 3300049574 Bacteria 1326
405 Ga0501039_0001416 3300049575 Bacteria 17647
406 Ga0501039_0001417 3300049575 Bacteria 17639
407 Ga0501039_0007940 3300049575 Bacteria 8084
408 Ga0501039_0061713 3300049575 Bacteria 2903
409 Ga0501039_0070553 3300049575 Bacteria 2714
410 Ga0501039_0082655 3300049575 Bacteria 2500
411 Ga0501039_0105324 3300049575 Bacteria 2202
412 Ga0501039_0174663 3300049575 Bacteria 1689
413 Ga0501039_0194065 3300049575 Bacteria 1596
414 Ga0501042_0006938 3300049578 Bacteria 7391
415 Ga0501042_0015677 3300049578 Bacteria 5191
416 Ga0501042_0021926 3300049578 Bacteria 4458
417 Ga0501042_0091435 3300049578 Bacteria 2184
418 Ga0501043_0000011 3300049579 Bacteria 198958
419 Ga0501043_0001785 3300049579 Bacteria 18494
420 Ga0501043_0003502 3300049579 Bacteria 12909
421 Ga0501043_0003989 3300049579 Bacteria 12089
422 Ga0501043_0007977 3300049579 Bacteria 8362
423 Ga0501043_0010777 3300049579 Bacteria 7159
424 Ga0501043_0023994 3300049579 Bacteria 4785
425 Ga0501043_0041137 3300049579 Bacteria 3631
426 Ga0501043_0044293 3300049579 Bacteria 3498
427 Ga0501043_0052745 3300049579 Bacteria 3194
428 Ga0501046_0004167 3300049580 Bacteria 13167
429 Ga0501046_0010460 3300049580 Bacteria 7969
430 Ga0501046_0011219 3300049580 Bacteria 7673
431 Ga0501046_0021539 3300049580 Bacteria 5319
432 Ga0501046_0024230 3300049580 Bacteria 4981
433 Ga0501046_0038705 3300049580 Bacteria 3824
434 Ga0501046_0042039 3300049580 Bacteria 3645
435 Ga0501046_0132664 3300049580 Bacteria 1888
436 Ga0501046_0221858 3300049580 Bacteria 1399
437 Ga0501047_0000581 3300049581 Bacteria 38872
438 Ga0501047_0004223 3300049581 Bacteria 13522
439 Ga0501047_0009350 3300049581 Bacteria 9254
440 Ga0501047_0026424 3300049581 Bacteria 5584
441 Ga0501047_0036757 3300049581 Bacteria 4734
442 Ga0501047_0040670 3300049581 Bacteria 4495
443 Ga0501047_0043601 3300049581 Bacteria 4333
444 Ga0501047_0084287 3300049581 Bacteria 3054
445 Ga0501047_0301651 3300049581 Bacteria 1444
446 Ga0501048_0002011 3300049582 Bacteria 15451
447 Ga0501048_0005098 3300049582 Bacteria 10009
448 Ga0501048_0010180 3300049582 Bacteria 7032
449 Ga0501048_0011775 3300049582 Bacteria 6519
450 Ga0501048_0029682 3300049582 Bacteria 3963
451 Ga0501048_0031071 3300049582 Bacteria 3865
452 Ga0501067_0004621 3300049583 Bacteria 7622
453 Ga0501067_0008285 3300049583 Bacteria 5772
454 Ga0501067_0025467 3300049583 Bacteria 3279
455 Ga0501067_0062471 3300049583 Bacteria 2062
456 Ga0501068_0002752 3300049584 Bacteria 9339
457 Ga0501068_0016002 3300049584 Bacteria 4320
458 Ga0501068_0016689 3300049584 Bacteria 4235
459 Ga0501068_0020455 3300049584 Bacteria 3856
460 Ga0501068_0085158 3300049584 Bacteria 1945
461 Ga0501069_0001078 3300049585 Bacteria 13114
462 Ga0501069_0002656 3300049585 Bacteria 9124
463 Ga0501069_0006483 3300049585 Bacteria 6119
464 Ga0501069_0009547 3300049585 Bacteria 5122
465 Ga0501070_0008169 3300049586 Bacteria 8853
466 Ga0501070_0015441 3300049586 Bacteria 6424
467 Ga0501070_0070219 3300049586 Bacteria 2900
468 Ga0501070_0074318 3300049586 Bacteria 2813
469 Ga0501070_0227273 3300049586 Bacteria 1529
470 Ga0501071_0014348 3300049587 Bacteria 5417
471 Ga0501071_0086994 3300049587 Bacteria 2292
472 Ga0501072_0197083 3300049588 Bacteria 1606
473 Ga0501073_0003878 3300049589 Bacteria 11225
474 Ga0501073_0019733 3300049589 Bacteria 4865
475 Ga0501073_0019784 3300049589 Bacteria 4858
476 Ga0501073_0048125 3300049589 Bacteria 2994
477 Ga0501073_0059823 3300049589 Bacteria 2659
478 Ga0501073_0109947 3300049589 Bacteria 1912
479 Ga0501074_0004446 3300049590 Bacteria 10031
480 Ga0501074_0005779 3300049590 Bacteria 8921
481 Ga0501074_0008800 3300049590 Bacteria 7317
482 Ga0501074_0028821 3300049590 Bacteria 4022
483 Ga0501076_0042168 3300049592 Bacteria 3593
484 Ga0501077_0136906 3300049593 Bacteria 1553
485 Ga0501077_0188865 3300049593 Bacteria 1309
486 Ga0501259_000060 3300049688 Bacteria 15102
487 Ga0501079_0089088 3300049741 Bacteria 2389
488 Ga0501079_0199788 3300049741 Bacteria 1561
489 Ga0501080_0001694 3300049742 Bacteria 18799
490 Ga0501080_0005649 3300049742 Bacteria 11180
491 Ga0501080_0008204 3300049742 Bacteria 9459
492 Ga0501080_0015542 3300049742 Bacteria 7019
493 Ga0501080_0020346 3300049742 Bacteria 6141
494 Ga0501080_0030751 3300049742 Bacteria 5002
495 Ga0501080_0048187 3300049742 Bacteria 3966
496 Ga0501080_0090332 3300049742 Bacteria 2845
497 Ga0501080_0213891 3300049742 Bacteria 1766
498 Ga0501080_0250923 3300049742 Bacteria 1613
499 Ga0501083_0000208 3300049744 Bacteria 38117
500 Ga0501083_0057951 3300049744 Bacteria 2592
501 Ga0501083_0108254 3300049744 Bacteria 1828
502 Ga0501035_0000589 3300049822 Bacteria 40009
503 Ga0501035_0000594 3300049822 Bacteria 39868
504 Ga0501035_0000755 3300049822 Bacteria 34825
505 Ga0501035_0001704 3300049822 Bacteria 22196
506 Ga0501035_0004158 3300049822 Bacteria 13758
507 Ga0501035_0022979 3300049822 Bacteria 5723
508 Ga0501035_0039124 3300049822 Bacteria 4292
509 Ga0501035_0040993 3300049822 Bacteria 4181
510 Ga0501035_0045961 3300049822 Bacteria 3927
511 Ga0501035_0046601 3300049822 Bacteria 3899
512 Ga0501035_0071855 3300049822 Bacteria 3063
513 Ga0501035_0099665 3300049822 Bacteria 2550
514 Ga0501035_0105297 3300049822 Bacteria 2473
515 Ga0501035_0159802 3300049822 Bacteria 1951
516 Ga0501035_0167675 3300049822 Bacteria 1898
517 Ga0501035_0217812 3300049822 Bacteria 1631
518 Ga0501044_0002324 3300049823 Bacteria 21666
519 Ga0501044_0008654 3300049823 Bacteria 11148
520 Ga0501044_0013659 3300049823 Bacteria 8775
521 Ga0501044_0026369 3300049823 Bacteria 6152
522 Ga0501044_0056105 3300049823 Bacteria 4044
523 Ga0501044_0060429 3300049823 Bacteria 3880
524 Ga0501044_0081195 3300049823 Bacteria 3282
525 Ga0501044_0161190 3300049823 Bacteria 2219
526 Ga0501044_0176342 3300049823 Bacteria 2106
527 Ga0501044_0211891 3300049823 Bacteria 1891
528 Ga0501044_0237105 3300049823 Bacteria 1769
529 Ga0501044_0319498 3300049823 Bacteria 1477
530 Ga0501044_0365042 3300049823 Bacteria 1361
531 Ga0501045_0005507 3300049824 Bacteria 8759
532 Ga0501045_0014258 3300049824 Bacteria 5633
533 Ga0501045_0085901 3300049824 Bacteria 2322
534 nmdc:mga03683_5_c1 3300050489 Bacteria 157897
535 nmdc:mga03n38_244_c1 3300050490 Bacteria 12819
536 nmdc:mga03n38_59697_c1 3300050490 Bacteria 1732
537 nmdc:mga00v17_78829_c1 3300050491 Bacteria 2053
538 nmdc:mga00v17_95_c1 3300050491 Bacteria 52432
539 nmdc:mga0yw44_72617_c1 3300050492 Bacteria 2139
540 nmdc:mga0k408_29423_c1 3300050493 Bacteria 3126
541 nmdc:mga06z11_17662_c1 3300050494 Bacteria 3243
542 nmdc:mga04h51_5197_c1 3300050495 Bacteria 3303
543 nmdc:mga07m45_2837_c1 3300050496 Bacteria 8199
544 nmdc:mga07m45_7313_c1 3300050496 Bacteria 5634
545 nmdc:mga05p37_395962_c1 3300050507 Bacteria 1614
546 nmdc:mga06r32_188771_c1 3300050510 Bacteria 2048
547 Ga0500644_0000325 3300053088 Bacteria 24740
548 Ga0500644_0023547 3300053088 Bacteria 1871
549 Ga0500651_0000004 3300053093 Bacteria 389879
550 Ga0500651_0001377 3300053093 Bacteria 12178
551 Ga0500651_0003048 3300053093 Bacteria 9060
552 Ga0500566_0003537 3300053094 Bacteria 9314
553 Ga0500641_0005170 3300053096 Bacteria 4624
554 Ga0500641_0022724 3300053096 Bacteria 2405
555 Ga0500650_0011126 3300053098 Bacteria 3690
556 Ga0500555_000026 3300053103 Bacteria 114412
557 Ga0500556_0000017 3300053104 Bacteria 192495
558 Ga0500556_0000195 3300053104 Bacteria 49800
559 Ga0500592_000349 3300053116 Bacteria 7762
560 Ga0500593_000006 3300053117 Bacteria 88644
561 Ga0500595_000001 3300053119 Bacteria 1088438
562 Ga0500595_000035 3300053119 Bacteria 106463
563 Ga0500595_002917 3300053119 Bacteria 8181
564 Ga0500595_002948 3300053119 Bacteria 8123
565 Ga0500595_006998 3300053119 Bacteria 4727
566 Ga0500607_088437 3300053121 Bacteria 1564
567 Ga0500608_012354 3300053122 Bacteria 3742
568 Ga0500642_0000012 3300053130 Bacteria 206424
569 Ga0500652_000146 3300053131 Bacteria 26947
570 Ga0500652_012191 3300053131 Bacteria 3008
571 Ga0500658_0006611 3300053134 Bacteria 4297
572 Ga0500658_0015652 3300053134 Bacteria 2818
573 Ga0500559_0000848 3300053136 Bacteria 19718
574 Ga0500568_0000005 3300053139 Bacteria 614296
575 Ga0500568_0010600 3300053139 Bacteria 4303
576 Ga0500568_0011318 3300053139 Bacteria 4147
577 Ga0500577_0006426 3300053142 Bacteria 3243
578 Ga0500586_002295 3300053145 Bacteria 4270
579 Ga0500604_0023785 3300053151 Bacteria 1749
580 Ga0500616_0000001 3300053153 Bacteria 1986011
581 Ga0500616_0001093 3300053153 Bacteria 28182
582 Ga0500616_0012122 3300053153 Bacteria 5056
583 Ga0500616_0023146 3300053153 Bacteria 3463
584 Ga0500622_0001963 3300053156 Bacteria 15485
585 Ga0500622_0031719 3300053156 Bacteria 2773
586 Ga0500627_0038807 3300053158 Bacteria 2038
587 Ga0500634_0000014 3300053161 Bacteria 114625
588 Ga0500638_000002 3300053162 Bacteria 188968
589 Ga0500636_0000495 3300053177 Bacteria 21410
590 Ga0500645_000629 3300053730 Bacteria 22510
591 Ga0500645_024648 3300053730 Bacteria 1838
592 Ga0501084_0009969 3300054114 Bacteria 7852
593 Ga0501084_0023861 3300054114 Bacteria 5101
594 Ga0501084_0024592 3300054114 Bacteria 5026
595 Ga0501082_0013202 3300060353 Bacteria 7104
596 Ga0501082_0093886 3300060353 Bacteria 2592

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046531 Ga0495665_0142380 Ga0495665_0142380_313_1203 296
2 3300025924 Ga0207694_10206129 Ga0207694_102061291 313
3 3300009551 Ga0105238_10279469 Ga0105238_102794692 315
4 3300035118 Ga0373954_0003833 Ga0373954_0003833_99_1049 316
5 3300035119 Ga0373956_0002705 Ga0373956_0002705_6108_7058 316
6 3300035724 Ga0373933_0092173 Ga0373933_0092173_805_1755 316
7 3300046558 Ga0495633_0012077 Ga0495633_0012077_3156_4307 318
8 3300015262 Ga0182007_10000051 Ga0182007_10000051125 319
9 3300046665 Ga0495661_0000017 Ga0495661_0000017_125751_126902 319
10 3300039437 Ga0436365_0722766 Ga0436365_0722766_2738_3703 321
11 3300049573 Ga0501037_0246800 Ga0501037_0246800_15_983 322
12 iso_pu_bacteria 2899370129 2899372841 322
13 3300005458 Ga0070681_10077741 Ga0070681_100777412 325
14 3300005530 Ga0070679_100387958 Ga0070679_1003879582 325
15 3300053103 Ga0500555_000026 Ga0500555_000026_93263_94321 325
16 3300053153 Ga0500616_0012122 Ga0500616_0012122_2465_3523 325
17 iso_pu_bacteria 2935684952 2935688570 325
18 iso_pu_bacteria 2935713505 2935715589 325
19 iso_pu_bacteria 2935722832 2935725847 325
20 iso_pu_bacteria 2935732158 2935734408 325
21 iso_pu_bacteria 2935741537 2935743787 325
22 iso_pu_bacteria 2935750917 2935754176 325
23 iso_pu_bacteria 2940556831 2940560448 325
24 3300003320 rootH2_10004835 rootH2_100048352 326
25 3300005546 Ga0070696_100026747 Ga0070696_1000267472 326
26 3300005614 Ga0068856_100004432 Ga0068856_1000044324 326
27 3300005614 Ga0068856_100054240 Ga0068856_1000542402 326
28 3300006844 Ga0075428_100137254 Ga0075428_1001372542 326
29 3300009093 Ga0105240_10144047 Ga0105240_101440471 326
30 3300009093 Ga0105240_10287702 Ga0105240_102877022 326
31 3300009545 Ga0105237_10012602 Ga0105237_100126021 326
32 3300009551 Ga0105238_10017854 Ga0105238_100178542 326
33 3300009551 Ga0105238_10258675 Ga0105238_102586751 326
34 3300014969 Ga0157376_10285287 Ga0157376_102852872 326
35 3300025912 Ga0207707_10061643 Ga0207707_100616432 326
36 3300025914 Ga0207671_10008185 Ga0207671_100081851 326
37 3300025921 Ga0207652_10335493 Ga0207652_103354932 326
38 3300025924 Ga0207694_10003718 Ga0207694_100037183 326
39 3300025924 Ga0207694_10009881 Ga0207694_100098814 326
40 3300025924 Ga0207694_10073457 Ga0207694_100734572 326
41 3300025949 Ga0207667_10152217 Ga0207667_101522172 326
42 3300026078 Ga0207702_10000452 Ga0207702_1000045233 326
43 3300026078 Ga0207702_10000795 Ga0207702_1000079537 326
44 3300028800 Ga0265338_10015712 Ga0265338_100157124 326
45 3300039437 Ga0436365_0395979 Ga0436365_0395979_8711_9772 326
46 iso_pu_bacteria 2786546517 2787437863 326
47 3300005327 Ga0070658_10329615 Ga0070658_103296151 327
48 3300005336 Ga0070680_100042419 Ga0070680_1000424191 327
49 3300005435 Ga0070714_100477322 Ga0070714_1004773221 327
50 3300005468 Ga0070707_100127385 Ga0070707_1001273852 327
51 3300005530 Ga0070679_100034031 Ga0070679_1000340312 327
52 3300005548 Ga0070665_100078620 Ga0070665_1000786203 327
53 3300005842 Ga0068858_100250787 Ga0068858_1002507873 327
54 3300006048 Ga0075363_100000054 Ga0075363_10000005416 327
55 3300006051 Ga0075364_10006576 Ga0075364_100065766 327
56 3300006177 Ga0075362_10000010 Ga0075362_1000001081 327
57 3300006178 Ga0075367_10015014 Ga0075367_100150147 327
58 3300006353 Ga0075370_10017896 Ga0075370_100178965 327
59 3300009093 Ga0105240_10187683 Ga0105240_101876833 327
60 3300009174 Ga0105241_10000040 Ga0105241_1000004034 327
61 3300009176 Ga0105242_10199507 Ga0105242_101995072 327
62 3300009545 Ga0105237_10072488 Ga0105237_100724881 327
63 3300009551 Ga0105238_10082103 Ga0105238_100821032 327
64 3300010375 Ga0105239_10025567 Ga0105239_100255674 327
65 3300010375 Ga0105239_10036746 Ga0105239_100367462 327
66 3300010375 Ga0105239_10147181 Ga0105239_101471813 327
67 3300013296 Ga0157374_10386595 Ga0157374_103865952 327
68 3300014969 Ga0157376_10012422 Ga0157376_100124223 327
69 3300015262 Ga0182007_10016874 Ga0182007_100168743 327
70 3300025911 Ga0207654_10000060 Ga0207654_100000609 327
71 3300025913 Ga0207695_10310666 Ga0207695_103106662 327
72 3300025914 Ga0207671_10022133 Ga0207671_100221331 327
73 3300025921 Ga0207652_10005516 Ga0207652_100055166 327
74 3300025924 Ga0207694_10140387 Ga0207694_101403873 327
75 3300025934 Ga0207686_10124467 Ga0207686_101244671 327
76 3300026078 Ga0207702_10146107 Ga0207702_101461072 327
77 3300028379 Ga0268266_10114685 Ga0268266_101146852 327
78 3300028379 Ga0268266_10355042 Ga0268266_103550421 327
79 3300031911 Ga0307412_10171950 Ga0307412_101719501 327
80 3300032002 Ga0307416_100144355 Ga0307416_1001443552 327
81 3300037068 Ga0373925_0014095 Ga0373925_0014095_251_1276 327
82 3300039437 Ga0436365_0472674 Ga0436365_0472674_175_1227 327
83 3300045049 Ga0466959_0091662 Ga0466959_0091662_668_1699 327
84 3300045051 Ga0451576_0404833 Ga0451576_0404833_380_1420 327
85 3300045836 Ga0466958_0200855 Ga0466958_0200855_35_1066 327
86 3300046459 Ga0495629_0038136 Ga0495629_0038136_1100_2143 327
87 3300046472 Ga0495580_0005598 Ga0495580_0005598_2815_3858 327
88 3300046473 Ga0495582_0006316 Ga0495582_0006316_2456_3499 327
89 3300046499 Ga0495594_0003253 Ga0495594_0003253_6497_7540 327
90 3300046683 Ga0495658_0008414 Ga0495658_0008414_978_2021 327
91 3300047320 Ga0495672_0002365 Ga0495672_0002365_3044_4045 327
92 3300048918 Ga0496115_0014023 Ga0496115_0014023_1337_2362 327
93 3300049571 Ga0501034_0195433 Ga0501034_0195433_197_1249 327
94 3300049573 Ga0501037_0001881 Ga0501037_0001881_138_1184 327
95 3300049581 Ga0501047_0000581 Ga0501047_0000581_194_1195 327
96 3300049688 Ga0501259_000060 Ga0501259_000060_9604_10644 327
97 3300049822 Ga0501035_0000594 Ga0501035_0000594_35088_36089 327
98 3300049823 Ga0501044_0002324 Ga0501044_0002324_9529_10530 327
99 3300049823 Ga0501044_0008654 Ga0501044_0008654_1642_2688 327
100 3300050489 nmdc:mga03683_5_c1 nmdc:mga03683_5_c1_83903_84943 327
101 3300050490 nmdc:mga03n38_244_c1 nmdc:mga03n38_244_c1_9318_10361 327
102 3300050491 nmdc:mga00v17_95_c1 nmdc:mga00v17_95_c1_7099_8139 327
103 3300050493 nmdc:mga0k408_29423_c1 nmdc:mga0k408_29423_c1_1754_2797 327
104 3300050494 nmdc:mga06z11_17662_c1 nmdc:mga06z11_17662_c1_921_1964 327
105 3300050496 nmdc:mga07m45_2837_c1 nmdc:mga07m45_2837_c1_1539_2582 327
106 3300053119 Ga0500595_000035 Ga0500595_000035_70119_71195 327
107 3300053162 Ga0500638_000002 Ga0500638_000002_98037_99071 327
108 iso_pu_bacteria 2687453341 2688391968 327
109 3300005437 Ga0070710_10003372 Ga0070710_100033729 328
110 3300005563 Ga0068855_100178166 Ga0068855_1001781662 328
111 3300005616 Ga0068852_100130918 Ga0068852_1001309182 328
112 3300005718 Ga0068866_10000352 Ga0068866_100003527 328
113 3300009093 Ga0105240_10008978 Ga0105240_100089784 328
114 3300009176 Ga0105242_10000863 Ga0105242_1000086314 328
115 3300009553 Ga0105249_10006316 Ga0105249_100063162 328
116 3300010375 Ga0105239_10002481 Ga0105239_1000248114 328
117 3300025898 Ga0207692_10001968 Ga0207692_100019682 328
118 3300025899 Ga0207642_10000092 Ga0207642_100000929 328
119 3300025913 Ga0207695_10022662 Ga0207695_100226622 328
120 3300025934 Ga0207686_10000304 Ga0207686_1000030414 328
121 3300025949 Ga0207667_10225043 Ga0207667_102250432 328
122 3300030731 Ga0316177_1184578 Ga0316177_11845784 328
123 3300035691 Ga0373931_0084727 Ga0373931_0084727_295_1332 328
124 3300044658 Ga0466972_0052974 Ga0466972_0052974_167_1213 328
125 3300044683 Ga0466965_0003030 Ga0466965_0003030_1817_2863 328
126 3300044901 Ga0466960_0001054 Ga0466960_0001054_834_1880 328
127 3300049568 Ga0501031_0087122 Ga0501031_0087122_420_1481 328
128 3300049569 Ga0501032_0015782 Ga0501032_0015782_506_1567 328
129 3300049571 Ga0501034_0006928 Ga0501034_0006928_5769_6830 328
130 3300049575 Ga0501039_0007940 Ga0501039_0007940_1954_3018 328
131 3300049575 Ga0501039_0061713 Ga0501039_0061713_91_1152 328
132 3300049579 Ga0501043_0001785 Ga0501043_0001785_1453_2511 328
133 3300049580 Ga0501046_0011219 Ga0501046_0011219_6529_7590 328
134 3300049581 Ga0501047_0040670 Ga0501047_0040670_1403_2467 328
135 3300049581 Ga0501047_0043601 Ga0501047_0043601_1214_2272 328
136 3300049584 Ga0501068_0085158 Ga0501068_0085158_113_1174 328
137 3300049585 Ga0501069_0009547 Ga0501069_0009547_3486_4547 328
138 3300049586 Ga0501070_0070219 Ga0501070_0070219_40_1101 328
139 3300049588 Ga0501072_0197083 Ga0501072_0197083_360_1421 328
140 3300049589 Ga0501073_0059823 Ga0501073_0059823_1339_2403 328
141 3300049593 Ga0501077_0136906 Ga0501077_0136906_450_1508 328
142 3300049593 Ga0501077_0188865 Ga0501077_0188865_186_1244 328
143 3300049742 Ga0501080_0250923 Ga0501080_0250923_374_1432 328
144 3300049744 Ga0501083_0000208 Ga0501083_0000208_16062_17120 328
145 3300049822 Ga0501035_0040993 Ga0501035_0040993_1050_2108 328
146 3300049822 Ga0501035_0167675 Ga0501035_0167675_207_1268 328
147 3300049823 Ga0501044_0319498 Ga0501044_0319498_94_1152 328
148 3300053093 Ga0500651_0000004 Ga0500651_0000004_170153_171292 328
149 3300054114 Ga0501084_0023861 Ga0501084_0023861_1987_3045 328
150 3300060353 Ga0501082_0093886 Ga0501082_0093886_38_1096 328
151 iso_pu_bacteria 2558860112 2558908760 328
152 iso_pu_bacteria 2870782633 2870786878 328
153 iso_pu_bacteria 8047710418 8047716774 328
154 3300001989 JGI24739J22299_10010281 JGI24739J22299_100102813 329
155 3300001990 JGI24737J22298_10042568 JGI24737J22298_100425682 329
156 3300002067 JGI24735J21928_10028584 JGI24735J21928_100285841 329
157 3300002067 JGI24735J21928_10040147 JGI24735J21928_100401472 329
158 3300002244 JGI24742J22300_10011531 JGI24742J22300_100115311 329
159 3300002987 JGI25159J45721_1012079 JGI25159J45721_10120793 329
160 3300003187 JGI25151J46595_10000115 JGI25151J46595_100001155 329
161 3300003214 JGI25165J46597_1000254 JGI25165J46597_10002544 329
162 3300003215 JGI25153J46596_10006347 JGI25153J46596_100063472 329
163 3300003771 Ga0055526_1000476 Ga0055526_100047612 329
164 3300003775 Ga0055524_1000065 Ga0055524_100006592 329
165 3300005262 Ga0065165_1000234 Ga0065165_100023411 329
166 3300005327 Ga0070658_10084687 Ga0070658_100846872 329
167 3300005329 Ga0070683_100018116 Ga0070683_1000181164 329
168 3300005336 Ga0070680_100041343 Ga0070680_1000413432 329
169 3300005337 Ga0070682_100147618 Ga0070682_1001476181 329
170 3300005339 Ga0070660_100011370 Ga0070660_1000113702 329
171 3300005339 Ga0070660_100097419 Ga0070660_1000974192 329
172 3300005347 Ga0070668_100008027 Ga0070668_1000080272 329
173 3300005347 Ga0070668_100077419 Ga0070668_1000774194 329
174 3300005347 Ga0070668_100134473 Ga0070668_1001344732 329
175 3300005353 Ga0070669_100112287 Ga0070669_1001122872 329
176 3300005354 Ga0070675_100219364 Ga0070675_1002193642 329
177 3300005355 Ga0070671_100151891 Ga0070671_1001518912 329
178 3300005356 Ga0070674_100039327 Ga0070674_1000393272 329
179 3300005356 Ga0070674_100163758 Ga0070674_1001637581 329
180 3300005366 Ga0070659_100017643 Ga0070659_1000176433 329
181 3300005434 Ga0070709_10006797 Ga0070709_100067978 329
182 3300005439 Ga0070711_100023658 Ga0070711_1000236582 329
183 3300005455 Ga0070663_100014777 Ga0070663_1000147773 329
184 3300005455 Ga0070663_100027481 Ga0070663_1000274812 329
185 3300005455 Ga0070663_100027666 Ga0070663_1000276662 329
186 3300005455 Ga0070663_100034922 Ga0070663_1000349222 329
187 3300005455 Ga0070663_100061736 Ga0070663_1000617362 329
188 3300005456 Ga0070678_100037889 Ga0070678_1000378892 329
189 3300005459 Ga0068867_100074046 Ga0068867_1000740462 329
190 3300005530 Ga0070679_100021210 Ga0070679_1000212105 329
191 3300005535 Ga0070684_100126565 Ga0070684_1001265652 329
192 3300005539 Ga0068853_100067129 Ga0068853_1000671292 329
193 3300005539 Ga0068853_100210610 Ga0068853_1002106102 329
194 3300005539 Ga0068853_100339801 Ga0068853_1003398012 329
195 3300005548 Ga0070665_100057580 Ga0070665_1000575802 329
196 3300005548 Ga0070665_100459281 Ga0070665_1004592811 329
197 3300005564 Ga0070664_100049276 Ga0070664_1000492762 329
198 3300005577 Ga0068857_100006293 Ga0068857_1000062932 329
199 3300005718 Ga0068866_10118755 Ga0068866_101187551 329
200 3300005937 Ga0081455_10002181 Ga0081455_100021816 329
201 3300005937 Ga0081455_10017868 Ga0081455_100178682 329
202 3300005937 Ga0081455_10018740 Ga0081455_100187402 329
203 3300005937 Ga0081455_10214017 Ga0081455_102140172 329
204 3300005981 Ga0081538_10050827 Ga0081538_100508272 329
205 3300005983 Ga0081540_1002178 Ga0081540_10021784 329
206 3300005983 Ga0081540_1004228 Ga0081540_10042289 329
207 3300005983 Ga0081540_1007503 Ga0081540_10075038 329
208 3300005983 Ga0081540_1022713 Ga0081540_10227132 329
209 3300006038 Ga0075365_10195658 Ga0075365_101956582 329
210 3300006048 Ga0075363_100085491 Ga0075363_1000854912 329
211 3300006051 Ga0075364_10005813 Ga0075364_100058136 329
212 3300006051 Ga0075364_10096044 Ga0075364_100960442 329
213 3300006051 Ga0075364_10098650 Ga0075364_100986502 329
214 3300006175 Ga0070712_100014886 Ga0070712_1000148862 329
215 3300006178 Ga0075367_10092277 Ga0075367_100922772 329
216 3300006195 Ga0075366_10015875 Ga0075366_100158752 329
217 3300006353 Ga0075370_10005200 Ga0075370_100052002 329
218 3300006358 Ga0068871_100128779 Ga0068871_1001287792 329
219 3300006844 Ga0075428_100041074 Ga0075428_1000410744 329
220 3300007788 Ga0099795_10003131 Ga0099795_100031312 329
221 3300009093 Ga0105240_10076252 Ga0105240_100762523 329
222 3300009147 Ga0114129_10028277 Ga0114129_100282772 329
223 3300009147 Ga0114129_10262210 Ga0114129_102622102 329
224 3300009148 Ga0105243_10101259 Ga0105243_101012592 329
225 3300009174 Ga0105241_10169272 Ga0105241_101692722 329
226 3300009177 Ga0105248_10017437 Ga0105248_100174374 329
227 3300009545 Ga0105237_10022058 Ga0105237_100220583 329
228 3300009545 Ga0105237_10196225 Ga0105237_101962252 329
229 3300009551 Ga0105238_10033083 Ga0105238_100330832 329
230 3300009553 Ga0105249_10154760 Ga0105249_101547601 329
231 3300010159 Ga0099796_10005011 Ga0099796_100050114 329
232 3300010375 Ga0105239_10148647 Ga0105239_101486472 329
233 3300011119 Ga0105246_10237865 Ga0105246_102378652 329
234 3300013102 Ga0157371_10040186 Ga0157371_100401862 329
235 3300013104 Ga0157370_10146480 Ga0157370_101464801 329
236 3300013105 Ga0157369_10044262 Ga0157369_100442624 329
237 3300013105 Ga0157369_10059929 Ga0157369_100599292 329
238 3300013105 Ga0157369_10337134 Ga0157369_103371341 329
239 3300013296 Ga0157374_10085287 Ga0157374_100852872 329
240 3300013306 Ga0163162_10050689 Ga0163162_100506892 329
241 3300014325 Ga0163163_10073912 Ga0163163_100739123 329
242 3300014325 Ga0163163_10084396 Ga0163163_100843962 329
243 3300014969 Ga0157376_10046105 Ga0157376_100461051 329
244 3300014969 Ga0157376_10117973 Ga0157376_101179732 329
245 3300015265 Ga0182005_1028056 Ga0182005_10280561 329
246 3300025261 Ga0209233_1000028 Ga0209233_1000028552 329
247 3300025284 Ga0209130_1000090 Ga0209130_1000090107 329
248 3300025284 Ga0209130_1000609 Ga0209130_100060912 329
249 3300025291 Ga0209675_1001075 Ga0209675_100107514 329
250 3300025294 Ga0209025_1000084 Ga0209025_1000084250 329
251 3300025295 Ga0209564_1000059 Ga0209564_1000059216 329
252 3300025295 Ga0209564_1000971 Ga0209564_100097115 329
253 3300025297 Ga0209758_1001444 Ga0209758_10014445 329
254 3300025297 Ga0209758_1003954 Ga0209758_10039547 329
255 3300025299 Ga0209256_1000033 Ga0209256_100003330 329
256 3300025302 Ga0207426_1000113 Ga0207426_1000113107 329
257 3300025898 Ga0207692_10022820 Ga0207692_100228204 329
258 3300025904 Ga0207647_10000520 Ga0207647_1000052010 329
259 3300025904 Ga0207647_10013527 Ga0207647_100135272 329
260 3300025904 Ga0207647_10018948 Ga0207647_100189485 329
261 3300025904 Ga0207647_10080587 Ga0207647_100805872 329
262 3300025906 Ga0207699_10016578 Ga0207699_100165784 329
263 3300025909 Ga0207705_10000703 Ga0207705_100007037 329
264 3300025913 Ga0207695_10072417 Ga0207695_100724172 329
265 3300025914 Ga0207671_10073260 Ga0207671_100732602 329
266 3300025914 Ga0207671_10137920 Ga0207671_101379202 329
267 3300025915 Ga0207693_10011976 Ga0207693_100119763 329
268 3300025916 Ga0207663_10025887 Ga0207663_100258872 329
269 3300025919 Ga0207657_10045293 Ga0207657_100452934 329
270 3300025921 Ga0207652_10108381 Ga0207652_101083811 329
271 3300025923 Ga0207681_10111220 Ga0207681_101112202 329
272 3300025924 Ga0207694_10181841 Ga0207694_101818412 329
273 3300025928 Ga0207700_10213245 Ga0207700_102132452 329
274 3300025929 Ga0207664_10068142 Ga0207664_100681422 329
275 3300025932 Ga0207690_10039354 Ga0207690_100393543 329
276 3300025933 Ga0207706_10022060 Ga0207706_100220602 329
277 3300025939 Ga0207665_10015899 Ga0207665_100158995 329
278 3300025940 Ga0207691_10092757 Ga0207691_100927572 329
279 3300025941 Ga0207711_10051028 Ga0207711_100510283 329
280 3300025944 Ga0207661_10043270 Ga0207661_100432703 329
281 3300025944 Ga0207661_10063302 Ga0207661_100633022 329
282 3300025949 Ga0207667_10031905 Ga0207667_100319052 329
283 3300025972 Ga0207668_10009915 Ga0207668_100099152 329
284 3300025972 Ga0207668_10104521 Ga0207668_101045212 329
285 3300026041 Ga0207639_10206845 Ga0207639_102068452 329
286 3300026067 Ga0207678_10000350 Ga0207678_1000035028 329
287 3300026067 Ga0207678_10026232 Ga0207678_100262324 329
288 3300026067 Ga0207678_10047116 Ga0207678_100471163 329
289 3300026067 Ga0207678_10047386 Ga0207678_100473862 329
290 3300026067 Ga0207678_10050769 Ga0207678_100507693 329
291 3300026118 Ga0207675_100143059 Ga0207675_1001430592 329
292 3300026118 Ga0207675_100278048 Ga0207675_1002780482 329
293 3300026121 Ga0207683_10003385 Ga0207683_1000338510 329
294 3300026121 Ga0207683_10114405 Ga0207683_101144052 329
295 3300026142 Ga0207698_10028481 Ga0207698_100284812 329
296 3300027512 Ga0209179_1000277 Ga0209179_10002775 329
297 3300027671 Ga0209588_1008878 Ga0209588_10088784 329
298 3300027866 Ga0209813_10017050 Ga0209813_100170502 329
299 3300028379 Ga0268266_10001439 Ga0268266_100014396 329
300 3300028379 Ga0268266_10008469 Ga0268266_100084693 329
301 3300028379 Ga0268266_10010578 Ga0268266_100105782 329
302 3300028380 Ga0268265_10106089 Ga0268265_101060892 329
303 3300028786 Ga0307517_10000098 Ga0307517_1000009887 329
304 3300028794 Ga0307515_10052231 Ga0307515_100522313 329
305 3300031250 Ga0265331_10028985 Ga0265331_100289851 329
306 3300031456 Ga0307513_10061771 Ga0307513_100617713 329
307 3300031456 Ga0307513_10085474 Ga0307513_100854742 329
308 3300031507 Ga0307509_10064501 Ga0307509_100645012 329
309 3300031507 Ga0307509_10299862 Ga0307509_102998622 329
310 3300031711 Ga0265314_10032920 Ga0265314_100329204 329
311 3300031911 Ga0307412_10013585 Ga0307412_100135852 329
312 3300033179 Ga0307507_10008496 Ga0307507_100084961 329
313 3300034957 Ga0373938_0024743 Ga0373938_0024743_21_1151 329
314 3300035170 Ga0373943_0090859 Ga0373943_0090859_130_1260 329
315 3300035691 Ga0373931_0001367 Ga0373931_0001367_1038_2213 329
316 3300037312 Ga0395899_0000030 Ga0395899_0000030_84559_85680 329
317 3300037418 Ga0395900_0000023 Ga0395900_0000023_90965_92086 329
318 3300037418 Ga0395900_0214183 Ga0395900_0214183_599_1723 329
319 3300037466 Ga0395898_0000038 Ga0395898_0000038_84559_85680 329
320 3300037466 Ga0395898_0231982 Ga0395898_0231982_620_1744 329
321 3300037471 Ga0395905_0000021 Ga0395905_0000021_84559_85680 329
322 3300038443 Ga0395901_0000018 Ga0395901_0000018_90965_92086 329
323 3300038443 Ga0395901_0020495 Ga0395901_0020495_2271_3395 329
324 3300038705 Ga0237819_07090 Ga0237819_07090_502_1620 329
325 3300039437 Ga0436365_1623535 Ga0436365_1623535_1000_2178 329
326 3300041452 Ga0451793_0104272 Ga0451793_0104272_523_1764 329
327 3300041509 Ga0451843_1428360 Ga0451843_1428360_266_1507 329
328 3300042013 Ga0439456_000061 Ga0439456_000061_30737_31888 329
329 3300045976 Ga0466967_0013725 Ga0466967_0013725_3687_4751 329
330 3300046455 Ga0495603_0008610 Ga0495603_0008610_3460_4590 329
331 3300046459 Ga0495629_0033615 Ga0495629_0033615_2071_3243 329
332 3300046460 Ga0495638_0007762 Ga0495638_0007762_11_1135 329
333 3300046471 Ga0495650_0000009 Ga0495650_0000009_644774_645964 329
334 3300046471 Ga0495650_0003587 Ga0495650_0003587_6272_7414 329
335 3300046512 Ga0495610_0029570 Ga0495610_0029570_1371_2501 329
336 3300046518 Ga0495631_0076804 Ga0495631_0076804_14_1144 329
337 3300046519 Ga0495632_0032085 Ga0495632_0032085_41_1171 329
338 3300046557 Ga0495622_0070746 Ga0495622_0070746_80_1210 329
339 3300046660 Ga0495625_0001312 Ga0495625_0001312_21295_22440 329
340 3300046660 Ga0495625_0104136 Ga0495625_0104136_83_1213 329
341 3300046664 Ga0495659_0018054 Ga0495659_0018054_348_1478 329
342 3300047320 Ga0495672_0026387 Ga0495672_0026387_570_1688 329
343 3300047320 Ga0495672_0068685 Ga0495672_0068685_360_1496 329
344 3300047469 Ga0495673_0036699 Ga0495673_0036699_902_2035 329
345 3300047472 Ga0495686_0051322 Ga0495686_0051322_1316_2440 329
346 3300047472 Ga0495686_0055567 Ga0495686_0055567_104_1231 329
347 3300048903 Ga0496100_0042584 Ga0496100_0042584_523_1653 329
348 3300048904 Ga0496101_0093781 Ga0496101_0093781_863_1993 329
349 3300048904 Ga0496101_0104927 Ga0496101_0104927_277_1452 329
350 3300048905 Ga0496102_0112028 Ga0496102_0112028_414_1544 329
351 3300048905 Ga0496102_0291451 Ga0496102_0291451_326_1501 329
352 3300048905 Ga0496102_0494228 Ga0496102_0494228_69_1109 329
353 3300048907 Ga0496104_0008854 Ga0496104_0008854_3020_4150 329
354 3300048907 Ga0496104_0022051 Ga0496104_0022051_4108_5268 329
355 3300048907 Ga0496104_0027826 Ga0496104_0027826_3187_4362 329
356 3300048907 Ga0496104_0145144 Ga0496104_0145144_316_1449 329
357 3300048908 Ga0496105_0014982 Ga0496105_0014982_3531_4706 329
358 3300048908 Ga0496105_0029646 Ga0496105_0029646_3290_4420 329
359 3300048908 Ga0496105_0144040 Ga0496105_0144040_442_1575 329
360 3300048909 Ga0496106_0014503 Ga0496106_0014503_2544_3674 329
361 3300048910 Ga0496107_0005083 Ga0496107_0005083_7405_8535 329
362 3300048910 Ga0496107_0043881 Ga0496107_0043881_1719_2849 329
363 3300048911 Ga0496108_0012405 Ga0496108_0012405_4796_5926 329
364 3300048911 Ga0496108_0085153 Ga0496108_0085153_1279_2412 329
365 3300048911 Ga0496108_0195006 Ga0496108_0195006_258_1433 329
366 3300048911 Ga0496108_0211516 Ga0496108_0211516_504_1634 329
367 3300048913 Ga0496110_0006254 Ga0496110_0006254_2423_3553 329
368 3300048913 Ga0496110_0029624 Ga0496110_0029624_1535_2710 329
369 3300048913 Ga0496110_0169332 Ga0496110_0169332_817_1947 329
370 3300048913 Ga0496110_0405915 Ga0496110_0405915_190_1230 329
371 3300048914 Ga0496111_0021599 Ga0496111_0021599_2149_3279 329
372 3300048914 Ga0496111_0070617 Ga0496111_0070617_498_1673 329
373 3300048915 Ga0496112_0073963 Ga0496112_0073963_2107_3267 329
374 3300048915 Ga0496112_0100598 Ga0496112_0100598_1519_2649 329
375 3300048915 Ga0496112_0215931 Ga0496112_0215931_137_1270 329
376 3300048916 Ga0496113_0039249 Ga0496113_0039249_604_1779 329
377 3300048917 Ga0496114_0005433 Ga0496114_0005433_1742_2872 329
378 3300048917 Ga0496114_0072517 Ga0496114_0072517_471_1646 329
379 3300048917 Ga0496114_0137647 Ga0496114_0137647_639_1769 329
380 3300048918 Ga0496115_0000662 Ga0496115_0000662_6040_7170 329
381 3300048919 Ga0496116_0009986 Ga0496116_0009986_3676_4800 329
382 3300048919 Ga0496116_0049085 Ga0496116_0049085_212_1372 329
383 3300048920 Ga0496117_0043947 Ga0496117_0043947_1609_2733 329
384 3300048920 Ga0496117_0067982 Ga0496117_0067982_38_1168 329
385 3300048920 Ga0496117_0082914 Ga0496117_0082914_903_2027 329
386 3300048921 Ga0496118_0139097 Ga0496118_0139097_275_1429 329
387 3300048922 Ga0496119_0021633 Ga0496119_0021633_1516_2646 329
388 3300048923 Ga0496120_0087944 Ga0496120_0087944_80_1243 329
389 3300048924 Ga0496121_0000265 Ga0496121_0000265_83103_84230 329
390 3300048924 Ga0496121_0004306 Ga0496121_0004306_7953_9083 329
391 3300048924 Ga0496121_0007746 Ga0496121_0007746_11016_12143 329
392 3300048924 Ga0496121_0010192 Ga0496121_0010192_8638_9762 329
393 3300048925 Ga0496122_0003946 Ga0496122_0003946_7962_9113 329
394 3300048926 Ga0496123_0002697 Ga0496123_0002697_9150_10301 329
395 3300048926 Ga0496123_0063434 Ga0496123_0063434_1051_2175 329
396 3300048927 Ga0496124_0093856 Ga0496124_0093856_272_1435 329
397 3300048927 Ga0496124_0179137 Ga0496124_0179137_354_1478 329
398 3300048927 Ga0496124_0253182 Ga0496124_0253182_106_1281 329
399 3300048928 Ga0496125_0002054 Ga0496125_0002054_6868_8031 329
400 3300048929 Ga0496126_0009405 Ga0496126_0009405_3858_4988 329
401 3300048929 Ga0496126_0040565 Ga0496126_0040565_263_1405 329
402 3300048929 Ga0496126_0090963 Ga0496126_0090963_462_1589 329
403 3300048929 Ga0496126_0197635 Ga0496126_0197635_284_1414 329
404 3300048929 Ga0496126_0261445 Ga0496126_0261445_14_1063 329
405 3300049568 Ga0501031_0001626 Ga0501031_0001626_983_2158 329
406 3300049568 Ga0501031_0003394 Ga0501031_0003394_6175_7257 329
407 3300049568 Ga0501031_0033746 Ga0501031_0033746_395_1531 329
408 3300049568 Ga0501031_0078537 Ga0501031_0078537_75_1244 329
409 3300049568 Ga0501031_0158696 Ga0501031_0158696_128_1303 329
410 3300049569 Ga0501032_0000005 Ga0501032_0000005_149807_150955 329
411 3300049569 Ga0501032_0004418 Ga0501032_0004418_2002_3084 329
412 3300049569 Ga0501032_0009241 Ga0501032_0009241_4483_5652 329
413 3300049569 Ga0501032_0025530 Ga0501032_0025530_639_1814 329
414 3300049570 Ga0501033_0001174 Ga0501033_0001174_11403_12578 329
415 3300049570 Ga0501033_0001918 Ga0501033_0001918_7777_8898 329
416 3300049570 Ga0501033_0006909 Ga0501033_0006909_704_1786 329
417 3300049570 Ga0501033_0007700 Ga0501033_0007700_5336_6412 329
418 3300049570 Ga0501033_0011510 Ga0501033_0011510_3569_4702 329
419 3300049570 Ga0501033_0014091 Ga0501033_0014091_4004_5173 329
420 3300049570 Ga0501033_0103944 Ga0501033_0103944_205_1275 329
421 3300049570 Ga0501033_0159196 Ga0501033_0159196_186_1361 329
422 3300049571 Ga0501034_0000027 Ga0501034_0000027_111971_113119 329
423 3300049571 Ga0501034_0043172 Ga0501034_0043172_2801_3871 329
424 3300049571 Ga0501034_0048394 Ga0501034_0048394_310_1458 329
425 3300049571 Ga0501034_0069581 Ga0501034_0069581_1530_2666 329
426 3300049571 Ga0501034_0069856 Ga0501034_0069856_2302_3477 329
427 3300049571 Ga0501034_0094596 Ga0501034_0094596_29_1018 329
428 3300049571 Ga0501034_0178099 Ga0501034_0178099_580_1662 329
429 3300049571 Ga0501034_0218387 Ga0501034_0218387_190_1275 329
430 3300049571 Ga0501034_0317015 Ga0501034_0317015_346_1422 329
431 3300049572 Ga0501036_0003212 Ga0501036_0003212_8086_9168 329
432 3300049572 Ga0501036_0003777 Ga0501036_0003777_6483_7568 329
433 3300049572 Ga0501036_0014934 Ga0501036_0014934_493_1620 329
434 3300049572 Ga0501036_0038227 Ga0501036_0038227_2486_3655 329
435 3300049572 Ga0501036_0111337 Ga0501036_0111337_314_1450 329
436 3300049573 Ga0501037_0000125 Ga0501037_0000125_19060_20208 329
437 3300049573 Ga0501037_0001255 Ga0501037_0001255_16187_17362 329
438 3300049573 Ga0501037_0003998 Ga0501037_0003998_1062_2144 329
439 3300049573 Ga0501037_0024632 Ga0501037_0024632_808_1983 329
440 3300049573 Ga0501037_0027629 Ga0501037_0027629_2265_3401 329
441 3300049573 Ga0501037_0031308 Ga0501037_0031308_538_1707 329
442 3300049574 Ga0501038_0000053 Ga0501038_0000053_52142_53290 329
443 3300049574 Ga0501038_0001348 Ga0501038_0001348_13458_14579 329
444 3300049574 Ga0501038_0002739 Ga0501038_0002739_7814_8896 329
445 3300049574 Ga0501038_0009152 Ga0501038_0009152_2257_3489 329
446 3300049574 Ga0501038_0010268 Ga0501038_0010268_294_1469 329
447 3300049574 Ga0501038_0010552 Ga0501038_0010552_1260_2435 329
448 3300049574 Ga0501038_0021002 Ga0501038_0021002_4722_5807 329
449 3300049574 Ga0501038_0025672 Ga0501038_0025672_1266_2336 329
450 3300049574 Ga0501038_0034203 Ga0501038_0034203_222_1349 329
451 3300049574 Ga0501038_0037038 Ga0501038_0037038_900_2069 329
452 3300049574 Ga0501038_0084110 Ga0501038_0084110_668_1804 329
453 3300049574 Ga0501038_0275214 Ga0501038_0275214_52_1185 329
454 3300049575 Ga0501039_0001416 Ga0501039_0001416_6962_8083 329
455 3300049575 Ga0501039_0001417 Ga0501039_0001417_9576_10751 329
456 3300049575 Ga0501039_0070553 Ga0501039_0070553_277_1452 329
457 3300049575 Ga0501039_0082655 Ga0501039_0082655_978_2210 329
458 3300049575 Ga0501039_0105324 Ga0501039_0105324_361_1497 329
459 3300049575 Ga0501039_0174663 Ga0501039_0174663_250_1425 329
460 3300049575 Ga0501039_0194065 Ga0501039_0194065_407_1576 329
461 3300049578 Ga0501042_0006938 Ga0501042_0006938_4991_6160 329
462 3300049578 Ga0501042_0015677 Ga0501042_0015677_1324_2445 329
463 3300049578 Ga0501042_0021926 Ga0501042_0021926_2134_3216 329
464 3300049578 Ga0501042_0091435 Ga0501042_0091435_79_1164 329
465 3300049579 Ga0501043_0000011 Ga0501043_0000011_147464_148612 329
466 3300049579 Ga0501043_0003502 Ga0501043_0003502_10659_11834 329
467 3300049579 Ga0501043_0003989 Ga0501043_0003989_4864_5985 329
468 3300049579 Ga0501043_0007977 Ga0501043_0007977_2936_4168 329
469 3300049579 Ga0501043_0010777 Ga0501043_0010777_966_2048 329
470 3300049579 Ga0501043_0023994 Ga0501043_0023994_942_2027 329
471 3300049579 Ga0501043_0041137 Ga0501043_0041137_1403_2539 329
472 3300049579 Ga0501043_0044293 Ga0501043_0044293_57_1226 329
473 3300049579 Ga0501043_0052745 Ga0501043_0052745_618_1745 329
474 3300049580 Ga0501046_0004167 Ga0501046_0004167_4297_5418 329
475 3300049580 Ga0501046_0010460 Ga0501046_0010460_1531_2667 329
476 3300049580 Ga0501046_0021539 Ga0501046_0021539_995_2170 329
477 3300049580 Ga0501046_0024230 Ga0501046_0024230_2821_3903 329
478 3300049580 Ga0501046_0038705 Ga0501046_0038705_1144_2220 329
479 3300049580 Ga0501046_0042039 Ga0501046_0042039_2271_3392 329
480 3300049580 Ga0501046_0132664 Ga0501046_0132664_185_1354 329
481 3300049580 Ga0501046_0221858 Ga0501046_0221858_162_1232 329
482 3300049581 Ga0501047_0004223 Ga0501047_0004223_9759_10829 329
483 3300049581 Ga0501047_0009350 Ga0501047_0009350_203_1285 329
484 3300049581 Ga0501047_0026424 Ga0501047_0026424_3509_4678 329
485 3300049581 Ga0501047_0036757 Ga0501047_0036757_194_1321 329
486 3300049581 Ga0501047_0084287 Ga0501047_0084287_1658_2794 329
487 3300049581 Ga0501047_0301651 Ga0501047_0301651_194_1318 329
488 3300049582 Ga0501048_0002011 Ga0501048_0002011_4218_5354 329
489 3300049582 Ga0501048_0005098 Ga0501048_0005098_594_1715 329
490 3300049582 Ga0501048_0010180 Ga0501048_0010180_3443_4612 329
491 3300049582 Ga0501048_0011775 Ga0501048_0011775_3751_4833 329
492 3300049582 Ga0501048_0029682 Ga0501048_0029682_999_2084 329
493 3300049582 Ga0501048_0031071 Ga0501048_0031071_2169_3239 329
494 3300049583 Ga0501067_0004621 Ga0501067_0004621_1069_2238 329
495 3300049583 Ga0501067_0008285 Ga0501067_0008285_3940_5022 329
496 3300049583 Ga0501067_0025467 Ga0501067_0025467_549_1634 329
497 3300049583 Ga0501067_0062471 Ga0501067_0062471_666_1802 329
498 3300049584 Ga0501068_0002752 Ga0501068_0002752_7815_8936 329
499 3300049584 Ga0501068_0016002 Ga0501068_0016002_1367_2452 329
500 3300049584 Ga0501068_0016689 Ga0501068_0016689_1849_2931 329
501 3300049584 Ga0501068_0020455 Ga0501068_0020455_2590_3759 329
502 3300049585 Ga0501069_0001078 Ga0501069_0001078_1704_2840 329
503 3300049585 Ga0501069_0002656 Ga0501069_0002656_6013_7095 329
504 3300049585 Ga0501069_0006483 Ga0501069_0006483_2662_3831 329
505 3300049586 Ga0501070_0008169 Ga0501070_0008169_63_1121 329
506 3300049586 Ga0501070_0015441 Ga0501070_0015441_2887_3972 329
507 3300049586 Ga0501070_0074318 Ga0501070_0074318_527_1696 329
508 3300049586 Ga0501070_0227273 Ga0501070_0227273_137_1273 329
509 3300049587 Ga0501071_0014348 Ga0501071_0014348_1202_2287 329
510 3300049587 Ga0501071_0086994 Ga0501071_0086994_126_1262 329
511 3300049589 Ga0501073_0003878 Ga0501073_0003878_8106_9188 329
512 3300049589 Ga0501073_0019733 Ga0501073_0019733_407_1576 329
513 3300049589 Ga0501073_0019784 Ga0501073_0019784_2747_3832 329
514 3300049589 Ga0501073_0048125 Ga0501073_0048125_346_1467 329
515 3300049589 Ga0501073_0109947 Ga0501073_0109947_640_1764 329
516 3300049590 Ga0501074_0004446 Ga0501074_0004446_8606_9724 329
517 3300049590 Ga0501074_0005779 Ga0501074_0005779_1911_3080 329
518 3300049590 Ga0501074_0008800 Ga0501074_0008800_865_2001 329
519 3300049590 Ga0501074_0028821 Ga0501074_0028821_705_1826 329
520 3300049592 Ga0501076_0042168 Ga0501076_0042168_1585_2754 329
521 3300049741 Ga0501079_0089088 Ga0501079_0089088_1096_2178 329
522 3300049741 Ga0501079_0199788 Ga0501079_0199788_280_1416 329
523 3300049742 Ga0501080_0001694 Ga0501080_0001694_7810_8928 329
524 3300049742 Ga0501080_0005649 Ga0501080_0005649_4190_5317 329
525 3300049742 Ga0501080_0008204 Ga0501080_0008204_6729_7850 329
526 3300049742 Ga0501080_0015542 Ga0501080_0015542_5038_6174 329
527 3300049742 Ga0501080_0020346 Ga0501080_0020346_1491_2576 329
528 3300049742 Ga0501080_0030751 Ga0501080_0030751_3183_4265 329
529 3300049742 Ga0501080_0048187 Ga0501080_0048187_535_1704 329
530 3300049742 Ga0501080_0090332 Ga0501080_0090332_416_1492 329
531 3300049742 Ga0501080_0213891 Ga0501080_0213891_342_1481 329
532 3300049744 Ga0501083_0057951 Ga0501083_0057951_257_1426 329
533 3300049744 Ga0501083_0108254 Ga0501083_0108254_404_1489 329
534 3300049822 Ga0501035_0000589 Ga0501035_0000589_33805_34923 329
535 3300049822 Ga0501035_0000755 Ga0501035_0000755_7559_8644 329
536 3300049822 Ga0501035_0001704 Ga0501035_0001704_14473_15648 329
537 3300049822 Ga0501035_0004158 Ga0501035_0004158_8180_9262 329
538 3300049822 Ga0501035_0022979 Ga0501035_0022979_3907_5028 329
539 3300049822 Ga0501035_0039124 Ga0501035_0039124_1319_2488 329
540 3300049822 Ga0501035_0045961 Ga0501035_0045961_446_1516 329
541 3300049822 Ga0501035_0046601 Ga0501035_0046601_1332_2453 329
542 3300049822 Ga0501035_0071855 Ga0501035_0071855_1565_2740 329
543 3300049822 Ga0501035_0099665 Ga0501035_0099665_28_1017 329
544 3300049822 Ga0501035_0105297 Ga0501035_0105297_136_1311 329
545 3300049822 Ga0501035_0159802 Ga0501035_0159802_234_1355 329
546 3300049822 Ga0501035_0217812 Ga0501035_0217812_487_1614 329
547 3300049823 Ga0501044_0013659 Ga0501044_0013659_545_1681 329
548 3300049823 Ga0501044_0026369 Ga0501044_0026369_557_1627 329
549 3300049823 Ga0501044_0056105 Ga0501044_0056105_1761_2993 329
550 3300049823 Ga0501044_0060429 Ga0501044_0060429_907_2076 329
551 3300049823 Ga0501044_0081195 Ga0501044_0081195_1479_2615 329
552 3300049823 Ga0501044_0161190 Ga0501044_0161190_708_1790 329
553 3300049823 Ga0501044_0176342 Ga0501044_0176342_113_1246 329
554 3300049823 Ga0501044_0211891 Ga0501044_0211891_649_1770 329
555 3300049823 Ga0501044_0237105 Ga0501044_0237105_71_1156 329
556 3300049823 Ga0501044_0365042 Ga0501044_0365042_103_1221 329
557 3300049824 Ga0501045_0005507 Ga0501045_0005507_5221_6342 329
558 3300049824 Ga0501045_0014258 Ga0501045_0014258_2597_3766 329
559 3300049824 Ga0501045_0085901 Ga0501045_0085901_272_1354 329
560 3300050490 nmdc:mga03n38_59697_c1 nmdc:mga03n38_59697_c1_194_1366 329
561 3300050491 nmdc:mga00v17_78829_c1 nmdc:mga00v17_78829_c1_482_1654 329
562 3300050492 nmdc:mga0yw44_72617_c1 nmdc:mga0yw44_72617_c1_819_1943 329
563 3300050495 nmdc:mga04h51_5197_c1 nmdc:mga04h51_5197_c1_515_1687 329
564 3300050496 nmdc:mga07m45_7313_c1 nmdc:mga07m45_7313_c1_1896_3068 329
565 3300050507 nmdc:mga05p37_395962_c1 nmdc:mga05p37_395962_c1_101_1231 329
566 3300050510 nmdc:mga06r32_188771_c1 nmdc:mga06r32_188771_c1_46_1182 329
567 3300053088 Ga0500644_0000325 Ga0500644_0000325_1678_2802 329
568 3300053088 Ga0500644_0023547 Ga0500644_0023547_490_1647 329
569 3300053093 Ga0500651_0001377 Ga0500651_0001377_9897_11027 329
570 3300053093 Ga0500651_0003048 Ga0500651_0003048_687_1811 329
571 3300053094 Ga0500566_0003537 Ga0500566_0003537_1314_2501 329
572 3300053096 Ga0500641_0005170 Ga0500641_0005170_615_1778 329
573 3300053096 Ga0500641_0022724 Ga0500641_0022724_649_1779 329
574 3300053098 Ga0500650_0011126 Ga0500650_0011126_457_1620 329
575 3300053104 Ga0500556_0000017 Ga0500556_0000017_95182_96342 329
576 3300053104 Ga0500556_0000195 Ga0500556_0000195_34584_35741 329
577 3300053116 Ga0500592_000349 Ga0500592_000349_5475_6632 329
578 3300053117 Ga0500593_000006 Ga0500593_000006_73939_75078 329
579 3300053119 Ga0500595_000001 Ga0500595_000001_241403_242533 329
580 3300053119 Ga0500595_002917 Ga0500595_002917_908_2035 329
581 3300053119 Ga0500595_002948 Ga0500595_002948_3525_4655 329
582 3300053119 Ga0500595_006998 Ga0500595_006998_1291_2421 329
583 3300053121 Ga0500607_088437 Ga0500607_088437_139_1263 329
584 3300053122 Ga0500608_012354 Ga0500608_012354_2558_3682 329
585 3300053130 Ga0500642_0000012 Ga0500642_0000012_34590_35714 329
586 3300053131 Ga0500652_000146 Ga0500652_000146_10737_11894 329
587 3300053131 Ga0500652_012191 Ga0500652_012191_381_1511 329
588 3300053134 Ga0500658_0006611 Ga0500658_0006611_1056_2180 329
589 3300053134 Ga0500658_0015652 Ga0500658_0015652_1156_2286 329
590 3300053136 Ga0500559_0000848 Ga0500559_0000848_6056_7243 329
591 3300053139 Ga0500568_0000005 Ga0500568_0000005_385962_387101 329
592 3300053139 Ga0500568_0010600 Ga0500568_0010600_570_1697 329
593 3300053139 Ga0500568_0011318 Ga0500568_0011318_814_1938 329
594 3300053142 Ga0500577_0006426 Ga0500577_0006426_480_1607 329
595 3300053145 Ga0500586_002295 Ga0500586_002295_1698_2822 329
596 3300053151 Ga0500604_0023785 Ga0500604_0023785_92_1216 329
597 3300053153 Ga0500616_0000001 Ga0500616_0000001_1736140_1737270 329
598 3300053153 Ga0500616_0001093 Ga0500616_0001093_22764_23888 329
599 3300053153 Ga0500616_0023146 Ga0500616_0023146_366_1535 329
600 3300053156 Ga0500622_0001963 Ga0500622_0001963_10475_11599 329
601 3300053156 Ga0500622_0031719 Ga0500622_0031719_494_1624 329
602 3300053158 Ga0500627_0038807 Ga0500627_0038807_275_1432 329
603 3300053161 Ga0500634_0000014 Ga0500634_0000014_56668_57759 329
604 3300053177 Ga0500636_0000495 Ga0500636_0000495_5861_6985 329
605 3300053730 Ga0500645_000629 Ga0500645_000629_18323_19453 329
606 3300053730 Ga0500645_024648 Ga0500645_024648_544_1719 329
607 3300054114 Ga0501084_0009969 Ga0501084_0009969_4777_5946 329
608 3300054114 Ga0501084_0024592 Ga0501084_0024592_1861_2943 329
609 3300060353 Ga0501082_0013202 Ga0501082_0013202_47_1129 329
610 iso_pu_bacteria 2513237094 2513644736 329
611 iso_pu_bacteria 2513237098 2513673275 329
612 iso_pu_bacteria 2513237141 2513894800 329
613 iso_pu_bacteria 2515154155 2515851185 329
614 iso_pu_bacteria 2524023205 2524442354 329
615 iso_pu_bacteria 2582580736 2583150517 329
616 iso_pu_bacteria 2585427649 2586062218 329
617 iso_pu_bacteria 2602042107 2603857449 329
618 iso_pu_bacteria 2643221629 2644168401 329
619 iso_pu_bacteria 2643221651 2644291216 329
620 iso_pu_bacteria 2643221662 2644349935 329
621 iso_pu_bacteria 2643221733 2644732373 329
622 iso_pu_bacteria 2643221736 2644743164 329
623 iso_pu_bacteria 2675903058 2676478951 329
624 iso_pu_bacteria 2721755755 2723848813 329
625 iso_pu_bacteria 2728368998 2728749778 329
626 iso_pu_bacteria 2744054633 2745075199 329
627 iso_pu_bacteria 2773857925 2774870097 329
628 iso_pu_bacteria 2775506902 2776273016 329
629 iso_pu_bacteria 2775506904 2776282141 329
630 iso_pu_bacteria 2775506925 2776373507 329
631 iso_pu_bacteria 2808606522 2809588609 329
632 iso_pu_bacteria 2816332119 2816427435 329
633 iso_pu_bacteria 2816332139 2816509740 329
634 iso_pu_bacteria 2818991467 2819717505 329
635 iso_pu_bacteria 2821443989 2821446770 329
636 iso_pu_bacteria 2827628540 2827630266 329
637 iso_pu_bacteria 2841760612 2841762969 329
638 iso_pu_bacteria 2842775625 2842775717 329
639 iso_pu_bacteria 2844104063 2844109161 329
640 iso_pu_bacteria 2844533157 2844536162 329
641 iso_pu_bacteria 2851246043 2851251268 329
642 iso_pu_bacteria 2857524615 2857526829 329
643 iso_pu_bacteria 2863067949 2863068689 329
644 iso_pu_bacteria 2866552031 2866554601 329
645 iso_pu_bacteria 2866612099 2866614607 329
646 iso_pu_bacteria 2874604998 2874606064 329
647 iso_pu_bacteria 2876761206 2876768065 329
648 iso_pu_bacteria 2876808645 2876809134 329
649 iso_pu_bacteria 2879083081 2879090442 329
650 iso_pu_bacteria 2879099564 2879108117 329
651 iso_pu_bacteria 2879110137 2879116773 329
652 iso_pu_bacteria 2882456835 2882461683 329
653 iso_pu_bacteria 2885374607 2885374636 329
654 iso_pu_bacteria 2885383462 2885386759 329
655 iso_pu_bacteria 2891326441 2891329038 329
656 iso_pu_bacteria 2893066018 2893069992 329
657 iso_pu_bacteria 2899359706 2899368211 329
658 iso_pu_bacteria 2903768456 2903775843 329
659 iso_pu_bacteria 2906610324 2906612496 329
660 iso_pu_bacteria 2915768154 2915775314 329
661 iso_pu_bacteria 2917736166 2917739425 329
662 iso_pu_bacteria 2919073203 2919077954 329
663 iso_pu_bacteria 2922361189 2922363447 329
664 iso_pu_bacteria 2922368715 2922375084 329
665 iso_pu_bacteria 2922386360 2922389563 329
666 iso_pu_bacteria 2932401849 2932404374 329
667 iso_pu_bacteria 2932784394 2932787558 329
668 iso_pu_bacteria 2932809354 2932813261 329
669 iso_pu_bacteria 2932818245 2932820819 329
670 iso_pu_bacteria 2932828146 2932834809 329
671 iso_pu_bacteria 2935616580 2935621774 329
672 iso_pu_bacteria 2935638405 2935642718 329
673 iso_pu_bacteria 2935665750 2935667820 329
674 iso_pu_bacteria 2935675223 2935682311 329
675 iso_pu_bacteria 2935694250 2935695922 329
676 iso_pu_bacteria 2935703347 2935706660 329
677 iso_pu_bacteria 2935760218 2935763215 329
678 iso_pu_bacteria 2935801545 2935806364 329
679 iso_pu_bacteria 2935810662 2935812965 329
680 iso_pu_bacteria 2935827899 2935830617 329
681 iso_pu_bacteria 2935837841 2935840646 329
682 iso_pu_bacteria 2935855204 2935860021 329
683 iso_pu_bacteria 2935864058 2935869344 329
684 iso_pu_bacteria 2935873716 2935880495 329
685 iso_pu_bacteria 2935992306 2935999543 329
686 iso_pu_bacteria 2936002035 2936006473 329
687 iso_pu_bacteria 2936037263 2936041553 329
688 iso_pu_bacteria 2939669807 2939674096 329
689 iso_pu_bacteria 2941538514 2941541224 329
690 iso_pu_bacteria 3002141150 3002145399 329
691 iso_pu_bacteria 8001845381 8001848370 329
692 iso_pu_bacteria 8002285264 8002291026 329
693 iso_pu_bacteria 8003314358 8003323805 329
694 iso_pu_bacteria 8006933436 8006941067 329
695 iso_pu_bacteria 8006964411 8006970048 329
696 iso_pu_bacteria 8006973647 8006980719 329
697 iso_pu_bacteria 8006984368 8006986261 329
698 iso_pu_bacteria 8006994254 8006998937 329
699 iso_pu_bacteria 8016511872 8016514006 329
700 iso_pu_bacteria 8017057580 8017062402 329
701 iso_pu_bacteria 8019576017 8019581863 329
702 iso_pu_bacteria 8019586578 8019589540 329
703 iso_pu_bacteria 8019597564 8019601726 329
704 iso_pu_bacteria 8019608314 8019616825 329
705 iso_pu_bacteria 8054563764 8054564015 329
706 iso_pu_bacteria 8056060235 8056064722 329
707 iso_pu_bacteria 8056207758 8056213631 329
708 iso_pu_bacteria 8056673599 8056675398 329
709 iso_pu_bacteria 8056681323 8056681756 329
710 iso_pu_bacteria 8057160832 8057162792 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00268

Ribonuc_red_sm

Ribonucleotide reductase, small chain

73

361

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ani-assembly1.cif.gz_A-2 crystal structure of the f127y mutant of ribonucleotide reductase r2 from chlamydia trachomatis 0.8771 3 299
8dq4-assembly1.cif.gz_B x-ray crystal structure of flavobacterium johnsoniae dimanganese(ii) class id ribonucleotide reductase beta subunit k71r variant 0.8726 22 283
4d8g-assembly2.cif.gz_D chlamydia trachomatis nrdb with a mn/fe cofactor (procedure 2 - low mn) 0.8712 3 307
2rcc-assembly1.cif.gz_B crystal structure of putative class i ribonucleotide reductase (np_241368.1) from bacillus halodurans at 1.90 a resolution 0.8677 17 298
7aik-assembly1.cif.gz_A ribonucleotide reductase r2 protein from aquifex aeolicus 0.8666 15 298
ID Description Score Start End Superfamily
4d8gD00 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.8712 3 307 1.10.620.20
2rccC01 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.8607 18 284 1.10.620.20
2rccC01 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.8542 18 284 1.10.620.20
3hf1A00 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.8376 20 296 1.10.620.20
2vuxB00 Mainly Alpha;Orthogonal Bundle;Ribonucleotide Reductase, subunit A;Ribonucleotide Reductase, subunit A 0.8233 11 299 1.10.620.20
ID Description Score Start End GO Terms
AF-A0A2B4ME11-F1-model_v4 deleted 0.9903 159 264
AF-A0A3M4FNA3-F1-model_v4 deleted 0.974 126 281
AF-A0A2B4ME11-F1-model_v4 deleted 0.9632 159 264
AF-F8XWD2-F1-model_v4 deleted 0.9622 36 307
AF-A0A3M4FNA3-F1-model_v4 deleted 0.956 126 281

Feature Viewer

pLDDT pTM Quality
83.47 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map