F476634

General Info

Members Datasets Scaffolds Average Seq Length
709 269 1224 164

Family's Representative Sequence

Representative Sequence 3300005276|Ga0065717_1005476|Ga0065717_10054762
Length 172
Sequence MPRRIFQIERGAMGRRIVPSVLAIGLVVGLMHFSPRSLAQTKSPGADKPASNLEIIHEKLKADKKLIVAKYMDLTESEAAKFWPVYEEYQKDLQGSNEKLRKLLESYAADYRNKSMTEWIVVEQEEGTRRSNFAPKVLRVLPPKKAARYLQIENEYRILLRYEIAAAVPLVE

Samples

Sample ID Description Type Environment
1 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
106 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
107 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
108 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
109 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
110 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
111 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
249 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 98.45
Stem 0
Stem Tuber 0
Unclassified 29.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065717_1005476 3300005276 Bacteria 883
2 2214936853 2209111006 Bacteria 1324
3 ARcpr5oldR_c027653 3300000041 Unclassified 526
4 ARcpr5yngRDRAFT_c006758 3300000043 Unclassified 1027
5 ARcpr5yngRDRAFT_c009863 3300000043 Bacteria 814
6 ARcpr5yngRDRAFT_c021497 3300000043 Unclassified 548
7 ARCol0yngRDRAFT_1001218 3300000652 Bacteria 2174
8 ARCol0yngRDRAFT_1014429 3300000652 Unclassified 592
9 JGI25407J50210_10034707 3300003373 Bacteria 1300
10 Ga0058863_11838810 3300004799 Bacteria 959
11 Ga0058861_11743320 3300004800 Unclassified 1720
12 Ga0058860_11677157 3300004801 Unclassified 1610
13 Ga0058862_12759890 3300004803 Bacteria 2416
14 Ga0065717_1003152 3300005276 Bacteria 1395
15 Ga0065704_10006252 3300005289 Unclassified 2608
16 Ga0065704_10521348 3300005289 Bacteria 653
17 Ga0065712_10001278 3300005290 Bacteria 12559
18 Ga0065712_10021947 3300005290 Unclassified 2795
19 Ga0065712_10126391 3300005290 Unclassified 1582
20 Ga0065715_10092281 3300005293 Bacteria 5211
21 Ga0065715_10127160 3300005293 Unclassified 2093
22 Ga0065715_10172630 3300005293 Bacteria 1535
23 Ga0065707_10003976 3300005295 Bacteria 4887
24 Ga0065707_10025257 3300005295 Unclassified 1462
25 Ga0065707_10036245 3300005295 Bacteria 1372
26 Ga0065707_10149364 3300005295 Bacteria 1676
27 Ga0065707_10159526 3300005295 Bacteria 1576
28 Ga0065707_10168429 3300005295 Unclassified 1503
29 Ga0070658_10069080 3300005327 Bacteria 2890
30 Ga0070658_10476250 3300005327 Bacteria 1077
31 Ga0070676_10046234 3300005328 Unclassified 2537
32 Ga0070670_100151420 3300005331 Unclassified 2007
33 Ga0070670_100244177 3300005331 Bacteria 1563
34 Ga0070670_100591676 3300005331 Bacteria 992
35 Ga0070677_10075566 3300005333 Bacteria 1428
36 Ga0070677_10133400 3300005333 Bacteria 1136
37 Ga0068869_100028989 3300005334 Unclassified 3873
38 Ga0070666_10044766 3300005335 Bacteria 2966
39 Ga0070666_10130292 3300005335 Bacteria 1747
40 Ga0070680_100086611 3300005336 Unclassified 2589
41 Ga0070680_100096610 3300005336 Bacteria 2450
42 Ga0070682_100089986 3300005337 Bacteria 2006
43 Ga0068868_100519735 3300005338 Bacteria 1045
44 Ga0070660_100027158 3300005339 Unclassified 4270
45 Ga0070691_10291843 3300005341 Bacteria 888
46 Ga0070691_10507898 3300005341 Bacteria 698
47 Ga0070687_100467337 3300005343 Unclassified 842
48 Ga0070687_100734150 3300005343 Bacteria 693
49 Ga0070661_100065469 3300005344 Bacteria 2671
50 Ga0070668_100067439 3300005347 Bacteria 2779
51 Ga0070669_100181577 3300005353 Bacteria 1646
52 Ga0070669_100289063 3300005353 Bacteria 1315
53 Ga0070669_100328563 3300005353 Bacteria 1236
54 Ga0070669_101196197 3300005353 Unclassified 656
55 Ga0070675_100024886 3300005354 Bacteria 4797
56 Ga0070671_100672143 3300005355 Bacteria 897
57 Ga0070674_100021702 3300005356 Bacteria 4129
58 Ga0070674_100714896 3300005356 Unclassified 858
59 Ga0070673_100167688 3300005364 Unclassified 1872
60 Ga0070673_100410447 3300005364 Unclassified 1212
61 Ga0070688_100533167 3300005365 Bacteria 890
62 Ga0070659_100045747 3300005366 Bacteria 3429
63 Ga0070659_100128561 3300005366 Bacteria 2056
64 Ga0070659_101251246 3300005366 Unclassified 657
65 Ga0070667_100087283 3300005367 Bacteria 2677
66 Ga0070667_100130179 3300005367 Unclassified 2195
67 Ga0070711_100578898 3300005439 Bacteria 934
68 Ga0070711_101257956 3300005439 Unclassified 641
69 Ga0070705_100017419 3300005440 Unclassified 3751
70 Ga0070705_100069384 3300005440 Bacteria 2125
71 Ga0070694_101301751 3300005444 Unclassified 611
72 Ga0070708_100210023 3300005445 Unclassified 1824
73 Ga0070708_100261784 3300005445 Bacteria 1626
74 Ga0070708_100497037 3300005445 Unclassified 1151
75 Ga0070663_100015540 3300005455 Unclassified 4919
76 Ga0070678_100033054 3300005456 Unclassified 3587
77 Ga0070678_100267843 3300005456 Bacteria 1439
78 Ga0070662_100034336 3300005457 Bacteria 3576
79 Ga0070662_100104399 3300005457 Bacteria 2150
80 Ga0070662_100117799 3300005457 Unclassified 2032
81 Ga0070662_100259593 3300005457 Bacteria 1399
82 Ga0070681_10009609 3300005458 Bacteria 9509
83 Ga0070681_10264854 3300005458 Bacteria 1630
84 Ga0070681_10382838 3300005458 Bacteria 1317
85 Ga0070681_10681865 3300005458 Bacteria 943
86 Ga0068867_100222425 3300005459 Bacteria 1522
87 Ga0068867_100604901 3300005459 Bacteria 956
88 Ga0070706_100126676 3300005467 Bacteria 2381
89 Ga0070706_100267394 3300005467 Bacteria 1596
90 Ga0070706_100687315 3300005467 Bacteria 949
91 Ga0070707_100091804 3300005468 Bacteria 2939
92 Ga0070698_100144530 3300005471 Unclassified 2329
93 Ga0070698_100540698 3300005471 Bacteria 1104
94 Ga0070698_101915012 3300005471 Unclassified 546
95 Ga0074259_12114301 3300005507 Unclassified 717
96 Ga0070699_100102054 3300005518 Bacteria 2515
97 Ga0070679_100016880 3300005530 Bacteria 7057
98 Ga0070679_100029951 3300005530 Bacteria 5370
99 Ga0070679_100397180 3300005530 Bacteria 1325
100 Ga0070684_100772787 3300005535 Unclassified 897
101 Ga0070697_100033762 3300005536 Bacteria 4123
102 Ga0070697_100204483 3300005536 Bacteria 1679
103 Ga0070697_100425361 3300005536 Unclassified 1154
104 Ga0070697_100432558 3300005536 Unclassified 1145
105 Ga0070697_100465590 3300005536 Bacteria 1102
106 Ga0070697_100798317 3300005536 Bacteria 835
107 Ga0068853_100075688 3300005539 Unclassified 2938
108 Ga0070672_100075999 3300005543 Bacteria 2682
109 Ga0070686_100017505 3300005544 Bacteria 4189
110 Ga0070686_100112310 3300005544 Bacteria 1858
111 Ga0070695_100008813 3300005545 Bacteria 5995
112 Ga0070695_100025299 3300005545 Bacteria 3665
113 Ga0070695_100070804 3300005545 Bacteria 2282
114 Ga0070695_100345404 3300005545 Unclassified 1113
115 Ga0070696_100072491 3300005546 Bacteria 2426
116 Ga0070696_100129118 3300005546 Bacteria 1837
117 Ga0070696_100213292 3300005546 Bacteria 1446
118 Ga0070693_100155796 3300005547 Unclassified 1451
119 Ga0070693_100245133 3300005547 Unclassified 1185
120 Ga0070665_100291018 3300005548 Bacteria 1636
121 Ga0070665_100545429 3300005548 Bacteria 1172
122 Ga0070704_101349528 3300005549 Bacteria 653
123 Ga0068855_100046700 3300005563 Bacteria 5118
124 Ga0070664_100014510 3300005564 Bacteria 6426
125 Ga0070664_100026191 3300005564 Bacteria 4836
126 Ga0068857_100322306 3300005577 Unclassified 1427
127 Ga0068857_100322314 3300005577 Bacteria 1427
128 Ga0068854_100043605 3300005578 Bacteria 3180
129 Ga0068854_100081846 3300005578 Unclassified 2386
130 Ga0070702_100287190 3300005615 Bacteria 1132
131 Ga0068859_100255052 3300005617 Bacteria 1845
132 Ga0068859_101407166 3300005617 Bacteria 769
133 Ga0068864_100372207 3300005618 Bacteria 1352
134 Ga0068866_10015965 3300005718 Unclassified 3347
135 Ga0068866_10374400 3300005718 Unclassified 911
136 Ga0068861_100400937 3300005719 Bacteria 1217
137 Ga0068861_101059840 3300005719 Bacteria 777
138 Ga0068870_10131903 3300005840 Unclassified 1452
139 Ga0068863_100931625 3300005841 Bacteria 870
140 Ga0068863_101116362 3300005841 Unclassified 793
141 Ga0068863_101136125 3300005841 Bacteria 786
142 Ga0068860_100089581 3300005843 Bacteria 2929
143 Ga0068862_101178103 3300005844 Bacteria 764
144 Ga0081455_10035088 3300005937 Bacteria 4487
145 Ga0081455_10036160 3300005937 Bacteria 4401
146 Ga0081455_10047532 3300005937 Bacteria 3716
147 Ga0081538_10014384 3300005981 Bacteria 6199
148 Ga0081538_10053962 3300005981 Bacteria 2383
149 Ga0081538_10193402 3300005981 Bacteria 849
150 Ga0075432_10043440 3300006058 Bacteria 1575
151 Ga0075432_10201314 3300006058 Bacteria 788
152 Ga0070716_100699616 3300006173 Unclassified 774
153 Ga0070712_101123921 3300006175 Bacteria 682
154 Ga0097621_100075698 3300006237 Unclassified 2790
155 Ga0097621_100278524 3300006237 Bacteria 1472
156 Ga0097621_101665927 3300006237 Unclassified 607
157 Ga0075428_100035285 3300006844 Bacteria 5513
158 Ga0075428_100044050 3300006844 Bacteria 4905
159 Ga0075428_100060358 3300006844 Bacteria 4152
160 Ga0075428_100107808 3300006844 Bacteria 3035
161 Ga0075428_101496471 3300006844 Bacteria 707
162 Ga0075430_100021693 3300006846 Bacteria 5458
163 Ga0075430_100029362 3300006846 Unclassified 4666
164 Ga0075430_100049039 3300006846 Bacteria 3564
165 Ga0075430_100308836 3300006846 Bacteria 1308
166 Ga0075430_100437476 3300006846 Bacteria 1079
167 Ga0075430_100744461 3300006846 Unclassified 808
168 Ga0075431_100007887 3300006847 Bacteria 10608
169 Ga0075431_100066478 3300006847 Bacteria 3722
170 Ga0075431_100158966 3300006847 Bacteria 2324
171 Ga0075431_100262739 3300006847 Bacteria 1751
172 Ga0075433_10004757 3300006852 Bacteria 10593
173 Ga0075433_10027541 3300006852 Unclassified 4822
174 Ga0075433_10043020 3300006852 Bacteria 3920
175 Ga0075433_10062917 3300006852 Bacteria 3250
176 Ga0075433_10070763 3300006852 Bacteria 3066
177 Ga0075433_10077258 3300006852 Bacteria 2933
178 Ga0075433_10090086 3300006852 Unclassified 2711
179 Ga0075433_10160078 3300006852 Bacteria 2003
180 Ga0075433_10168879 3300006852 Bacteria 1947
181 Ga0075433_10368928 3300006852 Bacteria 1268
182 Ga0075433_10376776 3300006852 Bacteria 1253
183 Ga0075433_10930569 3300006852 Unclassified 758
184 Ga0075434_100001256 3300006871 Bacteria 21138
185 Ga0075434_100013950 3300006871 Bacteria 7668
186 Ga0075434_100019454 3300006871 Bacteria 6572
187 Ga0075434_100025977 3300006871 Bacteria 5734
188 Ga0075434_100039221 3300006871 Bacteria 4693
189 Ga0075434_100057383 3300006871 Bacteria 3869
190 Ga0075434_100155628 3300006871 Bacteria 2305
191 Ga0075434_100503917 3300006871 Bacteria 1231
192 Ga0075434_100642910 3300006871 Bacteria 1079
193 Ga0075434_100723872 3300006871 Unclassified 1012
194 Ga0075434_100754469 3300006871 Bacteria 990
195 Ga0075434_100813022 3300006871 Unclassified 951
196 Ga0075434_100965386 3300006871 Bacteria 866
197 Ga0075434_101233600 3300006871 Bacteria 759
198 Ga0075429_100025581 3300006880 Bacteria 5123
199 Ga0075429_100087639 3300006880 Bacteria 2713
200 Ga0075429_100137358 3300006880 Bacteria 2139
201 Ga0075429_100255907 3300006880 Bacteria 1533
202 Ga0075429_100329916 3300006880 Bacteria 1335
203 Ga0075429_100748408 3300006880 Unclassified 856
204 Ga0068865_100242315 3300006881 Bacteria 1419
205 Ga0068865_100415247 3300006881 Bacteria 1105
206 Ga0075436_100017847 3300006914 Bacteria 4858
207 Ga0075436_100024496 3300006914 Bacteria 4148
208 Ga0075436_100048768 3300006914 Unclassified 2922
209 Ga0075436_100071617 3300006914 Unclassified 2397
210 Ga0075436_100142948 3300006914 Bacteria 1682
211 Ga0075436_100302972 3300006914 Unclassified 1146
212 Ga0075436_100549867 3300006914 Unclassified 847
213 Ga0097620_100255041 3300006931 Bacteria 1845
214 Ga0097620_100963096 3300006931 Bacteria 936
215 Ga0097620_101407791 3300006931 Bacteria 769
216 Ga0075435_100019809 3300007076 Bacteria 5145
217 Ga0075435_100034046 3300007076 Bacteria 4033
218 Ga0075435_100039150 3300007076 Bacteria 3783
219 Ga0075435_100041686 3300007076 Bacteria 3670
220 Ga0075435_100047393 3300007076 Bacteria 3451
221 Ga0075435_100112852 3300007076 Unclassified 2262
222 Ga0075435_100194343 3300007076 Unclassified 1718
223 Ga0075435_100212087 3300007076 Bacteria 1643
224 Ga0075435_100276332 3300007076 Bacteria 1433
225 Ga0075435_100354333 3300007076 Bacteria 1258
226 Ga0075435_100416670 3300007076 Bacteria 1156
227 Ga0075435_100496425 3300007076 Unclassified 1055
228 Ga0075435_100507728 3300007076 Unclassified 1043
229 Ga0075435_100509660 3300007076 Unclassified 1040
230 Ga0105240_10385606 3300009093 Bacteria 1581
231 Ga0111539_10041875 3300009094 Bacteria 5503
232 Ga0111539_10059966 3300009094 Bacteria 4510
233 Ga0111539_10133152 3300009094 Unclassified 2911
234 Ga0111539_10255240 3300009094 Unclassified 2042
235 Ga0111539_11307825 3300009094 Unclassified 841
236 Ga0111539_12280857 3300009094 Bacteria 628
237 Ga0105245_10108760 3300009098 Unclassified 2575
238 Ga0105245_10616200 3300009098 Bacteria 1113
239 Ga0105247_10434892 3300009101 Bacteria 942
240 Ga0114129_10027034 3300009147 Bacteria 8124
241 Ga0114129_10042188 3300009147 Bacteria 6424
242 Ga0114129_10120224 3300009147 Bacteria 3617
243 Ga0114129_10129023 3300009147 Bacteria 3475
244 Ga0114129_10137783 3300009147 Bacteria 3347
245 Ga0114129_10151513 3300009147 Bacteria 3173
246 Ga0114129_10211169 3300009147 Bacteria 2624
247 Ga0114129_11618337 3300009147 Bacteria 792
248 Ga0105243_10187923 3300009148 Bacteria 1802
249 Ga0105243_10293757 3300009148 Unclassified 1470
250 Ga0105241_10043617 3300009174 Unclassified 3397
251 Ga0105241_10069702 3300009174 Bacteria 2726
252 Ga0105242_10362283 3300009176 Unclassified 1342
253 Ga0105248_10041893 3300009177 Bacteria 5134
254 Ga0105248_12210503 3300009177 Bacteria 626
255 Ga0105237_10107770 3300009545 Unclassified 2778
256 Ga0105237_10406078 3300009545 Bacteria 1367
257 Ga0105237_11086861 3300009545 Bacteria 807
258 Ga0105238_10284811 3300009551 Bacteria 1634
259 Ga0105249_10191946 3300009553 Bacteria 1994
260 Ga0105249_10320932 3300009553 Bacteria 1560
261 Ga0105249_10755829 3300009553 Bacteria 1034
262 Ga0105239_10059296 3300010375 Unclassified 4201
263 Ga0105239_10161036 3300010375 Bacteria 2507
264 Ga0105246_10016188 3300011119 Unclassified 4718
265 Ga0105246_10225376 3300011119 Bacteria 1472
266 Ga0157337_1002638 3300012483 Bacteria 1030
267 Ga0157313_1005322 3300012503 Bacteria 924
268 Ga0157339_1005472 3300012505 Bacteria 1004
269 Ga0157324_1004265 3300012506 Unclassified 981
270 Ga0157316_1030518 3300012510 Unclassified 650
271 Ga0157326_1004941 3300012513 Bacteria 1403
272 Ga0157338_1002075 3300012515 Bacteria 1532
273 Ga0157373_10013409 3300013100 Bacteria 6012
274 Ga0157371_10087724 3300013102 Bacteria 2203
275 Ga0157370_10415279 3300013104 Bacteria 1238
276 Ga0157374_10009883 3300013296 Bacteria 8188
277 Ga0157378_10130599 3300013297 Unclassified 2325
278 Ga0157378_10132638 3300013297 Bacteria 2307
279 Ga0157378_10209349 3300013297 Unclassified 1848
280 Ga0157378_10596133 3300013297 Bacteria 1115
281 Ga0157378_11487257 3300013297 Bacteria 722
282 Ga0157378_12320400 3300013297 Bacteria 588
283 Ga0163162_10009371 3300013306 Bacteria 9523
284 Ga0163162_10279196 3300013306 Bacteria 1802
285 Ga0163162_10303439 3300013306 Bacteria 1729
286 Ga0157372_10097522 3300013307 Unclassified 3353
287 Ga0157372_11794959 3300013307 Bacteria 705
288 Ga0157375_10253981 3300013308 Bacteria 1919
289 Ga0163163_10261689 3300014325 Bacteria 1781
290 Ga0157377_10222580 3300014745 Bacteria 1209
291 Ga0157379_10380661 3300014968 Bacteria 1295
292 Ga0157376_10009531 3300014969 Bacteria 7059
293 Ga0157376_10696890 3300014969 Bacteria 1020
294 Ga0182007_10052247 3300015262 Unclassified 1347
295 Ga0207666_1028816 3300025271 Bacteria 844
296 Ga0207697_10009710 3300025315 Bacteria 4144
297 Ga0207697_10012439 3300025315 Unclassified 3567
298 Ga0207682_10070179 3300025893 Bacteria 1483
299 Ga0207682_10099829 3300025893 Bacteria 1268
300 Ga0207642_10170248 3300025899 Bacteria 1178
301 Ga0207688_10037505 3300025901 Unclassified 2688
302 Ga0207688_10046357 3300025901 Bacteria 2427
303 Ga0207680_10057069 3300025903 Bacteria 2361
304 Ga0207645_10011667 3300025907 Bacteria 5991
305 Ga0207705_10156069 3300025909 Bacteria 1712
306 Ga0207684_10548716 3300025910 Bacteria 989
307 Ga0207654_10092306 3300025911 Unclassified 1848
308 Ga0207654_10112637 3300025911 Bacteria 1695
309 Ga0207707_10002315 3300025912 Bacteria 17174
310 Ga0207707_10016347 3300025912 Bacteria 6472
311 Ga0207707_10611586 3300025912 Bacteria 921
312 Ga0207671_10259543 3300025914 Bacteria 1367
313 Ga0207693_10946703 3300025915 Bacteria 659
314 Ga0207660_10083016 3300025917 Unclassified 2358
315 Ga0207660_10108508 3300025917 Bacteria 2085
316 Ga0207662_10680357 3300025918 Bacteria 720
317 Ga0207657_10009804 3300025919 Bacteria 9599
318 Ga0207649_10190657 3300025920 Unclassified 1441
319 Ga0207649_10257550 3300025920 Bacteria 1259
320 Ga0207652_10144559 3300025921 Bacteria 2128
321 Ga0207652_10176670 3300025921 Unclassified 1918
322 Ga0207646_10268801 3300025922 Unclassified 1541
323 Ga0207646_10299363 3300025922 Bacteria 1453
324 Ga0207681_10032861 3300025923 Unclassified 3399
325 Ga0207681_10389933 3300025923 Unclassified 1123
326 Ga0207681_10810434 3300025923 Unclassified 782
327 Ga0207650_10173738 3300025925 Unclassified 1713
328 Ga0207650_10696508 3300025925 Bacteria 858
329 Ga0207659_10498910 3300025926 Bacteria 1030
330 Ga0207687_10295822 3300025927 Bacteria 1302
331 Ga0207690_10030219 3300025932 Bacteria 3454
332 Ga0207690_10088603 3300025932 Bacteria 2180
333 Ga0207706_10018664 3300025933 Bacteria 6240
334 Ga0207706_10076067 3300025933 Bacteria 2953
335 Ga0207706_10210857 3300025933 Bacteria 1703
336 Ga0207706_10730237 3300025933 Bacteria 845
337 Ga0207686_10271166 3300025934 Bacteria 1248
338 Ga0207670_10356748 3300025936 Bacteria 1159
339 Ga0207670_10499344 3300025936 Bacteria 988
340 Ga0207669_10013747 3300025937 Unclassified 4034
341 Ga0207669_10442783 3300025937 Bacteria 1028
342 Ga0207704_10063920 3300025938 Unclassified 2297
343 Ga0207704_10409623 3300025938 Unclassified 1072
344 Ga0207665_10319252 3300025939 Unclassified 1165
345 Ga0207691_10013234 3300025940 Bacteria 7901
346 Ga0207711_10059899 3300025941 Unclassified 3279
347 Ga0207711_10074868 3300025941 Bacteria 2945
348 Ga0207689_10063868 3300025942 Unclassified 3029
349 Ga0207679_10151021 3300025945 Unclassified 1890
350 Ga0207679_10172174 3300025945 Bacteria 1783
351 Ga0207679_11162124 3300025945 Unclassified 708
352 Ga0207667_10646705 3300025949 Bacteria 1063
353 Ga0207651_10146377 3300025960 Bacteria 1832
354 Ga0207651_11085310 3300025960 Bacteria 717
355 Ga0207651_11475187 3300025960 Bacteria 612
356 Ga0207712_10033382 3300025961 Bacteria 3479
357 Ga0207712_10116645 3300025961 Unclassified 2012
358 Ga0207668_10075482 3300025972 Bacteria 2424
359 Ga0207668_10099086 3300025972 Bacteria 2161
360 Ga0207668_11003719 3300025972 Unclassified 746
361 Ga0207640_10222495 3300025981 Unclassified 1446
362 Ga0207677_10246682 3300026023 Bacteria 1448
363 Ga0207703_10382592 3300026035 Unclassified 1302
364 Ga0207639_10177131 3300026041 Bacteria 1811
365 Ga0207678_10009593 3300026067 Bacteria 8512
366 Ga0207708_10172370 3300026075 Unclassified 1714
367 Ga0207702_10023274 3300026078 Bacteria 5136
368 Ga0207641_10526977 3300026088 Bacteria 1150
369 Ga0207648_10191927 3300026089 Bacteria 1810
370 Ga0207648_10206323 3300026089 Bacteria 1744
371 Ga0207676_10471694 3300026095 Bacteria 1187
372 Ga0207674_10310612 3300026116 Unclassified 1526
373 Ga0207674_10639818 3300026116 Bacteria 1027
374 Ga0207674_10848816 3300026116 Bacteria 881
375 Ga0207675_100414317 3300026118 Bacteria 1330
376 Ga0207675_100662028 3300026118 Bacteria 1051
377 Ga0207675_100838661 3300026118 Unclassified 934
378 Ga0207683_10004231 3300026121 Bacteria 12393
379 Ga0209967_1012380 3300027364 Unclassified 1205
380 Ga0209982_1007525 3300027552 Unclassified 1591
381 Ga0209970_1055820 3300027614 Bacteria 719
382 Ga0210002_1002315 3300027617 Unclassified 2749
383 Ga0209983_1025699 3300027665 Unclassified 1243
384 Ga0209971_1002713 3300027682 Bacteria 4233
385 Ga0209998_10003509 3300027717 Bacteria 3424
386 Ga0209998_10035113 3300027717 Bacteria 1123
387 Ga0209974_10000067 3300027876 Bacteria 27577
388 Ga0209974_10141605 3300027876 Unclassified 863
389 Ga0209974_10404374 3300027876 Bacteria 536
390 Ga0207428_10228068 3300027907 Bacteria 1394
391 Ga0207428_10263779 3300027907 Unclassified 1282
392 Ga0207428_10530560 3300027907 Unclassified 853
393 Ga0207428_10913113 3300027907 Unclassified 620
394 Ga0268266_10169664 3300028379 Bacteria 1980
395 Ga0268266_10232776 3300028379 Bacteria 1697
396 Ga0268264_10539374 3300028381 Bacteria 1143
397 Ga0307405_10337305 3300031731 Unclassified 1158
398 Ga0307416_100237544 3300032002 Unclassified 1763
399 Ga0307411_10274636 3300032005 Unclassified 1338
400 Ga0373930_0136480 3300034816 Bacteria 607
401 Ga0373926_0048197 3300035083 Bacteria 1532
402 Ga0373932_0129473 3300035112 Bacteria 849
403 Ga0373939_0196175 3300035114 Unclassified 761
404 Ga0373941_0184831 3300035115 Bacteria 784
405 Ga0373956_0160552 3300035119 Bacteria 1059
406 Ga0373960_0086180 3300035121 Bacteria 997
407 Ga0373961_0307616 3300035241 Unclassified 588
408 Ga0373931_0007839 3300035691 Bacteria 5047
409 Ga0373931_0080598 3300035691 Bacteria 1795
410 Ga0373931_0104295 3300035691 Bacteria 1599
411 Ga0373935_0037362 3300035692 Unclassified 3039
412 Ga0373927_0136239 3300035695 Bacteria 1605
413 Ga0373927_0729129 3300035695 Bacteria 655
414 Ga0373947_0058778 3300035725 Unclassified 2330
415 Ga0373937_0327191 3300036401 Bacteria 1450
416 Ga0373925_0278767 3300037068 Unclassified 1346
417 Ga0373925_0907003 3300037068 Unclassified 726
418 Ga0242420_057584 3300038996 Bacteria 770
419 Ga0439448_0316566 3300042005 Bacteria 555
420 Ga0439455_0010203 3300042012 Unclassified 2060
421 Ga0439455_0135518 3300042012 Bacteria 696
422 Ga0439458_0144091 3300042157 Bacteria 636
423 Ga0439434_0196287 3300042435 Unclassified 679
424 Ga0451577_0241782 3300042876 Bacteria 1633
425 Ga0451577_0584197 3300042876 Bacteria 1014
426 Ga0453684_0126340 3300044712 Bacteria 3077
427 Ga0451576_0049714 3300045051 Bacteria 4400
428 Ga0451576_0050532 3300045051 Unclassified 4360
429 Ga0451576_0226514 3300045051 Bacteria 1952
430 Ga0451576_0307098 3300045051 Bacteria 1659
431 Ga0451576_1870386 3300045051 Unclassified 620
432 Ga0495603_0359901 3300046455 Unclassified 835
433 Ga0495603_0454409 3300046455 Bacteria 734
434 Ga0495580_0063945 3300046472 Bacteria 2580
435 Ga0495580_0363979 3300046472 Bacteria 978
436 Ga0495582_0377145 3300046473 Bacteria 817
437 Ga0495586_0317955 3300046535 Bacteria 893
438 Ga0495657_0504964 3300046675 Unclassified 705
439 Ga0495658_0146863 3300046683 Bacteria 1446
440 Ga0495670_0452419 3300046691 Unclassified 696
441 Ga0496102_0556200 3300048905 Bacteria 1070
442 Ga0496104_0237362 3300048907 Bacteria 1735
443 Ga0496104_1412589 3300048907 Unclassified 599
444 Ga0496106_0234096 3300048909 Unclassified 1467
445 Ga0496106_0424952 3300048909 Bacteria 1068
446 Ga0496108_0545805 3300048911 Unclassified 1011
447 Ga0496109_0519316 3300048912 Bacteria 1124
448 Ga0496109_0872453 3300048912 Unclassified 838
449 Ga0496112_0133604 3300048915 Bacteria 2452
450 Ga0496113_0667754 3300048916 Bacteria 831
451 Ga0501031_0115632 3300049568 Bacteria 1752
452 Ga0501032_0052277 3300049569 Unclassified 2753
453 Ga0501033_0034642 3300049570 Bacteria 3786
454 Ga0501036_0191908 3300049572 Bacteria 1718
455 Ga0501037_0094225 3300049573 Bacteria 2165
456 Ga0501038_0029068 3300049574 Bacteria 4902
457 Ga0501038_0130767 3300049574 Bacteria 2061
458 Ga0501039_0021034 3300049575 Bacteria 5004
459 Ga0501039_0332695 3300049575 Bacteria 1193
460 Ga0501040_0016834 3300049576 Unclassified 4847
461 Ga0501040_0150510 3300049576 Bacteria 1642
462 Ga0501040_0196029 3300049576 Bacteria 1434
463 Ga0501040_0235297 3300049576 Bacteria 1305
464 Ga0501040_0261396 3300049576 Unclassified 1235
465 Ga0501040_0555448 3300049576 Unclassified 829
466 Ga0501040_1270498 3300049576 Unclassified 534
467 Ga0501041_0011751 3300049577 Bacteria 5182
468 Ga0501041_0151278 3300049577 Unclassified 1449
469 Ga0501042_0136623 3300049578 Bacteria 1767
470 Ga0501042_0206457 3300049578 Bacteria 1416
471 Ga0501042_1241956 3300049578 Unclassified 543
472 Ga0501046_0084664 3300049580 Bacteria 2445
473 Ga0501046_0535526 3300049580 Bacteria 836
474 Ga0501047_0595334 3300049581 Bacteria 928
475 Ga0501048_0016608 3300049582 Bacteria 5427
476 Ga0501048_0308391 3300049582 Bacteria 1126
477 Ga0501068_0084871 3300049584 Unclassified 1948
478 Ga0501068_0556233 3300049584 Unclassified 746
479 Ga0501070_0104067 3300049586 Unclassified 2348
480 Ga0501070_0489838 3300049586 Bacteria 988
481 Ga0501071_0035139 3300049587 Unclassified 3570
482 Ga0501071_0141779 3300049587 Unclassified 1790
483 Ga0501071_0333187 3300049587 Bacteria 1153
484 Ga0501072_0019706 3300049588 Bacteria 5217
485 Ga0501072_0290099 3300049588 Bacteria 1301
486 Ga0501072_0547253 3300049588 Unclassified 914
487 Ga0501072_0723972 3300049588 Unclassified 781
488 Ga0501073_0224254 3300049589 Bacteria 1298
489 Ga0501073_0462270 3300049589 Unclassified 877
490 Ga0501074_0027823 3300049590 Unclassified 4099
491 Ga0501074_0641722 3300049590 Unclassified 750
492 Ga0501075_0017860 3300049591 Bacteria 5124
493 Ga0501075_0044427 3300049591 Bacteria 3334
494 Ga0501075_0053840 3300049591 Unclassified 3026
495 Ga0501075_0339050 3300049591 Bacteria 1145
496 Ga0501076_0022824 3300049592 Bacteria 4813
497 Ga0501076_0053171 3300049592 Unclassified 3209
498 Ga0501077_0009310 3300049593 Bacteria 6098
499 Ga0501077_0011247 3300049593 Bacteria 5584
500 Ga0501077_0019401 3300049593 Bacteria 4301
501 Ga0501077_0019948 3300049593 Unclassified 4241
502 Ga0501077_0026433 3300049593 Bacteria 3684
503 Ga0501077_0139161 3300049593 Bacteria 1539
504 Ga0501225_0036162 3300049705 Unclassified 1361
505 Ga0501079_0021154 3300049741 Unclassified 4973
506 Ga0501079_0099001 3300049741 Unclassified 2260
507 Ga0501079_0215842 3300049741 Bacteria 1498
508 Ga0501080_0134734 3300049742 Unclassified 2286
509 Ga0501080_0551517 3300049742 Bacteria 1026
510 Ga0501080_1535924 3300049742 Unclassified 565
511 Ga0501081_0009065 3300049743 Bacteria 6469
512 Ga0501081_0335006 3300049743 Unclassified 1114
513 Ga0501081_0383514 3300049743 Unclassified 1039
514 Ga0501081_0405401 3300049743 Bacteria 1010
515 Ga0501083_0021284 3300049744 Unclassified 4506
516 Ga0501035_0242865 3300049822 Bacteria 1531
517 Ga0501044_0179808 3300049823 Bacteria 2083
518 Ga0501045_0008954 3300049824 Bacteria 6990
519 Ga0501045_0034904 3300049824 Bacteria 3651
520 Ga0501045_0214799 3300049824 Bacteria 1432
521 Ga0501045_0361837 3300049824 Unclassified 1080
522 nmdc:mga05p37_1255221_c1 3300050507 Bacteria 760
523 nmdc:mga05p37_1393683_c1 3300050507 Unclassified 707
524 nmdc:mga05p37_145674_c1 3300050507 Unclassified 2901
525 nmdc:mga05p37_245491_c1 3300050507 Bacteria 2150
526 nmdc:mga05p37_257672_c1 3300050507 Bacteria 2090
527 nmdc:mga05p37_26171_c1 3300050507 Bacteria 7093
528 nmdc:mga05p37_29034_c1 3300050507 Bacteria 6749
529 nmdc:mga05p37_29933_c1 3300050507 Bacteria 6645
530 nmdc:mga05p37_323165_c1 3300050507 Unclassified 1826
531 nmdc:mga05p37_42723_c1 3300050507 Bacteria 5572
532 nmdc:mga05p37_454572_c1 3300050507 Bacteria 1481
533 nmdc:mga05p37_95641_c1 3300050507 Bacteria 3660
534 nmdc:mga09592_119623_c1 3300050508 Bacteria 2262
535 nmdc:mga09592_1406489_c1 3300050508 Unclassified 570
536 nmdc:mga09592_22514_c1 3300050508 Bacteria 5201
537 nmdc:mga09592_433803_c1 3300050508 Bacteria 1134
538 nmdc:mga09592_51848_c1 3300050508 Bacteria 3462
539 nmdc:mga09592_74026_c1 3300050508 Bacteria 2895
540 nmdc:mga09592_762372_c1 3300050508 Unclassified 820
541 nmdc:mga09592_784048_c1 3300050508 Unclassified 807
542 nmdc:mga0qj67_105653_c1 3300050509 Bacteria 2272
543 nmdc:mga0qj67_223804_c1 3300050509 Bacteria 1527
544 nmdc:mga0qj67_596346_c1 3300050509 Unclassified 884
545 nmdc:mga06r32_1250751_c1 3300050510 Unclassified 687
546 nmdc:mga06r32_14945_c1 3300050510 Bacteria 7045
547 nmdc:mga06r32_181306_c1 3300050510 Bacteria 2092
548 nmdc:mga06r32_210177_c1 3300050510 Bacteria 1934
549 nmdc:mga06r32_325161_c1 3300050510 Bacteria 1523
550 nmdc:mga06r32_509194_c1 3300050510 Unclassified 1180
551 nmdc:mga06r32_57561_c1 3300050510 Bacteria 3734
552 nmdc:mga06r32_705349_c1 3300050510 Bacteria 974
553 nmdc:mga08y16_1034448_c1 3300050511 Bacteria 800
554 nmdc:mga08y16_178467_c1 3300050511 Bacteria 2206
555 nmdc:mga08y16_309103_c1 3300050511 Unclassified 1628
556 nmdc:mga08y16_85503_c1 3300050511 Unclassified 3287
557 nmdc:mga0n895_12792_c1 3300050512 Bacteria 7537
558 nmdc:mga0n895_1376179_c1 3300050512 Unclassified 675
559 nmdc:mga0n895_145560_c1 3300050512 Bacteria 2399
560 nmdc:mga0n895_151096_c1 3300050512 Bacteria 2353
561 nmdc:mga0n895_3232_c1 3300050512 Bacteria 13058
562 nmdc:mga0n895_366926_c1 3300050512 Bacteria 1458
563 nmdc:mga0n895_41053_c1 3300050512 Bacteria 4497
564 nmdc:mga0n895_43169_c1 3300050512 Unclassified 4393
565 nmdc:mga0n895_51194_c1 3300050512 Bacteria 4051
566 nmdc:mga0n895_561945_c1 3300050512 Bacteria 1146
567 nmdc:mga0n895_62716_c1 3300050512 Bacteria 3675
568 nmdc:mga0n895_662396_c1 3300050512 Unclassified 1042
569 nmdc:mga0rr50_120871_c1 3300050513 Bacteria 2085
570 nmdc:mga0rr50_1406407_c1 3300050513 Bacteria 590
571 nmdc:mga0rr50_1862_c1 3300050513 Bacteria 11708
572 nmdc:mga0rr50_198230_c1 3300050513 Bacteria 1649
573 nmdc:mga0rr50_456588_c1 3300050513 Bacteria 1083
574 nmdc:mga0rr50_47406_c1 3300050513 Bacteria 3170
575 nmdc:mga0rr50_5855_c1 3300050513 Bacteria 7392
576 nmdc:mga0rr50_661043_c1 3300050513 Bacteria 892
577 nmdc:mga0rr50_76539_c1 3300050513 Bacteria 2569
578 nmdc:mga0rr50_867889_c1 3300050513 Bacteria 769
579 nmdc:mga0rr50_9597_c2 3300050513 Unclassified 3700
580 nmdc:mga08x19_130666_c1 3300050514 Unclassified 1689
581 nmdc:mga08x19_15243_c1 3300050514 Bacteria 4674
582 nmdc:mga08x19_297185_c1 3300050514 Bacteria 1121
583 nmdc:mga08x19_33839_c1 3300050514 Bacteria 3227
584 nmdc:mga08x19_480468_c1 3300050514 Unclassified 876
585 nmdc:mga08x19_512096_c1 3300050514 Bacteria 848
586 nmdc:mga08x19_51411_c1 3300050514 Unclassified 2647
587 nmdc:mga0a205_104181_c1 3300050515 Bacteria 2736
588 nmdc:mga0a205_114045_c1 3300050515 Unclassified 2601
589 nmdc:mga0a205_14734_c1 3300050515 Bacteria 7294
590 nmdc:mga0a205_2119_c1 3300050515 Bacteria 17403
591 nmdc:mga0a205_216607_c1 3300050515 Bacteria 1802
592 nmdc:mga0a205_223560_c1 3300050515 Bacteria 1768
593 nmdc:mga0a205_228299_c1 3300050515 Unclassified 1746
594 nmdc:mga0a205_239236_c1 3300050515 Unclassified 1696
595 nmdc:mga0a205_2873_c1 3300050515 Bacteria 15235
596 nmdc:mga0a205_31932_c1 3300050515 Bacteria 5047
597 nmdc:mga0a205_36852_c1 3300050515 Unclassified 4701
598 nmdc:mga0a205_69445_c1 3300050515 Bacteria 3402
599 Ga0501084_0018762 3300054114 Bacteria 5759
600 Ga0501084_0049235 3300054114 Bacteria 3527
601 Ga0501084_0157565 3300054114 Bacteria 1915
602 Ga0501084_0249674 3300054114 Bacteria 1498
603 Ga0590074_033554 3300059423 Bacteria 911
604 Ga0590077_014497 3300059426 Unclassified 1643
605 Ga0501082_0026866 3300060353 Bacteria 4959
606 Ga0501082_0400723 3300060353 Bacteria 1197
607 Ga0501082_0460760 3300060353 Bacteria 1111
608 Ga0530510_0076138 3300061734 Bacteria 2437
609 Ga0530510_0184979 3300061734 Bacteria 1546
610 Ga0530510_0215622 3300061734 Unclassified 1426
611 Ga0530510_0221571 3300061734 Unclassified 1406
612 Ga0530510_0236201 3300061734 Bacteria 1360
613 Ga0065717_1005476
614 2214936853
615 ARcpr5oldR_c027653
616 ARcpr5yngRDRAFT_c006758
617 ARcpr5yngRDRAFT_c009863
618 ARcpr5yngRDRAFT_c021497
619 ARCol0yngRDRAFT_1001218
620 ARCol0yngRDRAFT_1014429
621 JGI25407J50210_10034707
622 Ga0058863_11838810
623 Ga0058861_11743320
624 Ga0058860_11677157
625 Ga0058862_12759890
626 Ga0065717_1003152
627 Ga0065704_10006252
628 Ga0065704_10521348
629 Ga0065712_10001278
630 Ga0065712_10021947
631 Ga0065712_10126391
632 Ga0065715_10092281
633 Ga0065715_10127160
634 Ga0065715_10172630
635 Ga0065707_10003976
636 Ga0065707_10025257
637 Ga0065707_10036245
638 Ga0065707_10149364
639 Ga0065707_10159526
640 Ga0065707_10168429
641 Ga0070658_10069080
642 Ga0070658_10476250
643 Ga0070676_10046234
644 Ga0070670_100151420
645 Ga0070670_100244177
646 Ga0070670_100591676
647 Ga0070677_10075566
648 Ga0070677_10133400
649 Ga0068869_100028989
650 Ga0070666_10044766
651 Ga0070666_10130292
652 Ga0070680_100086611
653 Ga0070680_100096610
654 Ga0070682_100089986
655 Ga0068868_100519735
656 Ga0070660_100027158
657 Ga0070691_10291843
658 Ga0070691_10507898
659 Ga0070687_100467337
660 Ga0070687_100734150
661 Ga0070661_100065469
662 Ga0070668_100067439
663 Ga0070669_100181577
664 Ga0070669_100289063
665 Ga0070669_100328563
666 Ga0070669_101196197
667 Ga0070675_100024886
668 Ga0070671_100672143
669 Ga0070674_100021702
670 Ga0070674_100714896
671 Ga0070673_100167688
672 Ga0070673_100410447
673 Ga0070688_100533167
674 Ga0070659_100045747
675 Ga0070659_100128561
676 Ga0070659_101251246
677 Ga0070667_100087283
678 Ga0070667_100130179
679 Ga0070711_100578898
680 Ga0070711_101257956
681 Ga0070705_100017419
682 Ga0070705_100069384
683 Ga0070694_101301751
684 Ga0070708_100210023
685 Ga0070708_100261784
686 Ga0070708_100497037
687 Ga0070663_100015540
688 Ga0070678_100033054
689 Ga0070678_100267843
690 Ga0070662_100034336
691 Ga0070662_100104399
692 Ga0070662_100117799
693 Ga0070662_100259593
694 Ga0070681_10009609
695 Ga0070681_10264854
696 Ga0070681_10382838
697 Ga0070681_10681865
698 Ga0068867_100222425
699 Ga0068867_100604901
700 Ga0070706_100126676
701 Ga0070706_100267394
702 Ga0070706_100687315
703 Ga0070707_100091804
704 Ga0070698_100144530
705 Ga0070698_100540698
706 Ga0070698_101915012
707 Ga0074259_12114301
708 Ga0070699_100102054
709 Ga0070679_100016880
710 Ga0070679_100029951
711 Ga0070679_100397180
712 Ga0070684_100772787
713 Ga0070697_100033762
714 Ga0070697_100204483
715 Ga0070697_100425361
716 Ga0070697_100432558
717 Ga0070697_100465590
718 Ga0070697_100798317
719 Ga0068853_100075688
720 Ga0070672_100075999
721 Ga0070686_100017505
722 Ga0070686_100112310
723 Ga0070695_100008813
724 Ga0070695_100025299
725 Ga0070695_100070804
726 Ga0070695_100345404
727 Ga0070696_100072491
728 Ga0070696_100129118
729 Ga0070696_100213292
730 Ga0070693_100155796
731 Ga0070693_100245133
732 Ga0070665_100291018
733 Ga0070665_100545429
734 Ga0070704_101349528
735 Ga0068855_100046700
736 Ga0070664_100014510
737 Ga0070664_100026191
738 Ga0068857_100322306
739 Ga0068857_100322314
740 Ga0068854_100043605
741 Ga0068854_100081846
742 Ga0070702_100287190
743 Ga0068859_100255052
744 Ga0068859_101407166
745 Ga0068864_100372207
746 Ga0068866_10015965
747 Ga0068866_10374400
748 Ga0068861_100400937
749 Ga0068861_101059840
750 Ga0068870_10131903
751 Ga0068863_100931625
752 Ga0068863_101116362
753 Ga0068863_101136125
754 Ga0068860_100089581
755 Ga0068862_101178103
756 Ga0081455_10035088
757 Ga0081455_10036160
758 Ga0081455_10047532
759 Ga0081538_10014384
760 Ga0081538_10053962
761 Ga0081538_10193402
762 Ga0075432_10043440
763 Ga0075432_10201314
764 Ga0070716_100699616
765 Ga0070712_101123921
766 Ga0097621_100075698
767 Ga0097621_100278524
768 Ga0097621_101665927
769 Ga0075428_100035285
770 Ga0075428_100044050
771 Ga0075428_100060358
772 Ga0075428_100107808
773 Ga0075428_101496471
774 Ga0075430_100021693
775 Ga0075430_100029362
776 Ga0075430_100049039
777 Ga0075430_100308836
778 Ga0075430_100437476
779 Ga0075430_100744461
780 Ga0075431_100007887
781 Ga0075431_100066478
782 Ga0075431_100158966
783 Ga0075431_100262739
784 Ga0075433_10004757
785 Ga0075433_10027541
786 Ga0075433_10043020
787 Ga0075433_10062917
788 Ga0075433_10070763
789 Ga0075433_10077258
790 Ga0075433_10090086
791 Ga0075433_10160078
792 Ga0075433_10168879
793 Ga0075433_10368928
794 Ga0075433_10376776
795 Ga0075433_10930569
796 Ga0075434_100001256
797 Ga0075434_100013950
798 Ga0075434_100019454
799 Ga0075434_100025977
800 Ga0075434_100039221
801 Ga0075434_100057383
802 Ga0075434_100155628
803 Ga0075434_100503917
804 Ga0075434_100642910
805 Ga0075434_100723872
806 Ga0075434_100754469
807 Ga0075434_100813022
808 Ga0075434_100965386
809 Ga0075434_101233600
810 Ga0075429_100025581
811 Ga0075429_100087639
812 Ga0075429_100137358
813 Ga0075429_100255907
814 Ga0075429_100329916
815 Ga0075429_100748408
816 Ga0068865_100242315
817 Ga0068865_100415247
818 Ga0075436_100017847
819 Ga0075436_100024496
820 Ga0075436_100048768
821 Ga0075436_100071617
822 Ga0075436_100142948
823 Ga0075436_100302972
824 Ga0075436_100549867
825 Ga0097620_100255041
826 Ga0097620_100963096
827 Ga0097620_101407791
828 Ga0075435_100019809
829 Ga0075435_100034046
830 Ga0075435_100039150
831 Ga0075435_100041686
832 Ga0075435_100047393
833 Ga0075435_100112852
834 Ga0075435_100194343
835 Ga0075435_100212087
836 Ga0075435_100276332
837 Ga0075435_100354333
838 Ga0075435_100416670
839 Ga0075435_100496425
840 Ga0075435_100507728
841 Ga0075435_100509660
842 Ga0105240_10385606
843 Ga0111539_10041875
844 Ga0111539_10059966
845 Ga0111539_10133152
846 Ga0111539_10255240
847 Ga0111539_11307825
848 Ga0111539_12280857
849 Ga0105245_10108760
850 Ga0105245_10616200
851 Ga0105247_10434892
852 Ga0114129_10027034
853 Ga0114129_10042188
854 Ga0114129_10120224
855 Ga0114129_10129023
856 Ga0114129_10137783
857 Ga0114129_10151513
858 Ga0114129_10211169
859 Ga0114129_11618337
860 Ga0105243_10187923
861 Ga0105243_10293757
862 Ga0105241_10043617
863 Ga0105241_10069702
864 Ga0105242_10362283
865 Ga0105248_10041893
866 Ga0105248_12210503
867 Ga0105237_10107770
868 Ga0105237_10406078
869 Ga0105237_11086861
870 Ga0105238_10284811
871 Ga0105249_10191946
872 Ga0105249_10320932
873 Ga0105249_10755829
874 Ga0105239_10059296
875 Ga0105239_10161036
876 Ga0105246_10016188
877 Ga0105246_10225376
878 Ga0157337_1002638
879 Ga0157313_1005322
880 Ga0157339_1005472
881 Ga0157324_1004265
882 Ga0157316_1030518
883 Ga0157326_1004941
884 Ga0157338_1002075
885 Ga0157373_10013409
886 Ga0157371_10087724
887 Ga0157370_10415279
888 Ga0157374_10009883
889 Ga0157378_10130599
890 Ga0157378_10132638
891 Ga0157378_10209349
892 Ga0157378_10596133
893 Ga0157378_11487257
894 Ga0157378_12320400
895 Ga0163162_10009371
896 Ga0163162_10279196
897 Ga0163162_10303439
898 Ga0157372_10097522
899 Ga0157372_11794959
900 Ga0157375_10253981
901 Ga0163163_10261689
902 Ga0157377_10222580
903 Ga0157379_10380661
904 Ga0157376_10009531
905 Ga0157376_10696890
906 Ga0182007_10052247
907 Ga0207666_1028816
908 Ga0207697_10009710
909 Ga0207697_10012439
910 Ga0207682_10070179
911 Ga0207682_10099829
912 Ga0207642_10170248
913 Ga0207688_10037505
914 Ga0207688_10046357
915 Ga0207680_10057069
916 Ga0207645_10011667
917 Ga0207705_10156069
918 Ga0207684_10548716
919 Ga0207654_10092306
920 Ga0207654_10112637
921 Ga0207707_10002315
922 Ga0207707_10016347
923 Ga0207707_10611586
924 Ga0207671_10259543
925 Ga0207693_10946703
926 Ga0207660_10083016
927 Ga0207660_10108508
928 Ga0207662_10680357
929 Ga0207657_10009804
930 Ga0207649_10190657
931 Ga0207649_10257550
932 Ga0207652_10144559
933 Ga0207652_10176670
934 Ga0207646_10268801
935 Ga0207646_10299363
936 Ga0207681_10032861
937 Ga0207681_10389933
938 Ga0207681_10810434
939 Ga0207650_10173738
940 Ga0207650_10696508
941 Ga0207659_10498910
942 Ga0207687_10295822
943 Ga0207690_10030219
944 Ga0207690_10088603
945 Ga0207706_10018664
946 Ga0207706_10076067
947 Ga0207706_10210857
948 Ga0207706_10730237
949 Ga0207686_10271166
950 Ga0207670_10356748
951 Ga0207670_10499344
952 Ga0207669_10013747
953 Ga0207669_10442783
954 Ga0207704_10063920
955 Ga0207704_10409623
956 Ga0207665_10319252
957 Ga0207691_10013234
958 Ga0207711_10059899
959 Ga0207711_10074868
960 Ga0207689_10063868
961 Ga0207679_10151021
962 Ga0207679_10172174
963 Ga0207679_11162124
964 Ga0207667_10646705
965 Ga0207651_10146377
966 Ga0207651_11085310
967 Ga0207651_11475187
968 Ga0207712_10033382
969 Ga0207712_10116645
970 Ga0207668_10075482
971 Ga0207668_10099086
972 Ga0207668_11003719
973 Ga0207640_10222495
974 Ga0207677_10246682
975 Ga0207703_10382592
976 Ga0207639_10177131
977 Ga0207678_10009593
978 Ga0207708_10172370
979 Ga0207702_10023274
980 Ga0207641_10526977
981 Ga0207648_10191927
982 Ga0207648_10206323
983 Ga0207676_10471694
984 Ga0207674_10310612
985 Ga0207674_10639818
986 Ga0207674_10848816
987 Ga0207675_100414317
988 Ga0207675_100662028
989 Ga0207675_100838661
990 Ga0207683_10004231
991 Ga0209967_1012380
992 Ga0209982_1007525
993 Ga0209970_1055820
994 Ga0210002_1002315
995 Ga0209983_1025699
996 Ga0209971_1002713
997 Ga0209998_10003509
998 Ga0209998_10035113
999 Ga0209974_10000067
1000 Ga0209974_10141605
1001 Ga0209974_10404374
1002 Ga0207428_10228068
1003 Ga0207428_10263779
1004 Ga0207428_10530560
1005 Ga0207428_10913113
1006 Ga0268266_10169664
1007 Ga0268266_10232776
1008 Ga0268264_10539374
1009 Ga0307405_10337305
1010 Ga0307416_100237544
1011 Ga0307411_10274636
1012 Ga0373930_0136480
1013 Ga0373926_0048197
1014 Ga0373932_0129473
1015 Ga0373939_0196175
1016 Ga0373941_0184831
1017 Ga0373956_0160552
1018 Ga0373960_0086180
1019 Ga0373961_0307616
1020 Ga0373931_0007839
1021 Ga0373931_0080598
1022 Ga0373931_0104295
1023 Ga0373935_0037362
1024 Ga0373927_0136239
1025 Ga0373927_0729129
1026 Ga0373947_0058778
1027 Ga0373937_0327191
1028 Ga0373925_0278767
1029 Ga0373925_0907003
1030 Ga0242420_057584
1031 Ga0439448_0316566
1032 Ga0439455_0010203
1033 Ga0439455_0135518
1034 Ga0439458_0144091
1035 Ga0439434_0196287
1036 Ga0451577_0241782
1037 Ga0451577_0584197
1038 Ga0453684_0126340
1039 Ga0451576_0049714
1040 Ga0451576_0050532
1041 Ga0451576_0226514
1042 Ga0451576_0307098
1043 Ga0451576_1870386
1044 Ga0495603_0359901
1045 Ga0495603_0454409
1046 Ga0495580_0063945
1047 Ga0495580_0363979
1048 Ga0495582_0377145
1049 Ga0495586_0317955
1050 Ga0495657_0504964
1051 Ga0495658_0146863
1052 Ga0495670_0452419
1053 Ga0496102_0556200
1054 Ga0496104_0237362
1055 Ga0496104_1412589
1056 Ga0496106_0234096
1057 Ga0496106_0424952
1058 Ga0496108_0545805
1059 Ga0496109_0519316
1060 Ga0496109_0872453
1061 Ga0496112_0133604
1062 Ga0496113_0667754
1063 Ga0501031_0115632
1064 Ga0501032_0052277
1065 Ga0501033_0034642
1066 Ga0501036_0191908
1067 Ga0501037_0094225
1068 Ga0501038_0029068
1069 Ga0501038_0130767
1070 Ga0501039_0021034
1071 Ga0501039_0332695
1072 Ga0501040_0016834
1073 Ga0501040_0150510
1074 Ga0501040_0196029
1075 Ga0501040_0235297
1076 Ga0501040_0261396
1077 Ga0501040_0555448
1078 Ga0501040_1270498
1079 Ga0501041_0011751
1080 Ga0501041_0151278
1081 Ga0501042_0136623
1082 Ga0501042_0206457
1083 Ga0501042_1241956
1084 Ga0501046_0084664
1085 Ga0501046_0535526
1086 Ga0501047_0595334
1087 Ga0501048_0016608
1088 Ga0501048_0308391
1089 Ga0501068_0084871
1090 Ga0501068_0556233
1091 Ga0501070_0104067
1092 Ga0501070_0489838
1093 Ga0501071_0035139
1094 Ga0501071_0141779
1095 Ga0501071_0333187
1096 Ga0501072_0019706
1097 Ga0501072_0290099
1098 Ga0501072_0547253
1099 Ga0501072_0723972
1100 Ga0501073_0224254
1101 Ga0501073_0462270
1102 Ga0501074_0027823
1103 Ga0501074_0641722
1104 Ga0501075_0017860
1105 Ga0501075_0044427
1106 Ga0501075_0053840
1107 Ga0501075_0339050
1108 Ga0501076_0022824
1109 Ga0501076_0053171
1110 Ga0501077_0009310
1111 Ga0501077_0011247
1112 Ga0501077_0019401
1113 Ga0501077_0019948
1114 Ga0501077_0026433
1115 Ga0501077_0139161
1116 Ga0501225_0036162
1117 Ga0501079_0021154
1118 Ga0501079_0099001
1119 Ga0501079_0215842
1120 Ga0501080_0134734
1121 Ga0501080_0551517
1122 Ga0501080_1535924
1123 Ga0501081_0009065
1124 Ga0501081_0335006
1125 Ga0501081_0383514
1126 Ga0501081_0405401
1127 Ga0501083_0021284
1128 Ga0501035_0242865
1129 Ga0501044_0179808
1130 Ga0501045_0008954
1131 Ga0501045_0034904
1132 Ga0501045_0214799
1133 Ga0501045_0361837
1134 nmdc:mga05p37_1255221_c1
1135 nmdc:mga05p37_1393683_c1
1136 nmdc:mga05p37_145674_c1
1137 nmdc:mga05p37_245491_c1
1138 nmdc:mga05p37_257672_c1
1139 nmdc:mga05p37_26171_c1
1140 nmdc:mga05p37_29034_c1
1141 nmdc:mga05p37_29933_c1
1142 nmdc:mga05p37_323165_c1
1143 nmdc:mga05p37_42723_c1
1144 nmdc:mga05p37_454572_c1
1145 nmdc:mga05p37_95641_c1
1146 nmdc:mga09592_119623_c1
1147 nmdc:mga09592_1406489_c1
1148 nmdc:mga09592_22514_c1
1149 nmdc:mga09592_433803_c1
1150 nmdc:mga09592_51848_c1
1151 nmdc:mga09592_74026_c1
1152 nmdc:mga09592_762372_c1
1153 nmdc:mga09592_784048_c1
1154 nmdc:mga0qj67_105653_c1
1155 nmdc:mga0qj67_223804_c1
1156 nmdc:mga0qj67_596346_c1
1157 nmdc:mga06r32_1250751_c1
1158 nmdc:mga06r32_14945_c1
1159 nmdc:mga06r32_181306_c1
1160 nmdc:mga06r32_210177_c1
1161 nmdc:mga06r32_325161_c1
1162 nmdc:mga06r32_509194_c1
1163 nmdc:mga06r32_57561_c1
1164 nmdc:mga06r32_705349_c1
1165 nmdc:mga08y16_1034448_c1
1166 nmdc:mga08y16_178467_c1
1167 nmdc:mga08y16_309103_c1
1168 nmdc:mga08y16_85503_c1
1169 nmdc:mga0n895_12792_c1
1170 nmdc:mga0n895_1376179_c1
1171 nmdc:mga0n895_145560_c1
1172 nmdc:mga0n895_151096_c1
1173 nmdc:mga0n895_3232_c1
1174 nmdc:mga0n895_366926_c1
1175 nmdc:mga0n895_41053_c1
1176 nmdc:mga0n895_43169_c1
1177 nmdc:mga0n895_51194_c1
1178 nmdc:mga0n895_561945_c1
1179 nmdc:mga0n895_62716_c1
1180 nmdc:mga0n895_662396_c1
1181 nmdc:mga0rr50_120871_c1
1182 nmdc:mga0rr50_1406407_c1
1183 nmdc:mga0rr50_1862_c1
1184 nmdc:mga0rr50_198230_c1
1185 nmdc:mga0rr50_456588_c1
1186 nmdc:mga0rr50_47406_c1
1187 nmdc:mga0rr50_5855_c1
1188 nmdc:mga0rr50_661043_c1
1189 nmdc:mga0rr50_76539_c1
1190 nmdc:mga0rr50_867889_c1
1191 nmdc:mga0rr50_9597_c2
1192 nmdc:mga08x19_130666_c1
1193 nmdc:mga08x19_15243_c1
1194 nmdc:mga08x19_297185_c1
1195 nmdc:mga08x19_33839_c1
1196 nmdc:mga08x19_480468_c1
1197 nmdc:mga08x19_512096_c1
1198 nmdc:mga08x19_51411_c1
1199 nmdc:mga0a205_104181_c1
1200 nmdc:mga0a205_114045_c1
1201 nmdc:mga0a205_14734_c1
1202 nmdc:mga0a205_2119_c1
1203 nmdc:mga0a205_216607_c1
1204 nmdc:mga0a205_223560_c1
1205 nmdc:mga0a205_228299_c1
1206 nmdc:mga0a205_239236_c1
1207 nmdc:mga0a205_2873_c1
1208 nmdc:mga0a205_31932_c1
1209 nmdc:mga0a205_36852_c1
1210 nmdc:mga0a205_69445_c1
1211 Ga0501084_0018762
1212 Ga0501084_0049235
1213 Ga0501084_0157565
1214 Ga0501084_0249674
1215 Ga0590074_033554
1216 Ga0590077_014497
1217 Ga0501082_0026866
1218 Ga0501082_0400723
1219 Ga0501082_0460760
1220 Ga0530510_0076138
1221 Ga0530510_0184979
1222 Ga0530510_0215622
1223 Ga0530510_0221571
1224 Ga0530510_0236201

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wwf-assembly2.cif.gz_B-2 high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs 0.7806 49 144
6naf-assembly1.cif.gz_A de novo designed homo-trimeric amantadine-binding protein 0.7544 60 131
3zg1-assembly2.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7198 56 158
4wwf-assembly2.cif.gz_B-2 high-resolution structure of two ni-bound forms of the m123c mutant of c. metallidurans cnrxs 0.7113 49 144
6naf-assembly1.cif.gz_A de novo designed homo-trimeric amantadine-binding protein 0.7044 60 131
ID Description Score Start End Superfamily
af_P0AAA9_39_119_1.20.120.1490 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8152 56 131 1.20.120.1490
af_I1NHU8_131_235_1.20.120.1490 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7765 50 147 1.20.120.1490
af_P0AAA9_39_119_1.20.120.1490 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.765 56 131 1.20.120.1490
af_I1LCJ8_127_231_1.20.120.1490 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7407 57 146 1.20.120.1490
3zg1B00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7102 49 154 1.20.120.1490
ID Description Score Start End GO Terms
AF-A0A7X1FN31-F1-model_v4 Transcriptional regulator 0.9478 60 163
AF-A0A7X1FN31-F1-model_v4 Transcriptional regulator 0.9223 60 163
AF-A0A3N5PTE9-F1-model_v4 Uncharacterized protein 0.8938 21 160
AF-A0A3N5PTE9-F1-model_v4 Uncharacterized protein 0.8817 21 160
AF-A0A399XC58-F1-model_v4 Uncharacterized protein 0.86 19 163

Map