F476595
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 708 | 426 | 599 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10000323|Ga0111539_100003235 |
| Length | 336 |
| Sequence | VAVFQVLAIGKESIMRKVIVVTGASSGFGALAARQLAANGDIVYASMRDTQGNNAAKVRETAAYAAEHRVDLRTIELDVQSQKSVDAAIGRIIAENGRLDVIVHNAGHMVLGPAEAFTPQQYAELYDINVLGAQRVNRAALPHFRWRRQGLLVWVSSSSTRGGTPPFLGPYFASKAAMDALAVSYAGELARWGIETAIIVPGSFTRGTNHYAHSGTPDDRTVAAQYNNGPYRGVPEAIQKGLASLEPADADADAVGRAIADVVAMPFGKRPFRTTIDPLDDGAGIVNAVADRVRAELFRRIGMEDLLHPATDRNRRRSGPDQIPANDRQPVQFVQF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 2 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 3 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 4 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 5 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 6 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 7 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 8 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 9 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 10 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 11 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 12 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 13 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 14 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 15 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 16 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 17 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 18 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 19 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 20 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 21 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 22 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 23 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 24 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 25 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 26 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 27 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 28 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 29 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 30 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 31 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 32 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 33 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 34 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 35 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 36 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 37 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 38 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 39 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 40 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 41 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 42 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 43 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 44 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 45 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 46 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 47 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 48 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 49 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 50 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 51 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 52 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 53 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 54 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 55 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 56 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 57 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 58 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 59 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 60 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 61 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 62 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 63 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 64 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 65 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 66 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 67 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 68 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 69 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 70 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 71 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 72 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 73 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 74 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 75 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 76 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 77 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 78 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 79 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 80 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 81 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 82 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 83 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 84 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 85 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 86 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 87 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 88 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 89 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 90 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 91 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 92 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 93 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 94 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 95 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 96 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 97 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 98 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 99 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 100 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 101 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 102 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 103 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 104 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 105 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 106 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 107 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 108 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 109 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 110 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 111 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 112 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 113 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 114 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 115 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 116 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 117 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 118 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 119 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 120 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 121 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 122 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 123 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 124 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 125 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 126 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 132 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 134 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 138 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 141 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 142 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 143 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 144 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 145 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 146 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 147 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 148 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 149 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 150 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 151 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 152 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 153 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 154 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 155 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 156 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 157 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 158 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 169 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 177 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 178 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 179 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 190 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 191 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 193 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 238 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 239 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 240 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 241 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 247 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 248 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 249 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 250 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 251 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 252 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 253 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 254 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 255 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 256 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 257 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 258 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 259 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 260 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 267 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 268 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 346 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 347 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 348 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 349 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 350 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 351 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 352 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 353 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 354 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 355 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 356 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 357 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 378 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 379 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 380 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 381 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 382 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 383 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 385 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 386 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 387 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 388 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 389 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 391 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 392 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 393 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 394 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 396 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 397 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 398 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 399 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 400 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 401 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 402 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 403 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 405 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 407 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 409 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 411 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 412 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 413 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 414 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 415 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 416 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 417 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 418 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 419 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 420 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 421 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 422 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 423 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 424 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 425 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 426 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.6 |
| Metatranscriptomes | 0 |
| Isolates | 15.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.15 |
| Nodule | 6.92 |
| Rhizoplane | 2.4 |
| Rhizosphere | 50.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1002313 | 3300001978 | Bacteria | 1540 |
| 2 | JGI24740J21852_10006148 | 3300001979 | Bacteria | 5008 |
| 3 | JGI25155J39150_1000007 | 3300002704 | Bacteria | 238857 |
| 4 | JGI25156J39149_1000050 | 3300002705 | Bacteria | 89634 |
| 5 | JGI25156J39149_1009817 | 3300002705 | Bacteria | 2295 |
| 6 | JGI25162J39368_1000206 | 3300002737 | Bacteria | 62562 |
| 7 | JGI25162J39368_1000418 | 3300002737 | Bacteria | 34635 |
| 8 | JGI25154J39366_1000035 | 3300002738 | Bacteria | 172224 |
| 9 | JGI25158J39367_1001462 | 3300002739 | Bacteria | 4132 |
| 10 | JGI25157J39369_1000036 | 3300002741 | Bacteria | 133671 |
| 11 | JGI25157J39369_1000331 | 3300002741 | Bacteria | 33478 |
| 12 | JGI25157J39369_1000580 | 3300002741 | Bacteria | 21643 |
| 13 | JGI25163J39215_1000434 | 3300002771 | Bacteria | 12920 |
| 14 | JGI25164J39214_1000091 | 3300002772 | Bacteria | 90400 |
| 15 | JGI25152J39213_1003362 | 3300002773 | Bacteria | 5489 |
| 16 | JGI25152J39213_1003573 | 3300002773 | Bacteria | 5263 |
| 17 | JGI25159J45721_1000175 | 3300002987 | Bacteria | 29637 |
| 18 | JGI25151J46595_10000373 | 3300003187 | Bacteria | 46885 |
| 19 | JGI25165J46597_1000196 | 3300003214 | Bacteria | 90400 |
| 20 | JGI25165J46597_1000375 | 3300003214 | Bacteria | 49445 |
| 21 | JGI25153J46596_10007668 | 3300003215 | Bacteria | 5263 |
| 22 | JGI25153J46596_10011456 | 3300003215 | Bacteria | 3918 |
| 23 | rootH1_10021276 | 3300003316 | Bacteria | 2697 |
| 24 | rootH2_10052331 | 3300003320 | Bacteria | 11944 |
| 25 | rootL2_10052043 | 3300003322 | Bacteria | 3812 |
| 26 | JGI25160J50197_1000365 | 3300003354 | Bacteria | 29637 |
| 27 | JGI25160J50197_1009247 | 3300003354 | Bacteria | 3674 |
| 28 | JGI25161J50226_1000280 | 3300003374 | Bacteria | 29331 |
| 29 | JGI25161J50226_1000331 | 3300003374 | Bacteria | 25691 |
| 30 | JGI25404J52841_10002599 | 3300003659 | Bacteria | 3441 |
| 31 | Ga0055538_1002018 | 3300003751 | Bacteria | 3289 |
| 32 | Ga0055535_1000240 | 3300003761 | Bacteria | 57957 |
| 33 | Ga0055535_1000375 | 3300003761 | Bacteria | 42689 |
| 34 | Ga0055542_1000215 | 3300003762 | Bacteria | 70610 |
| 35 | Ga0055542_1000244 | 3300003762 | Bacteria | 62562 |
| 36 | Ga0055542_1019813 | 3300003762 | Bacteria | 997 |
| 37 | Ga0055529_1000170 | 3300003763 | Bacteria | 90400 |
| 38 | Ga0055526_1001092 | 3300003771 | Bacteria | 19774 |
| 39 | Ga0055526_1002806 | 3300003771 | Bacteria | 11539 |
| 40 | Ga0055524_1009480 | 3300003775 | Bacteria | 3955 |
| 41 | Ga0055524_1018050 | 3300003775 | Bacteria | 2465 |
| 42 | Ga0055528_1000864 | 3300003790 | Bacteria | 20538 |
| 43 | Ga0055528_1015817 | 3300003790 | Bacteria | 2702 |
| 44 | Ga0055540_1004874 | 3300003792 | Bacteria | 5871 |
| 45 | Ga0055540_1007295 | 3300003792 | Bacteria | 4208 |
| 46 | Ga0055540_1027147 | 3300003792 | Bacteria | 1374 |
| 47 | Ga0055531_10020946 | 3300003794 | Bacteria | 2560 |
| 48 | Ga0055543_1000372 | 3300004625 | Bacteria | 29554 |
| 49 | Ga0055543_1000646 | 3300004625 | Bacteria | 18584 |
| 50 | Ga0065165_1000199 | 3300005262 | Bacteria | 104204 |
| 51 | Ga0065165_1001221 | 3300005262 | Bacteria | 29554 |
| 52 | Ga0065165_1026237 | 3300005262 | Bacteria | 1920 |
| 53 | Ga0065714_10002557 | 3300005288 | Bacteria | 15625 |
| 54 | Ga0070661_100013998 | 3300005344 | Bacteria | 5641 |
| 55 | Ga0070661_100044404 | 3300005344 | Bacteria | 3247 |
| 56 | Ga0070674_100091000 | 3300005356 | Bacteria | 2202 |
| 57 | Ga0070667_100000434 | 3300005367 | Bacteria | 44002 |
| 58 | Ga0070667_100006154 | 3300005367 | Bacteria | 9973 |
| 59 | Ga0070709_10037640 | 3300005434 | Bacteria | 2956 |
| 60 | Ga0070714_100207444 | 3300005435 | Bacteria | 1795 |
| 61 | Ga0070713_100011166 | 3300005436 | Bacteria | 6530 |
| 62 | Ga0070711_100021813 | 3300005439 | Bacteria | 4145 |
| 63 | Ga0070700_100295987 | 3300005441 | Bacteria | 1179 |
| 64 | Ga0070694_100182492 | 3300005444 | Bacteria | 1553 |
| 65 | Ga0070663_100000053 | 3300005455 | Bacteria | 52160 |
| 66 | Ga0070699_100215654 | 3300005518 | Bacteria | 1709 |
| 67 | Ga0070699_100374324 | 3300005518 | Bacteria | 1285 |
| 68 | Ga0070679_100052069 | 3300005530 | Bacteria | 4079 |
| 69 | Ga0070696_100014147 | 3300005546 | Bacteria | 5355 |
| 70 | Ga0070696_100063955 | 3300005546 | Bacteria | 2578 |
| 71 | Ga0070665_100027525 | 3300005548 | Bacteria | 5726 |
| 72 | Ga0070665_100286607 | 3300005548 | Bacteria | 1649 |
| 73 | Ga0068855_100029037 | 3300005563 | Bacteria | 6614 |
| 74 | Ga0068855_100051022 | 3300005563 | Bacteria | 4874 |
| 75 | Ga0068854_100000391 | 3300005578 | Bacteria | 27510 |
| 76 | Ga0068856_100037139 | 3300005614 | Bacteria | 4779 |
| 77 | Ga0068856_100188542 | 3300005614 | Bacteria | 2076 |
| 78 | Ga0068861_100377894 | 3300005719 | Bacteria | 1251 |
| 79 | Ga0068860_100070916 | 3300005843 | Bacteria | 3312 |
| 80 | Ga0068860_100143228 | 3300005843 | Bacteria | 2298 |
| 81 | Ga0068862_100045422 | 3300005844 | Bacteria | 3749 |
| 82 | Ga0081455_10022242 | 3300005937 | Bacteria | 5931 |
| 83 | Ga0081455_10040306 | 3300005937 | Bacteria | 4120 |
| 84 | Ga0081455_10065672 | 3300005937 | Bacteria | 3033 |
| 85 | Ga0081540_1001968 | 3300005983 | Bacteria | 17139 |
| 86 | Ga0081540_1004717 | 3300005983 | Bacteria | 10312 |
| 87 | Ga0075365_10104848 | 3300006038 | Bacteria | 1939 |
| 88 | Ga0075368_10039933 | 3300006042 | Bacteria | 1841 |
| 89 | Ga0075363_100108742 | 3300006048 | Bacteria | 1540 |
| 90 | Ga0075363_100182366 | 3300006048 | Bacteria | 1195 |
| 91 | Ga0070716_100008492 | 3300006173 | Bacteria | 5097 |
| 92 | Ga0070716_100112198 | 3300006173 | Bacteria | 1692 |
| 93 | Ga0070712_100012612 | 3300006175 | Bacteria | 5376 |
| 94 | Ga0075367_10005561 | 3300006178 | Bacteria | 6278 |
| 95 | Ga0075369_10001899 | 3300006186 | Bacteria | 7324 |
| 96 | Ga0075369_10016370 | 3300006186 | Bacteria | 2991 |
| 97 | Ga0075428_100435820 | 3300006844 | Bacteria | 1404 |
| 98 | Ga0075436_100020617 | 3300006914 | Bacteria | 4524 |
| 99 | Ga0099795_10015083 | 3300007788 | Bacteria | 2411 |
| 100 | Ga0105250_10023960 | 3300009092 | Bacteria | 2460 |
| 101 | Ga0105240_10000985 | 3300009093 | Bacteria | 50823 |
| 102 | Ga0105240_10001505 | 3300009093 | Bacteria | 39693 |
| 103 | Ga0105240_10005162 | 3300009093 | Bacteria | 19532 |
| 104 | Ga0105240_10080521 | 3300009093 | Bacteria | 4005 |
| 105 | Ga0105240_10161761 | 3300009093 | Bacteria | 2659 |
| 106 | Ga0111539_10000323 | 3300009094 | Bacteria | 58458 |
| 107 | Ga0105245_10361143 | 3300009098 | Bacteria | 1441 |
| 108 | Ga0114129_10671110 | 3300009147 | Bacteria | 1335 |
| 109 | Ga0105241_10092223 | 3300009174 | Bacteria | 2391 |
| 110 | Ga0105248_10000227 | 3300009177 | Bacteria | 64494 |
| 111 | Ga0105248_10007577 | 3300009177 | Bacteria | 11924 |
| 112 | Ga0105237_10002159 | 3300009545 | Bacteria | 24750 |
| 113 | Ga0105238_10000611 | 3300009551 | Bacteria | 37533 |
| 114 | Ga0105249_10000145 | 3300009553 | Bacteria | 91408 |
| 115 | Ga0105249_10096321 | 3300009553 | Bacteria | 2776 |
| 116 | Ga0123342_1021132 | 3300009766 | Bacteria | 4623 |
| 117 | Ga0105239_10000080 | 3300010375 | Bacteria | 134982 |
| 118 | Ga0105239_10002299 | 3300010375 | Bacteria | 24398 |
| 119 | Ga0105239_10064026 | 3300010375 | Unclassified | 4037 |
| 120 | Ga0105239_10225837 | 3300010375 | Bacteria | 2100 |
| 121 | Ga0105239_10265937 | 3300010375 | Bacteria | 1928 |
| 122 | Ga0157370_10000131 | 3300013104 | Bacteria | 89805 |
| 123 | Ga0157370_10087637 | 3300013104 | Bacteria | 2924 |
| 124 | Ga0157369_10008814 | 3300013105 | Bacteria | 11557 |
| 125 | Ga0157369_10031912 | 3300013105 | Bacteria | 5796 |
| 126 | Ga0157369_10399465 | 3300013105 | Bacteria | 1426 |
| 127 | Ga0157374_10462300 | 3300013296 | Bacteria | 1271 |
| 128 | Ga0163162_10008330 | 3300013306 | Bacteria | 10113 |
| 129 | Ga0163162_10070294 | 3300013306 | Bacteria | 3552 |
| 130 | Ga0163162_10107680 | 3300013306 | Bacteria | 2883 |
| 131 | Ga0157375_10145570 | 3300013308 | Bacteria | 2500 |
| 132 | Ga0157380_10220533 | 3300014326 | Bacteria | 1696 |
| 133 | Ga0182008_10030134 | 3300014497 | Bacteria | 2737 |
| 134 | Ga0182008_10036340 | 3300014497 | Bacteria | 2465 |
| 135 | Ga0182005_1000112 | 3300015265 | Bacteria | 58115 |
| 136 | Ga0213872_10001285 | 3300021361 | Bacteria | 16783 |
| 137 | Ga0213872_10001559 | 3300021361 | Bacteria | 14652 |
| 138 | Ga0213872_10016889 | 3300021361 | Bacteria | 3382 |
| 139 | Ga0213872_10051233 | 3300021361 | Bacteria | 1873 |
| 140 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 141 | Ga0209435_107069 | 3300025206 | Bacteria | 1246 |
| 142 | Ga0209760_100284 | 3300025207 | Bacteria | 18011 |
| 143 | Ga0209436_100110 | 3300025208 | Bacteria | 41189 |
| 144 | Ga0209436_100259 | 3300025208 | Bacteria | 24235 |
| 145 | Ga0209784_100074 | 3300025224 | Bacteria | 144366 |
| 146 | Ga0209672_101334 | 3300025228 | Bacteria | 9368 |
| 147 | Ga0209672_103153 | 3300025228 | Bacteria | 3545 |
| 148 | Ga0209147_111962 | 3300025229 | Bacteria | 946 |
| 149 | Ga0207427_100079 | 3300025231 | Bacteria | 145096 |
| 150 | Ga0207427_101222 | 3300025231 | Bacteria | 9942 |
| 151 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 152 | Ga0209437_100163 | 3300025233 | Bacteria | 145370 |
| 153 | Ga0209258_100196 | 3300025242 | Bacteria | 124063 |
| 154 | Ga0209258_100290 | 3300025242 | Bacteria | 82647 |
| 155 | Ga0207425_1001672 | 3300025245 | Bacteria | 8864 |
| 156 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 157 | Ga0209646_1000369 | 3300025246 | Bacteria | 29925 |
| 158 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 159 | Ga0209026_1000064 | 3300025250 | Bacteria | 211303 |
| 160 | Ga0209026_1000109 | 3300025250 | Bacteria | 144563 |
| 161 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 162 | Ga0209148_1000262 | 3300025254 | Bacteria | 82647 |
| 163 | Ga0209148_1001305 | 3300025254 | Bacteria | 13334 |
| 164 | Ga0209148_1002897 | 3300025254 | Bacteria | 5238 |
| 165 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 166 | Ga0209759_1000518 | 3300025256 | Bacteria | 41664 |
| 167 | Ga0209759_1001130 | 3300025256 | Bacteria | 17123 |
| 168 | Ga0209129_1000226 | 3300025258 | Bacteria | 63537 |
| 169 | Ga0209129_1003999 | 3300025258 | Bacteria | 6057 |
| 170 | Ga0209129_1005143 | 3300025258 | Bacteria | 4773 |
| 171 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 172 | Ga0209233_1000275 | 3300025261 | Bacteria | 72941 |
| 173 | Ga0209455_1000155 | 3300025272 | Bacteria | 121004 |
| 174 | Ga0209455_1002312 | 3300025272 | Bacteria | 7460 |
| 175 | Ga0209455_1020260 | 3300025272 | Bacteria | 1320 |
| 176 | Ga0209673_1001495 | 3300025273 | Bacteria | 21722 |
| 177 | Ga0209673_1042173 | 3300025273 | Bacteria | 1286 |
| 178 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 179 | Ga0209130_1000598 | 3300025284 | Bacteria | 34961 |
| 180 | Ga0209676_1000286 | 3300025292 | Bacteria | 103478 |
| 181 | Ga0209676_1005120 | 3300025292 | Bacteria | 6988 |
| 182 | Ga0209025_1000969 | 3300025294 | Bacteria | 43045 |
| 183 | Ga0209025_1001885 | 3300025294 | Bacteria | 24518 |
| 184 | Ga0209025_1004327 | 3300025294 | Bacteria | 12409 |
| 185 | Ga0209025_1010204 | 3300025294 | Bacteria | 6404 |
| 186 | Ga0209025_1024943 | 3300025294 | Bacteria | 3065 |
| 187 | Ga0209025_1060118 | 3300025294 | Bacteria | 1429 |
| 188 | Ga0209564_1000393 | 3300025295 | Bacteria | 78338 |
| 189 | Ga0209564_1000692 | 3300025295 | Bacteria | 49341 |
| 190 | Ga0209758_1000390 | 3300025297 | Bacteria | 75869 |
| 191 | Ga0209758_1000422 | 3300025297 | Bacteria | 71804 |
| 192 | Ga0209758_1000792 | 3300025297 | Bacteria | 45045 |
| 193 | Ga0209758_1005297 | 3300025297 | Bacteria | 10072 |
| 194 | Ga0209758_1008994 | 3300025297 | Bacteria | 6315 |
| 195 | Ga0209758_1009269 | 3300025297 | Bacteria | 6158 |
| 196 | Ga0209758_1010618 | 3300025297 | Bacteria | 5480 |
| 197 | Ga0209758_1011701 | 3300025297 | Bacteria | 5039 |
| 198 | Ga0209758_1023429 | 3300025297 | Bacteria | 2791 |
| 199 | Ga0209758_1037846 | 3300025297 | Bacteria | 1859 |
| 200 | Ga0209758_1078282 | 3300025297 | Bacteria | 1010 |
| 201 | Ga0209050_1007028 | 3300025298 | Bacteria | 6467 |
| 202 | Ga0209256_1001225 | 3300025299 | Bacteria | 28613 |
| 203 | Ga0209256_1004144 | 3300025299 | Bacteria | 9364 |
| 204 | Ga0209256_1007631 | 3300025299 | Bacteria | 5271 |
| 205 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 206 | Ga0207426_1000779 | 3300025302 | Bacteria | 34961 |
| 207 | Ga0207426_1004887 | 3300025302 | Bacteria | 6338 |
| 208 | Ga0209051_1000321 | 3300025303 | Bacteria | 72390 |
| 209 | Ga0209051_1002790 | 3300025303 | Bacteria | 12052 |
| 210 | Ga0209051_1003739 | 3300025303 | Bacteria | 9784 |
| 211 | Ga0209051_1008707 | 3300025303 | Bacteria | 5337 |
| 212 | Ga0209051_1070565 | 3300025303 | Bacteria | 1053 |
| 213 | Ga0209257_1003172 | 3300025304 | Bacteria | 14622 |
| 214 | Ga0209257_1009080 | 3300025304 | Bacteria | 5436 |
| 215 | Ga0207696_1000077 | 3300025711 | Bacteria | 209611 |
| 216 | Ga0207696_1029952 | 3300025711 | Bacteria | 1658 |
| 217 | Ga0207653_10058255 | 3300025885 | Bacteria | 1298 |
| 218 | Ga0207692_10016657 | 3300025898 | Bacteria | 3261 |
| 219 | Ga0207647_10000014 | 3300025904 | Bacteria | 143525 |
| 220 | Ga0207699_10006403 | 3300025906 | Bacteria | 5697 |
| 221 | Ga0207705_10049073 | 3300025909 | Bacteria | 3038 |
| 222 | Ga0207707_10182687 | 3300025912 | Bacteria | 1831 |
| 223 | Ga0207695_10000529 | 3300025913 | Bacteria | 80214 |
| 224 | Ga0207695_10001440 | 3300025913 | Bacteria | 39881 |
| 225 | Ga0207695_10020250 | 3300025913 | Bacteria | 7625 |
| 226 | Ga0207652_10099821 | 3300025921 | Bacteria | 2562 |
| 227 | Ga0207646_10450407 | 3300025922 | Bacteria | 1161 |
| 228 | Ga0207681_10023218 | 3300025923 | Bacteria | 3965 |
| 229 | Ga0207664_10293412 | 3300025929 | Bacteria | 1429 |
| 230 | Ga0207706_10010266 | 3300025933 | Bacteria | 8562 |
| 231 | Ga0207665_10096152 | 3300025939 | Bacteria | 2060 |
| 232 | Ga0207711_10000969 | 3300025941 | Bacteria | 27463 |
| 233 | Ga0207689_10003593 | 3300025942 | Bacteria | 14162 |
| 234 | Ga0207667_10000228 | 3300025949 | Bacteria | 78952 |
| 235 | Ga0207712_10000124 | 3300025961 | Bacteria | 83410 |
| 236 | Ga0207712_10305377 | 3300025961 | Bacteria | 1308 |
| 237 | Ga0207712_10316039 | 3300025961 | Bacteria | 1287 |
| 238 | Ga0207668_10011193 | 3300025972 | Bacteria | 5445 |
| 239 | Ga0207668_10136143 | 3300025972 | Bacteria | 1882 |
| 240 | Ga0207668_10143638 | 3300025972 | Bacteria | 1839 |
| 241 | Ga0207640_10000120 | 3300025981 | Bacteria | 59715 |
| 242 | Ga0207658_10000032 | 3300025986 | Bacteria | 162260 |
| 243 | Ga0207658_10111560 | 3300025986 | Bacteria | 2163 |
| 244 | Ga0207678_10000378 | 3300026067 | Bacteria | 40708 |
| 245 | Ga0207678_10117331 | 3300026067 | Unclassified | 2271 |
| 246 | Ga0207708_10013899 | 3300026075 | Bacteria | 6018 |
| 247 | Ga0207702_10173265 | 3300026078 | Bacteria | 1981 |
| 248 | Ga0207702_10349444 | 3300026078 | Bacteria | 1414 |
| 249 | Ga0207675_100020288 | 3300026118 | Bacteria | 6197 |
| 250 | Ga0207675_100548234 | 3300026118 | Bacteria | 1155 |
| 251 | Ga0209179_1017514 | 3300027512 | Bacteria | 1358 |
| 252 | Ga0207428_10000129 | 3300027907 | Bacteria | 104467 |
| 253 | Ga0268266_10000764 | 3300028379 | Bacteria | 42997 |
| 254 | Ga0268266_10174536 | 3300028379 | Bacteria | 1953 |
| 255 | Ga0268265_10006979 | 3300028380 | Bacteria | 7640 |
| 256 | Ga0268264_10010225 | 3300028381 | Bacteria | 7765 |
| 257 | Ga0307515_10020126 | 3300028794 | Bacteria | 11935 |
| 258 | Ga0307512_10018529 | 3300030522 | Bacteria | 6358 |
| 259 | Ga0307513_10013523 | 3300031456 | Bacteria | 10013 |
| 260 | Ga0307507_10013205 | 3300033179 | Bacteria | 10067 |
| 261 | Ga0307510_10017084 | 3300033180 | Bacteria | 8560 |
| 262 | Ga0307510_10024486 | 3300033180 | Bacteria | 6973 |
| 263 | Ga0307510_10248538 | 3300033180 | Bacteria | 1268 |
| 264 | Ga0373936_0070981 | 3300035113 | Bacteria | 1435 |
| 265 | Ga0395900_0000035 | 3300037418 | Bacteria | 254301 |
| 266 | Ga0395898_0207809 | 3300037466 | Bacteria | 1868 |
| 267 | Ga0395901_0033375 | 3300038443 | Bacteria | 5313 |
| 268 | Ga0436361_0165235 | 3300039447 | Bacteria | 5547 |
| 269 | Ga0436361_0431025 | 3300039447 | Bacteria | 3393 |
| 270 | Ga0436361_0645665 | 3300039447 | Bacteria | 29461 |
| 271 | Ga0436361_0864259 | 3300039447 | Bacteria | 3525 |
| 272 | Ga0436361_1035230 | 3300039447 | Bacteria | 5145 |
| 273 | Ga0439466_0006569 | 3300041411 | Bacteria | 4417 |
| 274 | Ga0439465_0018317 | 3300041413 | Bacteria | 2188 |
| 275 | Ga0439465_0025374 | 3300041413 | Bacteria | 1870 |
| 276 | Ga0439465_0061691 | 3300041413 | Bacteria | 1243 |
| 277 | Ga0451835_0241946 | 3300041492 | Bacteria | 5513 |
| 278 | Ga0451845_0706423 | 3300041501 | Bacteria | 7524 |
| 279 | Ga0451849_0378119 | 3300041505 | Bacteria | 2844 |
| 280 | Ga0451855_1793643 | 3300041511 | Bacteria | 1482 |
| 281 | Ga0451853_2803005 | 3300041512 | Bacteria | 3915 |
| 282 | Ga0439456_009747 | 3300042013 | Bacteria | 1982 |
| 283 | Ga0439462_0019976 | 3300042015 | Bacteria | 1746 |
| 284 | Ga0439463_000088 | 3300042016 | Bacteria | 21428 |
| 285 | Ga0439434_0024696 | 3300042435 | Bacteria | 1814 |
| 286 | Ga0466969_0014693 | 3300044656 | Bacteria | 4115 |
| 287 | Ga0466972_0159299 | 3300044658 | Bacteria | 1061 |
| 288 | Ga0466982_0000002 | 3300044672 | Bacteria | 454900 |
| 289 | Ga0466982_0001214 | 3300044672 | Bacteria | 9081 |
| 290 | Ga0466965_0053560 | 3300044683 | Bacteria | 2005 |
| 291 | Ga0466966_0014642 | 3300044684 | Bacteria | 5192 |
| 292 | Ga0466966_0073888 | 3300044684 | Bacteria | 2132 |
| 293 | Ga0466966_0097293 | 3300044684 | Bacteria | 1822 |
| 294 | Ga0466961_0000643 | 3300044693 | Bacteria | 21937 |
| 295 | Ga0466961_0000993 | 3300044693 | Bacteria | 17503 |
| 296 | Ga0466961_0065787 | 3300044693 | Bacteria | 2303 |
| 297 | Ga0466963_0142432 | 3300044694 | Bacteria | 1661 |
| 298 | Ga0466964_0002071 | 3300044706 | Bacteria | 7055 |
| 299 | Ga0466971_0005331 | 3300044719 | Bacteria | 5575 |
| 300 | Ga0466968_0005525 | 3300044735 | Bacteria | 4734 |
| 301 | Ga0466968_0061075 | 3300044735 | Bacteria | 1625 |
| 302 | Ga0466970_0031649 | 3300044765 | Bacteria | 2794 |
| 303 | Ga0466970_0108407 | 3300044765 | Bacteria | 1516 |
| 304 | Ga0466970_0117238 | 3300044765 | Bacteria | 1456 |
| 305 | Ga0466957_0000548 | 3300044842 | Bacteria | 18973 |
| 306 | Ga0466957_0079181 | 3300044842 | Bacteria | 2044 |
| 307 | Ga0466957_0398066 | 3300044842 | Bacteria | 941 |
| 308 | Ga0466960_0003128 | 3300044901 | Bacteria | 6343 |
| 309 | Ga0466959_0019933 | 3300045049 | Bacteria | 4937 |
| 310 | Ga0466959_0114527 | 3300045049 | Bacteria | 1921 |
| 311 | Ga0466959_0189387 | 3300045049 | Bacteria | 1436 |
| 312 | Ga0466958_0018727 | 3300045836 | Bacteria | 4022 |
| 313 | Ga0466958_0063994 | 3300045836 | Bacteria | 2243 |
| 314 | Ga0466958_0082451 | 3300045836 | Bacteria | 1981 |
| 315 | Ga0466967_0112250 | 3300045976 | Bacteria | 2506 |
| 316 | Ga0495617_000066 | 3300046452 | Bacteria | 92026 |
| 317 | Ga0495617_000091 | 3300046452 | Bacteria | 64325 |
| 318 | Ga0495617_000176 | 3300046452 | Bacteria | 40516 |
| 319 | Ga0495627_009919 | 3300046453 | Bacteria | 3486 |
| 320 | Ga0495592_0056536 | 3300046454 | Bacteria | 2899 |
| 321 | Ga0495590_0035118 | 3300046457 | Bacteria | 1750 |
| 322 | Ga0495590_0095244 | 3300046457 | Bacteria | 1055 |
| 323 | Ga0495629_0048881 | 3300046459 | Bacteria | 2965 |
| 324 | Ga0495638_0000139 | 3300046460 | Bacteria | 114810 |
| 325 | Ga0495638_0000300 | 3300046460 | Bacteria | 63643 |
| 326 | Ga0495638_0001061 | 3300046460 | Bacteria | 26873 |
| 327 | Ga0495638_0001453 | 3300046460 | Bacteria | 21399 |
| 328 | Ga0495638_0008888 | 3300046460 | Bacteria | 7086 |
| 329 | Ga0495638_0026773 | 3300046460 | Bacteria | 3736 |
| 330 | Ga0495638_0154337 | 3300046460 | Bacteria | 1330 |
| 331 | Ga0495653_0016662 | 3300046463 | Bacteria | 5979 |
| 332 | Ga0495650_0051922 | 3300046471 | Bacteria | 1686 |
| 333 | Ga0495580_0075267 | 3300046472 | Bacteria | 2356 |
| 334 | Ga0495605_0013429 | 3300046474 | Bacteria | 4512 |
| 335 | Ga0495605_0023646 | 3300046474 | Bacteria | 3227 |
| 336 | Ga0495662_0000570 | 3300046476 | Bacteria | 16973 |
| 337 | Ga0495662_0031509 | 3300046476 | Bacteria | 2561 |
| 338 | Ga0495664_0008493 | 3300046477 | Bacteria | 5728 |
| 339 | Ga0495585_0000112 | 3300046492 | Bacteria | 87291 |
| 340 | Ga0495585_0017367 | 3300046492 | Bacteria | 4156 |
| 341 | Ga0495607_0000006 | 3300046501 | Bacteria | 281664 |
| 342 | Ga0495607_0000066 | 3300046501 | Bacteria | 103573 |
| 343 | Ga0495607_0000067 | 3300046501 | Bacteria | 102663 |
| 344 | Ga0495607_0004558 | 3300046501 | Bacteria | 10168 |
| 345 | Ga0495607_0041453 | 3300046501 | Bacteria | 2735 |
| 346 | Ga0495583_0036087 | 3300046506 | Bacteria | 2354 |
| 347 | Ga0495583_0090367 | 3300046506 | Bacteria | 1319 |
| 348 | Ga0495606_0003058 | 3300046507 | Bacteria | 18238 |
| 349 | Ga0495606_0041995 | 3300046507 | Bacteria | 3062 |
| 350 | Ga0495606_0078264 | 3300046507 | Bacteria | 2063 |
| 351 | Ga0495608_0080020 | 3300046511 | Bacteria | 2124 |
| 352 | Ga0495616_0011069 | 3300046513 | Bacteria | 5183 |
| 353 | Ga0495620_0000066 | 3300046515 | Bacteria | 89405 |
| 354 | Ga0495620_0006745 | 3300046515 | Bacteria | 6279 |
| 355 | Ga0495620_0007343 | 3300046515 | Bacteria | 5999 |
| 356 | Ga0495628_0031555 | 3300046516 | Bacteria | 4284 |
| 357 | Ga0495631_0000124 | 3300046518 | Bacteria | 51693 |
| 358 | Ga0495632_0020467 | 3300046519 | Bacteria | 3581 |
| 359 | Ga0495632_0159835 | 3300046519 | Bacteria | 1038 |
| 360 | Ga0495637_0023889 | 3300046520 | Bacteria | 2768 |
| 361 | Ga0495643_0018843 | 3300046522 | Bacteria | 3998 |
| 362 | Ga0495644_0070615 | 3300046523 | Bacteria | 1312 |
| 363 | Ga0495648_0000331 | 3300046524 | Bacteria | 52275 |
| 364 | Ga0495648_0002339 | 3300046524 | Bacteria | 17604 |
| 365 | Ga0495648_0018469 | 3300046524 | Bacteria | 4933 |
| 366 | Ga0495648_0018841 | 3300046524 | Bacteria | 4871 |
| 367 | Ga0495663_0010954 | 3300046525 | Bacteria | 2524 |
| 368 | Ga0495666_0002852 | 3300046526 | Bacteria | 8653 |
| 369 | Ga0495652_0127870 | 3300046529 | Bacteria | 2016 |
| 370 | Ga0495654_0002386 | 3300046530 | Bacteria | 12115 |
| 371 | Ga0495665_0060186 | 3300046531 | Bacteria | 2005 |
| 372 | Ga0495640_0060789 | 3300046533 | Bacteria | 2568 |
| 373 | Ga0495640_0189403 | 3300046533 | Bacteria | 1308 |
| 374 | Ga0495586_0100431 | 3300046535 | Bacteria | 1605 |
| 375 | Ga0495609_0010003 | 3300046538 | Bacteria | 4567 |
| 376 | Ga0495609_0035576 | 3300046538 | Bacteria | 2254 |
| 377 | Ga0495609_0120269 | 3300046538 | Bacteria | 1129 |
| 378 | Ga0495597_0000005 | 3300046542 | Bacteria | 286580 |
| 379 | Ga0495597_0011850 | 3300046542 | Bacteria | 4220 |
| 380 | Ga0495645_0041356 | 3300046543 | Bacteria | 3361 |
| 381 | Ga0495633_0016046 | 3300046558 | Bacteria | 3874 |
| 382 | Ga0495633_0046472 | 3300046558 | Bacteria | 2054 |
| 383 | Ga0495667_0009593 | 3300046559 | Bacteria | 6563 |
| 384 | Ga0495668_0000105 | 3300046616 | Bacteria | 133981 |
| 385 | Ga0495668_0076621 | 3300046616 | Bacteria | 1836 |
| 386 | Ga0495668_0104652 | 3300046616 | Bacteria | 1548 |
| 387 | Ga0495634_0037605 | 3300046642 | Bacteria | 3306 |
| 388 | Ga0495611_0000002 | 3300046648 | Bacteria | 705677 |
| 389 | Ga0495611_0002278 | 3300046648 | Bacteria | 8885 |
| 390 | Ga0495611_0017707 | 3300046648 | Bacteria | 3051 |
| 391 | Ga0495611_0085927 | 3300046648 | Bacteria | 1451 |
| 392 | Ga0495625_0000002 | 3300046660 | Bacteria | 813323 |
| 393 | Ga0495625_0000648 | 3300046660 | Bacteria | 50041 |
| 394 | Ga0495625_0007951 | 3300046660 | Bacteria | 9113 |
| 395 | Ga0495625_0017683 | 3300046660 | Bacteria | 5578 |
| 396 | Ga0495625_0021355 | 3300046660 | Bacteria | 4986 |
| 397 | Ga0495625_0023158 | 3300046660 | Bacteria | 4746 |
| 398 | Ga0495625_0057646 | 3300046660 | Bacteria | 2761 |
| 399 | Ga0495625_0092782 | 3300046660 | Bacteria | 2086 |
| 400 | Ga0495625_0153030 | 3300046660 | Bacteria | 1549 |
| 401 | Ga0495625_0207540 | 3300046660 | Bacteria | 1289 |
| 402 | Ga0495661_0001828 | 3300046665 | Bacteria | 17057 |
| 403 | Ga0495661_0089528 | 3300046665 | Bacteria | 1754 |
| 404 | Ga0495588_0042797 | 3300046674 | Bacteria | 2316 |
| 405 | Ga0495657_0004205 | 3300046675 | Bacteria | 11524 |
| 406 | Ga0495657_0147439 | 3300046675 | Bacteria | 1463 |
| 407 | Ga0495599_0037866 | 3300046678 | Bacteria | 3029 |
| 408 | Ga0495646_0016649 | 3300046680 | Bacteria | 4668 |
| 409 | Ga0495613_0023111 | 3300046689 | Bacteria | 4633 |
| 410 | Ga0495624_0037538 | 3300046690 | Bacteria | 3115 |
| 411 | Ga0495670_0005355 | 3300046691 | Bacteria | 6310 |
| 412 | Ga0495670_0028059 | 3300046691 | Bacteria | 2790 |
| 413 | Ga0495670_0038191 | 3300046691 | Bacteria | 2394 |
| 414 | Ga0495671_0000220 | 3300046692 | Bacteria | 49354 |
| 415 | Ga0495671_0140452 | 3300046692 | Bacteria | 1177 |
| 416 | Ga0495589_0000067 | 3300046794 | Bacteria | 99395 |
| 417 | Ga0495589_0055248 | 3300046794 | Bacteria | 1957 |
| 418 | Ga0495600_0021552 | 3300046809 | Bacteria | 4128 |
| 419 | Ga0495660_0000432 | 3300046810 | Bacteria | 35230 |
| 420 | Ga0495660_0002239 | 3300046810 | Bacteria | 12446 |
| 421 | Ga0495660_0011631 | 3300046810 | Bacteria | 5105 |
| 422 | Ga0495660_0139302 | 3300046810 | Bacteria | 1209 |
| 423 | Ga0495636_0006453 | 3300047318 | Bacteria | 4609 |
| 424 | Ga0495674_0059369 | 3300047319 | Bacteria | 3340 |
| 425 | Ga0495672_0007690 | 3300047320 | Bacteria | 8072 |
| 426 | Ga0495672_0011865 | 3300047320 | Bacteria | 6118 |
| 427 | Ga0495672_0042575 | 3300047320 | Bacteria | 2737 |
| 428 | Ga0495683_0042689 | 3300047323 | Bacteria | 2286 |
| 429 | Ga0495683_0082989 | 3300047323 | Bacteria | 1561 |
| 430 | Ga0495687_000136 | 3300047443 | Bacteria | 113298 |
| 431 | Ga0495687_023120 | 3300047443 | Bacteria | 2974 |
| 432 | Ga0495675_0013119 | 3300047444 | Bacteria | 5227 |
| 433 | Ga0495679_000003 | 3300047446 | Bacteria | 787868 |
| 434 | Ga0495673_0000293 | 3300047469 | Bacteria | 67070 |
| 435 | Ga0495673_0002760 | 3300047469 | Bacteria | 12021 |
| 436 | Ga0495673_0004862 | 3300047469 | Bacteria | 8302 |
| 437 | Ga0495673_0016493 | 3300047469 | Bacteria | 3775 |
| 438 | Ga0495684_0023089 | 3300047471 | Bacteria | 4784 |
| 439 | Ga0495686_0000024 | 3300047472 | Bacteria | 400343 |
| 440 | Ga0495686_0000769 | 3300047472 | Bacteria | 42306 |
| 441 | Ga0495686_0002120 | 3300047472 | Bacteria | 19433 |
| 442 | Ga0495686_0004287 | 3300047472 | Bacteria | 11814 |
| 443 | Ga0495686_0014472 | 3300047472 | Bacteria | 5426 |
| 444 | Ga0495686_0015344 | 3300047472 | Bacteria | 5236 |
| 445 | Ga0495626_0067585 | 3300048091 | Bacteria | 1614 |
| 446 | Ga0496100_0094557 | 3300048903 | Bacteria | 2047 |
| 447 | Ga0496101_0012871 | 3300048904 | Bacteria | 5596 |
| 448 | Ga0496101_0141082 | 3300048904 | Bacteria | 1836 |
| 449 | Ga0496104_0006478 | 3300048907 | Bacteria | 10292 |
| 450 | Ga0496105_0004378 | 3300048908 | Bacteria | 10632 |
| 451 | Ga0496106_0000028 | 3300048909 | Bacteria | 143296 |
| 452 | Ga0496106_0033388 | 3300048909 | Bacteria | 3840 |
| 453 | Ga0496106_0108491 | 3300048909 | Bacteria | 2159 |
| 454 | Ga0496107_0000291 | 3300048910 | Bacteria | 26731 |
| 455 | Ga0496107_0056313 | 3300048910 | Bacteria | 2841 |
| 456 | Ga0496113_0096063 | 3300048916 | Bacteria | 2291 |
| 457 | Ga0496115_0037183 | 3300048918 | Bacteria | 3858 |
| 458 | Ga0496117_0001480 | 3300048920 | Bacteria | 33719 |
| 459 | Ga0496117_0010079 | 3300048920 | Bacteria | 8676 |
| 460 | Ga0496117_0037920 | 3300048920 | Bacteria | 3583 |
| 461 | Ga0496117_0038843 | 3300048920 | Bacteria | 3521 |
| 462 | Ga0496117_0068594 | 3300048920 | Bacteria | 2393 |
| 463 | Ga0496117_0150352 | 3300048920 | Bacteria | 1379 |
| 464 | Ga0496117_0172381 | 3300048920 | Bacteria | 1254 |
| 465 | Ga0496118_0000268 | 3300048921 | Bacteria | 91201 |
| 466 | Ga0496118_0000374 | 3300048921 | Bacteria | 75346 |
| 467 | Ga0496118_0000423 | 3300048921 | Bacteria | 70256 |
| 468 | Ga0496118_0011225 | 3300048921 | Bacteria | 8770 |
| 469 | Ga0496118_0018654 | 3300048921 | Bacteria | 6239 |
| 470 | Ga0496118_0051128 | 3300048921 | Bacteria | 3164 |
| 471 | Ga0496118_0195356 | 3300048921 | Bacteria | 1205 |
| 472 | Ga0496119_0000537 | 3300048922 | Bacteria | 51588 |
| 473 | Ga0496119_0000906 | 3300048922 | Bacteria | 38547 |
| 474 | Ga0496119_0064067 | 3300048922 | Bacteria | 2184 |
| 475 | Ga0496119_0085573 | 3300048922 | Bacteria | 1804 |
| 476 | Ga0496119_0089214 | 3300048922 | Bacteria | 1756 |
| 477 | Ga0496119_0137504 | 3300048922 | Bacteria | 1323 |
| 478 | Ga0496120_0000055 | 3300048923 | Bacteria | 180856 |
| 479 | Ga0496120_0067515 | 3300048923 | Bacteria | 1975 |
| 480 | Ga0496121_0000101 | 3300048924 | Bacteria | 195984 |
| 481 | Ga0496121_0000116 | 3300048924 | Bacteria | 177260 |
| 482 | Ga0496121_0002027 | 3300048924 | Bacteria | 32114 |
| 483 | Ga0496121_0019715 | 3300048924 | Bacteria | 6727 |
| 484 | Ga0496121_0063007 | 3300048924 | Bacteria | 3033 |
| 485 | Ga0496121_0161229 | 3300048924 | Bacteria | 1639 |
| 486 | Ga0496121_0166376 | 3300048924 | Bacteria | 1606 |
| 487 | Ga0496121_0240580 | 3300048924 | Bacteria | 1261 |
| 488 | Ga0496122_0000302 | 3300048925 | Bacteria | 109564 |
| 489 | Ga0496122_0030501 | 3300048925 | Bacteria | 4517 |
| 490 | Ga0496122_0054340 | 3300048925 | Bacteria | 3009 |
| 491 | Ga0496122_0117019 | 3300048925 | Bacteria | 1731 |
| 492 | Ga0496122_0171623 | 3300048925 | Bacteria | 1306 |
| 493 | Ga0496123_0000239 | 3300048926 | Bacteria | 110475 |
| 494 | Ga0496123_0009680 | 3300048926 | Bacteria | 8641 |
| 495 | Ga0496123_0038520 | 3300048926 | Bacteria | 3358 |
| 496 | Ga0496123_0072420 | 3300048926 | Bacteria | 2144 |
| 497 | Ga0496124_0043555 | 3300048927 | Bacteria | 3858 |
| 498 | Ga0496124_0045276 | 3300048927 | Bacteria | 3773 |
| 499 | Ga0496124_0049468 | 3300048927 | Bacteria | 3586 |
| 500 | Ga0496124_0130032 | 3300048927 | Bacteria | 2001 |
| 501 | Ga0496124_0163240 | 3300048927 | Bacteria | 1734 |
| 502 | Ga0496125_0003171 | 3300048928 | Bacteria | 20382 |
| 503 | Ga0496125_0004359 | 3300048928 | Bacteria | 16404 |
| 504 | Ga0496126_0000896 | 3300048929 | Bacteria | 51766 |
| 505 | Ga0496126_0037975 | 3300048929 | Bacteria | 4484 |
| 506 | Ga0496126_0041077 | 3300048929 | Bacteria | 4284 |
| 507 | Ga0496126_0052203 | 3300048929 | Bacteria | 3717 |
| 508 | Ga0496126_0191634 | 3300048929 | Bacteria | 1731 |
| 509 | Ga0495678_014000 | 3300049459 | Bacteria | 3744 |
| 510 | Ga0495682_0009229 | 3300049460 | Bacteria | 3859 |
| 511 | Ga0495682_0037073 | 3300049460 | Bacteria | 1794 |
| 512 | Ga0501033_0036676 | 3300049570 | Bacteria | 3672 |
| 513 | Ga0501033_0149227 | 3300049570 | Bacteria | 1687 |
| 514 | Ga0501033_0389615 | 3300049570 | Bacteria | 973 |
| 515 | Ga0501034_0001153 | 3300049571 | Bacteria | 36629 |
| 516 | Ga0501034_0215317 | 3300049571 | Bacteria | 1875 |
| 517 | Ga0501034_0223643 | 3300049571 | Bacteria | 1834 |
| 518 | Ga0501036_0015259 | 3300049572 | Bacteria | 6414 |
| 519 | Ga0501039_0108551 | 3300049575 | Bacteria | 2169 |
| 520 | Ga0501043_0081705 | 3300049579 | Bacteria | 2539 |
| 521 | Ga0501043_0185191 | 3300049579 | Bacteria | 1621 |
| 522 | Ga0501046_0215018 | 3300049580 | Bacteria | 1425 |
| 523 | Ga0501047_0057686 | 3300049581 | Bacteria | 3754 |
| 524 | Ga0501047_0155631 | 3300049581 | Bacteria | 2159 |
| 525 | Ga0501047_0259819 | 3300049581 | Bacteria | 1584 |
| 526 | Ga0501068_0008282 | 3300049584 | Bacteria | 5778 |
| 527 | Ga0501073_0094608 | 3300049589 | Bacteria | 2075 |
| 528 | Ga0501074_0039318 | 3300049590 | Bacteria | 3426 |
| 529 | Ga0501035_0092218 | 3300049822 | Bacteria | 2665 |
| 530 | Ga0501044_0031639 | 3300049823 | Bacteria | 5568 |
| 531 | Ga0501044_0037972 | 3300049823 | Bacteria | 5032 |
| 532 | Ga0501044_0365009 | 3300049823 | Bacteria | 1361 |
| 533 | nmdc:mga03n38_18109_c1 | 3300050490 | Bacteria | 2774 |
| 534 | nmdc:mga0k408_76885_c1 | 3300050493 | Bacteria | 1951 |
| 535 | nmdc:mga07m45_248833_c1 | 3300050496 | Bacteria | 1034 |
| 536 | nmdc:mga08y16_51_c1 | 3300050511 | Bacteria | 105348 |
| 537 | nmdc:mga08x19_46707_c1 | 3300050514 | Bacteria | 2770 |
| 538 | Ga0495601_0000191 | 3300053077 | Bacteria | 32447 |
| 539 | Ga0495601_0204481 | 3300053077 | Bacteria | 1290 |
| 540 | Ga0500635_0004004 | 3300053080 | Bacteria | 3759 |
| 541 | Ga0500643_000027 | 3300053087 | Bacteria | 251062 |
| 542 | Ga0500643_000031 | 3300053087 | Bacteria | 204488 |
| 543 | Ga0500643_000097 | 3300053087 | Bacteria | 92120 |
| 544 | Ga0500643_003087 | 3300053087 | Bacteria | 8182 |
| 545 | Ga0500583_0000703 | 3300053092 | Bacteria | 9741 |
| 546 | Ga0500651_0002913 | 3300053093 | Bacteria | 9204 |
| 547 | Ga0500651_0021159 | 3300053093 | Bacteria | 4053 |
| 548 | Ga0500651_0074743 | 3300053093 | Bacteria | 2106 |
| 549 | Ga0500566_0000009 | 3300053094 | Bacteria | 131668 |
| 550 | Ga0500554_023792 | 3300053102 | Bacteria | 1727 |
| 551 | Ga0500555_003009 | 3300053103 | Bacteria | 4818 |
| 552 | Ga0500555_005778 | 3300053103 | Bacteria | 3512 |
| 553 | Ga0500556_0003089 | 3300053104 | Bacteria | 4978 |
| 554 | Ga0500556_0143085 | 3300053104 | Bacteria | 940 |
| 555 | Ga0500562_004959 | 3300053108 | Bacteria | 3355 |
| 556 | Ga0500569_000971 | 3300053109 | Bacteria | 5165 |
| 557 | Ga0500569_003562 | 3300053109 | Bacteria | 3195 |
| 558 | Ga0500572_000142 | 3300053111 | Bacteria | 24469 |
| 559 | Ga0500572_037508 | 3300053111 | Bacteria | 1389 |
| 560 | Ga0500592_014265 | 3300053116 | Bacteria | 1273 |
| 561 | Ga0500595_003417 | 3300053119 | Bacteria | 7423 |
| 562 | Ga0500597_000264 | 3300053120 | Bacteria | 10718 |
| 563 | Ga0500607_100305 | 3300053121 | Bacteria | 1439 |
| 564 | Ga0500608_012605 | 3300053122 | Bacteria | 3714 |
| 565 | Ga0500652_013262 | 3300053131 | Bacteria | 2913 |
| 566 | Ga0500652_045426 | 3300053131 | Bacteria | 1781 |
| 567 | Ga0500658_0001192 | 3300053134 | Bacteria | 10585 |
| 568 | Ga0500659_0107780 | 3300053135 | Bacteria | 1436 |
| 569 | Ga0500559_0005792 | 3300053136 | Bacteria | 5633 |
| 570 | Ga0500559_0101872 | 3300053136 | Bacteria | 1323 |
| 571 | Ga0500564_010005 | 3300053138 | Bacteria | 4147 |
| 572 | Ga0500568_0001664 | 3300053139 | Bacteria | 13928 |
| 573 | Ga0500568_0002341 | 3300053139 | Bacteria | 11225 |
| 574 | Ga0500568_0003692 | 3300053139 | Bacteria | 8400 |
| 575 | Ga0500568_0004641 | 3300053139 | Bacteria | 7310 |
| 576 | Ga0500573_0000067 | 3300053140 | Bacteria | 61890 |
| 577 | Ga0500588_0019395 | 3300053146 | Bacteria | 1808 |
| 578 | Ga0500590_087486 | 3300053148 | Bacteria | 1518 |
| 579 | Ga0500603_000016 | 3300053150 | Bacteria | 56563 |
| 580 | Ga0500604_0036277 | 3300053151 | Bacteria | 1470 |
| 581 | Ga0500616_0001502 | 3300053153 | Bacteria | 22017 |
| 582 | Ga0500616_0142798 | 3300053153 | Bacteria | 1116 |
| 583 | Ga0500619_108657 | 3300053154 | Bacteria | 943 |
| 584 | Ga0500622_0000906 | 3300053156 | Bacteria | 25193 |
| 585 | Ga0500622_0018980 | 3300053156 | Bacteria | 3653 |
| 586 | Ga0500622_0019176 | 3300053156 | Bacteria | 3633 |
| 587 | Ga0500627_0035968 | 3300053158 | Bacteria | 2106 |
| 588 | Ga0500627_0055148 | 3300053158 | Bacteria | 1739 |
| 589 | Ga0500633_0000975 | 3300053160 | Bacteria | 5042 |
| 590 | Ga0500638_030174 | 3300053162 | Bacteria | 2610 |
| 591 | Ga0500638_104347 | 3300053162 | Bacteria | 1317 |
| 592 | Ga0500639_000017 | 3300053163 | Bacteria | 114464 |
| 593 | Ga0500636_0000456 | 3300053177 | Bacteria | 22340 |
| 594 | Ga0500645_006226 | 3300053730 | Bacteria | 4282 |
| 595 | Ga0500596_000049 | 3300053735 | Bacteria | 16202 |
| 596 | Ga0500601_000025 | 3300053737 | Bacteria | 33788 |
| 597 | Ga0466962_0004210 | 3300061719 | Bacteria | 6891 |
| 598 | Ga0466962_0018712 | 3300061719 | Bacteria | 3330 |
| 599 | Ga0466962_0086113 | 3300061719 | Bacteria | 1504 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048920 | Ga0496117_0001480 | Ga0496117_0001480_21681_22481 | 266 |
| 2 | 3300048921 | Ga0496118_0000374 | Ga0496118_0000374_21708_22508 | 266 |
| 3 | 3300005441 | Ga0070700_100295987 | Ga0070700_1002959871 | 268 |
| 4 | 3300025254 | Ga0209148_1001305 | Ga0209148_10013056 | 270 |
| 5 | 3300005518 | Ga0070699_100374324 | Ga0070699_1003743241 | 271 |
| 6 | 3300005546 | Ga0070696_100014147 | Ga0070696_1000141474 | 271 |
| 7 | 3300044658 | Ga0466972_0159299 | Ga0466972_0159299_33_851 | 271 |
| 8 | 3300044684 | Ga0466966_0073888 | Ga0466966_0073888_531_1349 | 271 |
| 9 | 3300002773 | JGI25152J39213_1003362 | JGI25152J39213_10033622 | 273 |
| 10 | 3300003215 | JGI25153J46596_10011456 | JGI25153J46596_100114563 | 273 |
| 11 | 3300003354 | JGI25160J50197_1009247 | JGI25160J50197_10092474 | 273 |
| 12 | 3300003374 | JGI25161J50226_1000331 | JGI25161J50226_100033122 | 273 |
| 13 | 3300003771 | Ga0055526_1002806 | Ga0055526_10028068 | 273 |
| 14 | 3300003775 | Ga0055524_1009480 | Ga0055524_10094802 | 273 |
| 15 | 3300003790 | Ga0055528_1000864 | Ga0055528_100086419 | 273 |
| 16 | 3300003792 | Ga0055540_1004874 | Ga0055540_10048746 | 273 |
| 17 | 3300004625 | Ga0055543_1000646 | Ga0055543_10006465 | 273 |
| 18 | 3300005262 | Ga0065165_1026237 | Ga0065165_10262372 | 273 |
| 19 | 3300005548 | Ga0070665_100286607 | Ga0070665_1002866072 | 273 |
| 20 | 3300025208 | Ga0209436_100110 | Ga0209436_10011030 | 273 |
| 21 | 3300025273 | Ga0209673_1001495 | Ga0209673_100149512 | 273 |
| 22 | 3300025284 | Ga0209130_1000023 | Ga0209130_1000023219 | 273 |
| 23 | 3300025295 | Ga0209564_1000393 | Ga0209564_100039326 | 273 |
| 24 | 3300025297 | Ga0209758_1000390 | Ga0209758_100039048 | 273 |
| 25 | 3300025299 | Ga0209256_1004144 | Ga0209256_10041446 | 273 |
| 26 | 3300025302 | Ga0207426_1000087 | Ga0207426_1000087143 | 273 |
| 27 | 3300025303 | Ga0209051_1003739 | Ga0209051_10037396 | 273 |
| 28 | 3300041413 | Ga0439465_0025374 | Ga0439465_0025374_218_1120 | 273 |
| 29 | 3300046501 | Ga0495607_0041453 | Ga0495607_0041453_1695_2597 | 273 |
| 30 | 3300046538 | Ga0495609_0120269 | Ga0495609_0120269_78_980 | 274 |
| 31 | 3300046660 | Ga0495625_0153030 | Ga0495625_0153030_380_1282 | 274 |
| 32 | 3300025297 | Ga0209758_1078282 | Ga0209758_10782821 | 275 |
| 33 | 3300046457 | Ga0495590_0095244 | Ga0495590_0095244_91_993 | 275 |
| 34 | 3300048091 | Ga0495626_0067585 | Ga0495626_0067585_30_932 | 275 |
| 35 | 3300048927 | Ga0496124_0049468 | Ga0496124_0049468_297_1199 | 275 |
| 36 | 3300053136 | Ga0500559_0005792 | Ga0500559_0005792_4778_5608 | 275 |
| 37 | 3300025258 | Ga0209129_1005143 | Ga0209129_10051433 | 276 |
| 38 | 3300025294 | Ga0209025_1060118 | Ga0209025_10601182 | 276 |
| 39 | 3300025297 | Ga0209758_1000422 | Ga0209758_10004222 | 276 |
| 40 | 3300053160 | Ga0500633_0000975 | Ga0500633_0000975_3046_3948 | 276 |
| 41 | 3300046501 | Ga0495607_0004558 | Ga0495607_0004558_4737_5633 | 278 |
| 42 | 3300045836 | Ga0466958_0082451 | Ga0466958_0082451_669_1568 | 280 |
| 43 | 3300046506 | Ga0495583_0036087 | Ga0495583_0036087_1476_2321 | 280 |
| 44 | 3300061719 | Ga0466962_0086113 | Ga0466962_0086113_316_1215 | 280 |
| 45 | 3300048903 | Ga0496100_0094557 | Ga0496100_0094557_21_872 | 282 |
| 46 | 3300050496 | nmdc:mga07m45_248833_c1 | nmdc:mga07m45_248833_c1_12_863 | 282 |
| 47 | 3300046460 | Ga0495638_0154337 | Ga0495638_0154337_43_963 | 283 |
| 48 | 3300039447 | Ga0436361_0431025 | Ga0436361_0431025_257_1144 | 284 |
| 49 | 3300002773 | JGI25152J39213_1003573 | JGI25152J39213_10035734 | 286 |
| 50 | 3300003215 | JGI25153J46596_10007668 | JGI25153J46596_100076684 | 286 |
| 51 | 3300025245 | Ga0207425_1001672 | Ga0207425_10016722 | 286 |
| 52 | 3300025258 | Ga0209129_1003999 | Ga0209129_10039993 | 286 |
| 53 | 3300025294 | Ga0209025_1024943 | Ga0209025_10249432 | 286 |
| 54 | 3300025297 | Ga0209758_1000792 | Ga0209758_100079238 | 286 |
| 55 | iso_pu_bacteria | 2977516862 | 2977521676 | 286 |
| 56 | 3300053140 | Ga0500573_0000067 | Ga0500573_0000067_36714_37613 | 287 |
| 57 | 3300006173 | Ga0070716_100112198 | Ga0070716_1001121981 | 288 |
| 58 | 3300025292 | Ga0209676_1000286 | Ga0209676_100028626 | 288 |
| 59 | 3300046507 | Ga0495606_0003058 | Ga0495606_0003058_4894_5796 | 288 |
| 60 | 3300046524 | Ga0495648_0002339 | Ga0495648_0002339_12497_13396 | 288 |
| 61 | 3300046525 | Ga0495663_0010954 | Ga0495663_0010954_1606_2505 | 288 |
| 62 | 3300046648 | Ga0495611_0002278 | Ga0495611_0002278_1843_2742 | 288 |
| 63 | 3300046660 | Ga0495625_0000648 | Ga0495625_0000648_27934_28833 | 288 |
| 64 | 3300046691 | Ga0495670_0005355 | Ga0495670_0005355_1789_2688 | 288 |
| 65 | 3300047443 | Ga0495687_000136 | Ga0495687_000136_4217_5116 | 288 |
| 66 | 3300047472 | Ga0495686_0004287 | Ga0495686_0004287_6622_7524 | 288 |
| 67 | 3300048924 | Ga0496121_0240580 | Ga0496121_0240580_216_1118 | 288 |
| 68 | 3300053092 | Ga0500583_0000703 | Ga0500583_0000703_4691_5590 | 288 |
| 69 | iso_pu_bacteria | 2841957949 | 2841961257 | 288 |
| 70 | 3300046471 | Ga0495650_0051922 | Ga0495650_0051922_745_1647 | 289 |
| 71 | 3300047443 | Ga0495687_023120 | Ga0495687_023120_1984_2856 | 289 |
| 72 | 3300053109 | Ga0500569_003562 | Ga0500569_003562_2263_3135 | 289 |
| 73 | 3300053119 | Ga0500595_003417 | Ga0500595_003417_4748_5620 | 289 |
| 74 | 3300053146 | Ga0500588_0019395 | Ga0500588_0019395_461_1333 | 289 |
| 75 | 3300006186 | Ga0075369_10016370 | Ga0075369_100163703 | 290 |
| 76 | 3300025231 | Ga0207427_101222 | Ga0207427_1012227 | 291 |
| 77 | 3300003659 | JGI25404J52841_10002599 | JGI25404J52841_100025993 | 292 |
| 78 | 3300005937 | Ga0081455_10040306 | Ga0081455_100403064 | 292 |
| 79 | 3300005983 | Ga0081540_1001968 | Ga0081540_10019683 | 292 |
| 80 | 3300005983 | Ga0081540_1004717 | Ga0081540_10047174 | 292 |
| 81 | 3300053080 | Ga0500635_0004004 | Ga0500635_0004004_1263_2144 | 292 |
| 82 | 3300053093 | Ga0500651_0074743 | Ga0500651_0074743_860_1741 | 292 |
| 83 | 3300053111 | Ga0500572_037508 | Ga0500572_037508_294_1175 | 292 |
| 84 | 3300053122 | Ga0500608_012605 | Ga0500608_012605_937_1818 | 292 |
| 85 | 3300053136 | Ga0500559_0101872 | Ga0500559_0101872_16_897 | 292 |
| 86 | 3300053138 | Ga0500564_010005 | Ga0500564_010005_3079_3960 | 292 |
| 87 | 3300053148 | Ga0500590_087486 | Ga0500590_087486_78_959 | 292 |
| 88 | 3300053154 | Ga0500619_108657 | Ga0500619_108657_51_932 | 292 |
| 89 | 3300053162 | Ga0500638_104347 | Ga0500638_104347_375_1256 | 292 |
| 90 | 3300053177 | Ga0500636_0000456 | Ga0500636_0000456_18381_19262 | 292 |
| 91 | 3300053737 | Ga0500601_000025 | Ga0500601_000025_22784_23665 | 292 |
| 92 | iso_pu_bacteria | 2593339238 | 2595448944 | 292 |
| 93 | iso_pu_bacteria | 2738543009 | 2739225924 | 292 |
| 94 | iso_pu_bacteria | 2818991449 | 2819617828 | 292 |
| 95 | iso_pu_bacteria | 2824600985 | 2824604872 | 292 |
| 96 | iso_pu_bacteria | 2824609381 | 2824611377 | 292 |
| 97 | iso_pu_bacteria | 2824653114 | 2824656064 | 292 |
| 98 | iso_pu_bacteria | 2876761206 | 2876764475 | 292 |
| 99 | iso_pu_bacteria | 2884960567 | 2884961938 | 292 |
| 100 | iso_pu_bacteria | 2888419890 | 2888421605 | 292 |
| 101 | 3300025297 | Ga0209758_1005297 | Ga0209758_10052974 | 293 |
| 102 | iso_pu_bacteria | 2511231006 | 2511265279 | 293 |
| 103 | iso_pu_bacteria | 2597489887 | 2597855458 | 293 |
| 104 | iso_pu_bacteria | 2599185185 | 2599485344 | 293 |
| 105 | iso_pu_bacteria | 2599185257 | 2599806488 | 293 |
| 106 | iso_pu_bacteria | 2599185354 | 2600201146 | 293 |
| 107 | iso_pu_bacteria | 2671180172 | 2671772139 | 293 |
| 108 | iso_pu_bacteria | 2884338543 | 2884338894 | 293 |
| 109 | iso_pu_bacteria | 2919085039 | 2919086411 | 293 |
| 110 | iso_pu_bacteria | 2941471342 | 2941471972 | 293 |
| 111 | iso_pu_bacteria | 8005301065 | 8005306227 | 293 |
| 112 | iso_pu_bacteria | 8005688590 | 8005694076 | 293 |
| 113 | 3300005937 | Ga0081455_10022242 | Ga0081455_100222424 | 294 |
| 114 | 3300025939 | Ga0207665_10096152 | Ga0207665_100961522 | 294 |
| 115 | 3300046501 | Ga0495607_0000066 | Ga0495607_0000066_82250_83185 | 294 |
| 116 | 3300046520 | Ga0495637_0023889 | Ga0495637_0023889_1559_2494 | 294 |
| 117 | 3300047320 | Ga0495672_0042575 | Ga0495672_0042575_1450_2385 | 294 |
| 118 | iso_pu_bacteria | 2510917028 | 2511182805 | 294 |
| 119 | iso_pu_bacteria | 2513237138 | 2513869760 | 294 |
| 120 | iso_pu_bacteria | 2534681796 | 2535517331 | 294 |
| 121 | iso_pu_bacteria | 2582581294 | 2585204586 | 294 |
| 122 | iso_pu_bacteria | 2582581867 | 2585402851 | 294 |
| 123 | iso_pu_bacteria | 2582581867 | 2585403944 | 294 |
| 124 | iso_pu_bacteria | 2585427590 | 2585823487 | 294 |
| 125 | iso_pu_bacteria | 2585427590 | 2585825175 | 294 |
| 126 | iso_pu_bacteria | 2643221599 | 2644003012 | 294 |
| 127 | iso_pu_bacteria | 2643221723 | 2644672122 | 294 |
| 128 | iso_pu_bacteria | 2857504554 | 2857507260 | 294 |
| 129 | iso_pu_bacteria | 2876761206 | 2876765390 | 294 |
| 130 | iso_pu_bacteria | 2896384573 | 2896390935 | 294 |
| 131 | iso_pu_bacteria | 2909042592 | 2909048136 | 294 |
| 132 | iso_pu_bacteria | 2923556063 | 2923562020 | 294 |
| 133 | iso_pu_bacteria | 2928135762 | 2928135817 | 294 |
| 134 | iso_pu_bacteria | 2928531327 | 2928533353 | 294 |
| 135 | iso_pu_bacteria | 2957415311 | 2957420911 | 294 |
| 136 | iso_pu_bacteria | 2996887358 | 2996892620 | 294 |
| 137 | iso_pu_bacteria | 3005452660 | 3005455148 | 294 |
| 138 | iso_pu_bacteria | 8005258706 | 8005264753 | 294 |
| 139 | iso_pu_bacteria | 8005321885 | 8005327147 | 294 |
| 140 | 3300044656 | Ga0466969_0014693 | Ga0466969_0014693_2183_3073 | 295 |
| 141 | 3300044684 | Ga0466966_0097293 | Ga0466966_0097293_553_1443 | 295 |
| 142 | 3300044693 | Ga0466961_0065787 | Ga0466961_0065787_252_1142 | 295 |
| 143 | 3300044765 | Ga0466970_0108407 | Ga0466970_0108407_523_1413 | 295 |
| 144 | 3300044842 | Ga0466957_0000548 | Ga0466957_0000548_6363_7253 | 295 |
| 145 | 3300045049 | Ga0466959_0019933 | Ga0466959_0019933_3086_3976 | 295 |
| 146 | 3300048922 | Ga0496119_0064067 | Ga0496119_0064067_1171_2091 | 295 |
| 147 | iso_pu_bacteria | 2513237144 | 2513910555 | 295 |
| 148 | iso_pu_bacteria | 2513237162 | 2514017821 | 295 |
| 149 | iso_pu_bacteria | 2551306085 | 2551683215 | 295 |
| 150 | iso_pu_bacteria | 2551306089 | 2551709168 | 295 |
| 151 | iso_pu_bacteria | 2551306089 | 2551714063 | 295 |
| 152 | iso_pu_bacteria | 2582581299 | 2585230764 | 295 |
| 153 | iso_pu_bacteria | 2582581304 | 2585257773 | 295 |
| 154 | iso_pu_bacteria | 2582581308 | 2585280505 | 295 |
| 155 | iso_pu_bacteria | 2582581315 | 2585322777 | 295 |
| 156 | iso_pu_bacteria | 2585427527 | 2585532732 | 295 |
| 157 | iso_pu_bacteria | 2585427530 | 2585554252 | 295 |
| 158 | iso_pu_bacteria | 2585427608 | 2585898743 | 295 |
| 159 | iso_pu_bacteria | 2615840626 | 2616307139 | 295 |
| 160 | iso_pu_bacteria | 2615840698 | 2616554740 | 295 |
| 161 | iso_pu_bacteria | 2617270742 | 2617383093 | 295 |
| 162 | iso_pu_bacteria | 2643221634 | 2644196750 | 295 |
| 163 | iso_pu_bacteria | 2643221643 | 2644237984 | 295 |
| 164 | iso_pu_bacteria | 2643221689 | 2644497927 | 295 |
| 165 | iso_pu_bacteria | 2667528174 | 2671111977 | 295 |
| 166 | iso_pu_bacteria | 2724679232 | 2725949291 | 295 |
| 167 | iso_pu_bacteria | 2818991448 | 2819609799 | 295 |
| 168 | iso_pu_bacteria | 2818991453 | 2819639901 | 295 |
| 169 | iso_pu_bacteria | 2838029111 | 2838034022 | 295 |
| 170 | iso_pu_bacteria | 2842475841 | 2842480810 | 295 |
| 171 | iso_pu_bacteria | 2842482326 | 2842483585 | 295 |
| 172 | iso_pu_bacteria | 2842502639 | 2842507379 | 295 |
| 173 | iso_pu_bacteria | 2874168670 | 2874169225 | 295 |
| 174 | iso_pu_bacteria | 2882456835 | 2882463315 | 295 |
| 175 | iso_pu_bacteria | 2896384573 | 2896389829 | 295 |
| 176 | iso_pu_bacteria | 2916048683 | 2916048732 | 295 |
| 177 | iso_pu_bacteria | 2916076590 | 2916082863 | 295 |
| 178 | iso_pu_bacteria | 2919100787 | 2919105679 | 295 |
| 179 | iso_pu_bacteria | 2919408235 | 2919410481 | 295 |
| 180 | iso_pu_bacteria | 2957402308 | 2957406613 | 295 |
| 181 | iso_pu_bacteria | 2970054988 | 2970058958 | 295 |
| 182 | iso_pu_bacteria | 3005409236 | 3005409312 | 295 |
| 183 | iso_pu_bacteria | 3005416602 | 3005418687 | 295 |
| 184 | iso_pu_bacteria | 3005445848 | 3005448918 | 295 |
| 185 | iso_pu_bacteria | 8005314921 | 8005318421 | 295 |
| 186 | iso_pu_bacteria | 8005484373 | 8005488695 | 295 |
| 187 | iso_pu_bacteria | 8005563573 | 8005568490 | 295 |
| 188 | iso_pu_bacteria | 8005645114 | 8005645924 | 295 |
| 189 | iso_pu_bacteria | 8005682033 | 8005682398 | 295 |
| 190 | 3300003761 | Ga0055535_1000375 | Ga0055535_100037518 | 296 |
| 191 | 3300003762 | Ga0055542_1000215 | Ga0055542_100021518 | 296 |
| 192 | 3300005262 | Ga0065165_1000199 | Ga0065165_100019961 | 296 |
| 193 | 3300005344 | Ga0070661_100013998 | Ga0070661_1000139985 | 296 |
| 194 | 3300005356 | Ga0070674_100091000 | Ga0070674_1000910001 | 296 |
| 195 | 3300005367 | Ga0070667_100006154 | Ga0070667_1000061542 | 296 |
| 196 | 3300005434 | Ga0070709_10037640 | Ga0070709_100376403 | 296 |
| 197 | 3300005436 | Ga0070713_100011166 | Ga0070713_1000111664 | 296 |
| 198 | 3300005439 | Ga0070711_100021813 | Ga0070711_1000218132 | 296 |
| 199 | 3300005444 | Ga0070694_100182492 | Ga0070694_1001824922 | 296 |
| 200 | 3300005546 | Ga0070696_100063955 | Ga0070696_1000639552 | 296 |
| 201 | 3300005719 | Ga0068861_100377894 | Ga0068861_1003778942 | 296 |
| 202 | 3300005843 | Ga0068860_100143228 | Ga0068860_1001432281 | 296 |
| 203 | 3300005937 | Ga0081455_10065672 | Ga0081455_100656722 | 296 |
| 204 | 3300006173 | Ga0070716_100008492 | Ga0070716_1000084926 | 296 |
| 205 | 3300006175 | Ga0070712_100012612 | Ga0070712_1000126123 | 296 |
| 206 | 3300009092 | Ga0105250_10023960 | Ga0105250_100239602 | 296 |
| 207 | 3300009098 | Ga0105245_10361143 | Ga0105245_103611432 | 296 |
| 208 | 3300009553 | Ga0105249_10096321 | Ga0105249_100963212 | 296 |
| 209 | 3300010375 | Ga0105239_10225837 | Ga0105239_102258372 | 296 |
| 210 | 3300013296 | Ga0157374_10462300 | Ga0157374_104623002 | 296 |
| 211 | 3300013306 | Ga0163162_10008330 | Ga0163162_100083302 | 296 |
| 212 | 3300013308 | Ga0157375_10145570 | Ga0157375_101455702 | 296 |
| 213 | 3300014326 | Ga0157380_10220533 | Ga0157380_102205332 | 296 |
| 214 | 3300025228 | Ga0209672_101334 | Ga0209672_1013346 | 296 |
| 215 | 3300025229 | Ga0209147_111962 | Ga0209147_1119621 | 296 |
| 216 | 3300025242 | Ga0209258_100290 | Ga0209258_10029029 | 296 |
| 217 | 3300025254 | Ga0209148_1000262 | Ga0209148_100026229 | 296 |
| 218 | 3300025272 | Ga0209455_1002312 | Ga0209455_10023124 | 296 |
| 219 | 3300025297 | Ga0209758_1009269 | Ga0209758_10092692 | 296 |
| 220 | 3300025302 | Ga0207426_1004887 | Ga0207426_10048875 | 296 |
| 221 | 3300025303 | Ga0209051_1008707 | Ga0209051_10087076 | 296 |
| 222 | 3300025711 | Ga0207696_1029952 | Ga0207696_10299521 | 296 |
| 223 | 3300025885 | Ga0207653_10058255 | Ga0207653_100582551 | 296 |
| 224 | 3300025898 | Ga0207692_10016657 | Ga0207692_100166572 | 296 |
| 225 | 3300025906 | Ga0207699_10006403 | Ga0207699_100064035 | 296 |
| 226 | 3300025923 | Ga0207681_10023218 | Ga0207681_100232183 | 296 |
| 227 | 3300025933 | Ga0207706_10010266 | Ga0207706_100102664 | 296 |
| 228 | 3300025942 | Ga0207689_10003593 | Ga0207689_100035938 | 296 |
| 229 | 3300025961 | Ga0207712_10305377 | Ga0207712_103053772 | 296 |
| 230 | 3300025972 | Ga0207668_10011193 | Ga0207668_100111932 | 296 |
| 231 | 3300025986 | Ga0207658_10111560 | Ga0207658_101115602 | 296 |
| 232 | 3300026067 | Ga0207678_10117331 | Ga0207678_101173312 | 296 |
| 233 | 3300026075 | Ga0207708_10013899 | Ga0207708_100138993 | 296 |
| 234 | 3300026118 | Ga0207675_100020288 | Ga0207675_1000202888 | 296 |
| 235 | 3300026118 | Ga0207675_100548234 | Ga0207675_1005482342 | 296 |
| 236 | 3300028380 | Ga0268265_10006979 | Ga0268265_100069794 | 296 |
| 237 | 3300033179 | Ga0307507_10013205 | Ga0307507_100132054 | 296 |
| 238 | 3300033180 | Ga0307510_10024486 | Ga0307510_100244864 | 296 |
| 239 | 3300033180 | Ga0307510_10248538 | Ga0307510_102485382 | 296 |
| 240 | 3300035113 | Ga0373936_0070981 | Ga0373936_0070981_511_1404 | 296 |
| 241 | 3300044672 | Ga0466982_0000002 | Ga0466982_0000002_280555_281496 | 296 |
| 242 | 3300044672 | Ga0466982_0001214 | Ga0466982_0001214_2102_2995 | 296 |
| 243 | 3300044684 | Ga0466966_0014642 | Ga0466966_0014642_2609_3550 | 296 |
| 244 | 3300044693 | Ga0466961_0000993 | Ga0466961_0000993_13170_14063 | 296 |
| 245 | 3300044706 | Ga0466964_0002071 | Ga0466964_0002071_3568_4509 | 296 |
| 246 | 3300044719 | Ga0466971_0005331 | Ga0466971_0005331_3183_4124 | 296 |
| 247 | 3300044735 | Ga0466968_0005525 | Ga0466968_0005525_3470_4411 | 296 |
| 248 | 3300044842 | Ga0466957_0398066 | Ga0466957_0398066_15_908 | 296 |
| 249 | 3300044901 | Ga0466960_0003128 | Ga0466960_0003128_3090_4031 | 296 |
| 250 | 3300045049 | Ga0466959_0114527 | Ga0466959_0114527_169_1110 | 296 |
| 251 | 3300046452 | Ga0495617_000091 | Ga0495617_000091_23320_24213 | 296 |
| 252 | 3300046452 | Ga0495617_000176 | Ga0495617_000176_31358_32251 | 296 |
| 253 | 3300046460 | Ga0495638_0000139 | Ga0495638_0000139_46782_47675 | 296 |
| 254 | 3300046460 | Ga0495638_0001453 | Ga0495638_0001453_10914_11807 | 296 |
| 255 | 3300046492 | Ga0495585_0000112 | Ga0495585_0000112_48457_49350 | 296 |
| 256 | 3300046501 | Ga0495607_0000067 | Ga0495607_0000067_100607_101500 | 296 |
| 257 | 3300046513 | Ga0495616_0011069 | Ga0495616_0011069_1597_2490 | 296 |
| 258 | 3300046515 | Ga0495620_0000066 | Ga0495620_0000066_23320_24213 | 296 |
| 259 | 3300046518 | Ga0495631_0000124 | Ga0495631_0000124_2311_3204 | 296 |
| 260 | 3300046519 | Ga0495632_0159835 | Ga0495632_0159835_17_928 | 296 |
| 261 | 3300046524 | Ga0495648_0000331 | Ga0495648_0000331_2226_3119 | 296 |
| 262 | 3300046538 | Ga0495609_0010003 | Ga0495609_0010003_2061_2954 | 296 |
| 263 | 3300046616 | Ga0495668_0104652 | Ga0495668_0104652_322_1215 | 296 |
| 264 | 3300046648 | Ga0495611_0000002 | Ga0495611_0000002_546880_547773 | 296 |
| 265 | 3300046648 | Ga0495611_0017707 | Ga0495611_0017707_586_1479 | 296 |
| 266 | 3300046648 | Ga0495611_0085927 | Ga0495611_0085927_459_1352 | 296 |
| 267 | 3300046660 | Ga0495625_0000002 | Ga0495625_0000002_551365_552258 | 296 |
| 268 | 3300046665 | Ga0495661_0001828 | Ga0495661_0001828_15515_16408 | 296 |
| 269 | 3300046692 | Ga0495671_0000220 | Ga0495671_0000220_13587_14480 | 296 |
| 270 | 3300046794 | Ga0495589_0000067 | Ga0495589_0000067_21300_22193 | 296 |
| 271 | 3300046810 | Ga0495660_0000432 | Ga0495660_0000432_15193_16086 | 296 |
| 272 | 3300046810 | Ga0495660_0139302 | Ga0495660_0139302_183_1094 | 296 |
| 273 | 3300047323 | Ga0495683_0082989 | Ga0495683_0082989_582_1538 | 296 |
| 274 | 3300047446 | Ga0495679_000003 | Ga0495679_000003_248176_249069 | 296 |
| 275 | 3300047469 | Ga0495673_0004862 | Ga0495673_0004862_697_1590 | 296 |
| 276 | 3300047469 | Ga0495673_0016493 | Ga0495673_0016493_1714_2607 | 296 |
| 277 | 3300047472 | Ga0495686_0015344 | Ga0495686_0015344_4332_5225 | 296 |
| 278 | 3300048920 | Ga0496117_0068594 | Ga0496117_0068594_1213_2106 | 296 |
| 279 | 3300048921 | Ga0496118_0051128 | Ga0496118_0051128_1307_2200 | 296 |
| 280 | 3300048922 | Ga0496119_0137504 | Ga0496119_0137504_80_973 | 296 |
| 281 | 3300048924 | Ga0496121_0166376 | Ga0496121_0166376_468_1361 | 296 |
| 282 | 3300048927 | Ga0496124_0045276 | Ga0496124_0045276_241_1134 | 296 |
| 283 | 3300048929 | Ga0496126_0041077 | Ga0496126_0041077_1392_2285 | 296 |
| 284 | 3300048929 | Ga0496126_0052203 | Ga0496126_0052203_2219_3136 | 296 |
| 285 | 3300049460 | Ga0495682_0009229 | Ga0495682_0009229_643_1536 | 296 |
| 286 | 3300053087 | Ga0500643_000031 | Ga0500643_000031_41151_42044 | 296 |
| 287 | 3300053087 | Ga0500643_000097 | Ga0500643_000097_67334_68227 | 296 |
| 288 | 3300053094 | Ga0500566_0000009 | Ga0500566_0000009_79449_80342 | 296 |
| 289 | 3300053103 | Ga0500555_003009 | Ga0500555_003009_3033_3926 | 296 |
| 290 | 3300053103 | Ga0500555_005778 | Ga0500555_005778_800_1693 | 296 |
| 291 | 3300053104 | Ga0500556_0003089 | Ga0500556_0003089_3854_4747 | 296 |
| 292 | 3300053108 | Ga0500562_004959 | Ga0500562_004959_754_1647 | 296 |
| 293 | 3300053111 | Ga0500572_000142 | Ga0500572_000142_8003_8896 | 296 |
| 294 | 3300053131 | Ga0500652_013262 | Ga0500652_013262_43_936 | 296 |
| 295 | 3300053131 | Ga0500652_045426 | Ga0500652_045426_846_1739 | 296 |
| 296 | 3300053139 | Ga0500568_0004641 | Ga0500568_0004641_6128_7021 | 296 |
| 297 | 3300053150 | Ga0500603_000016 | Ga0500603_000016_51790_52683 | 296 |
| 298 | 3300053151 | Ga0500604_0036277 | Ga0500604_0036277_529_1422 | 296 |
| 299 | 3300053156 | Ga0500622_0019176 | Ga0500622_0019176_811_1704 | 296 |
| 300 | 3300053158 | Ga0500627_0035968 | Ga0500627_0035968_313_1206 | 296 |
| 301 | 3300053158 | Ga0500627_0055148 | Ga0500627_0055148_719_1612 | 296 |
| 302 | 3300053162 | Ga0500638_030174 | Ga0500638_030174_975_1868 | 296 |
| 303 | 3300053163 | Ga0500639_000017 | Ga0500639_000017_31970_32863 | 296 |
| 304 | 3300053730 | Ga0500645_006226 | Ga0500645_006226_2845_3738 | 296 |
| 305 | 3300053735 | Ga0500596_000049 | Ga0500596_000049_4992_5885 | 296 |
| 306 | 3300061719 | Ga0466962_0018712 | Ga0466962_0018712_1116_2057 | 296 |
| 307 | iso_pu_bacteria | 2511231027 | 2511388523 | 296 |
| 308 | iso_pu_bacteria | 2582581280 | 2585151975 | 296 |
| 309 | iso_pu_bacteria | 2582581293 | 2585194539 | 296 |
| 310 | iso_pu_bacteria | 2842871566 | 2842875366 | 296 |
| 311 | iso_pu_bacteria | 8005542996 | 8005546146 | 296 |
| 312 | 3300002705 | JGI25156J39149_1009817 | JGI25156J39149_10098172 | 297 |
| 313 | 3300002741 | JGI25157J39369_1000331 | JGI25157J39369_100033112 | 297 |
| 314 | 3300005288 | Ga0065714_10002557 | Ga0065714_1000255712 | 297 |
| 315 | 3300005344 | Ga0070661_100044404 | Ga0070661_1000444042 | 297 |
| 316 | 3300005548 | Ga0070665_100027525 | Ga0070665_1000275253 | 297 |
| 317 | 3300005844 | Ga0068862_100045422 | Ga0068862_1000454222 | 297 |
| 318 | 3300006914 | Ga0075436_100020617 | Ga0075436_1000206173 | 297 |
| 319 | 3300009174 | Ga0105241_10092223 | Ga0105241_100922233 | 297 |
| 320 | 3300009551 | Ga0105238_10000611 | Ga0105238_1000061126 | 297 |
| 321 | 3300013104 | Ga0157370_10087637 | Ga0157370_100876372 | 297 |
| 322 | 3300013105 | Ga0157369_10008814 | Ga0157369_1000881411 | 297 |
| 323 | 3300014497 | Ga0182008_10036340 | Ga0182008_100363402 | 297 |
| 324 | 3300015265 | Ga0182005_1000112 | Ga0182005_100011243 | 297 |
| 325 | 3300021361 | Ga0213872_10001285 | Ga0213872_100012855 | 297 |
| 326 | 3300025250 | Ga0209026_1000064 | Ga0209026_1000064174 | 297 |
| 327 | 3300025256 | Ga0209759_1000518 | Ga0209759_100051812 | 297 |
| 328 | 3300025904 | Ga0207647_10000014 | Ga0207647_1000001420 | 297 |
| 329 | 3300030522 | Ga0307512_10018529 | Ga0307512_100185293 | 297 |
| 330 | 3300033180 | Ga0307510_10017084 | Ga0307510_100170843 | 297 |
| 331 | 3300037418 | Ga0395900_0000035 | Ga0395900_0000035_49176_50096 | 297 |
| 332 | 3300038443 | Ga0395901_0033375 | Ga0395901_0033375_1694_2614 | 297 |
| 333 | 3300039447 | Ga0436361_0165235 | Ga0436361_0165235_2184_3077 | 297 |
| 334 | 3300042013 | Ga0439456_009747 | Ga0439456_009747_1034_1930 | 297 |
| 335 | 3300042015 | Ga0439462_0019976 | Ga0439462_0019976_198_1094 | 297 |
| 336 | 3300042016 | Ga0439463_000088 | Ga0439463_000088_6031_6927 | 297 |
| 337 | 3300046452 | Ga0495617_000066 | Ga0495617_000066_27891_28787 | 297 |
| 338 | 3300046453 | Ga0495627_009919 | Ga0495627_009919_1391_2287 | 297 |
| 339 | 3300046457 | Ga0495590_0035118 | Ga0495590_0035118_688_1584 | 297 |
| 340 | 3300046460 | Ga0495638_0026773 | Ga0495638_0026773_938_1834 | 297 |
| 341 | 3300046474 | Ga0495605_0023646 | Ga0495605_0023646_1422_2318 | 297 |
| 342 | 3300046660 | Ga0495625_0017683 | Ga0495625_0017683_1348_2244 | 297 |
| 343 | 3300046660 | Ga0495625_0057646 | Ga0495625_0057646_815_1711 | 297 |
| 344 | 3300046691 | Ga0495670_0028059 | Ga0495670_0028059_817_1713 | 297 |
| 345 | 3300047472 | Ga0495686_0000024 | Ga0495686_0000024_36964_37860 | 297 |
| 346 | 3300048920 | Ga0496117_0010079 | Ga0496117_0010079_2926_3822 | 297 |
| 347 | 3300048920 | Ga0496117_0037920 | Ga0496117_0037920_183_1079 | 297 |
| 348 | 3300048921 | Ga0496118_0000268 | Ga0496118_0000268_72003_72899 | 297 |
| 349 | 3300048921 | Ga0496118_0000423 | Ga0496118_0000423_8058_8954 | 297 |
| 350 | 3300048924 | Ga0496121_0000116 | Ga0496121_0000116_176301_177197 | 297 |
| 351 | 3300048925 | Ga0496122_0117019 | Ga0496122_0117019_42_938 | 297 |
| 352 | 3300048926 | Ga0496123_0038520 | Ga0496123_0038520_987_1883 | 297 |
| 353 | 3300048928 | Ga0496125_0003171 | Ga0496125_0003171_8675_9571 | 297 |
| 354 | 3300049460 | Ga0495682_0037073 | Ga0495682_0037073_397_1293 | 297 |
| 355 | 3300049589 | Ga0501073_0094608 | Ga0501073_0094608_256_1155 | 297 |
| 356 | 3300050514 | nmdc:mga08x19_46707_c1 | nmdc:mga08x19_46707_c1_1781_2689 | 297 |
| 357 | 3300053087 | Ga0500643_000027 | Ga0500643_000027_63438_64334 | 297 |
| 358 | 3300053116 | Ga0500592_014265 | Ga0500592_014265_157_1053 | 297 |
| 359 | iso_pu_bacteria | 2521172590 | 2521557203 | 297 |
| 360 | 3300002737 | JGI25162J39368_1000206 | JGI25162J39368_100020613 | 298 |
| 361 | 3300002739 | JGI25158J39367_1001462 | JGI25158J39367_10014624 | 298 |
| 362 | 3300002741 | JGI25157J39369_1000580 | JGI25157J39369_10005808 | 298 |
| 363 | 3300002771 | JGI25163J39215_1000434 | JGI25163J39215_10004348 | 298 |
| 364 | 3300002772 | JGI25164J39214_1000091 | JGI25164J39214_100009181 | 298 |
| 365 | 3300002987 | JGI25159J45721_1000175 | JGI25159J45721_100017525 | 298 |
| 366 | 3300003187 | JGI25151J46595_10000373 | JGI25151J46595_1000037334 | 298 |
| 367 | 3300003214 | JGI25165J46597_1000196 | JGI25165J46597_100019681 | 298 |
| 368 | 3300003354 | JGI25160J50197_1000365 | JGI25160J50197_100036525 | 298 |
| 369 | 3300003374 | JGI25161J50226_1000280 | JGI25161J50226_100028015 | 298 |
| 370 | 3300003751 | Ga0055538_1002018 | Ga0055538_10020184 | 298 |
| 371 | 3300003761 | Ga0055535_1000240 | Ga0055535_100024051 | 298 |
| 372 | 3300003762 | Ga0055542_1000244 | Ga0055542_100024413 | 298 |
| 373 | 3300003763 | Ga0055529_1000170 | Ga0055529_100017081 | 298 |
| 374 | 3300003771 | Ga0055526_1001092 | Ga0055526_100109227 | 298 |
| 375 | 3300003775 | Ga0055524_1018050 | Ga0055524_10180504 | 298 |
| 376 | 3300003792 | Ga0055540_1027147 | Ga0055540_10271471 | 298 |
| 377 | 3300003794 | Ga0055531_10020946 | Ga0055531_100209461 | 298 |
| 378 | 3300004625 | Ga0055543_1000372 | Ga0055543_100037225 | 298 |
| 379 | 3300005262 | Ga0065165_1001221 | Ga0065165_100122125 | 298 |
| 380 | 3300005367 | Ga0070667_100000434 | Ga0070667_10000043411 | 298 |
| 381 | 3300005455 | Ga0070663_100000053 | Ga0070663_10000005314 | 298 |
| 382 | 3300005563 | Ga0068855_100029037 | Ga0068855_1000290376 | 298 |
| 383 | 3300005578 | Ga0068854_100000391 | Ga0068854_1000003916 | 298 |
| 384 | 3300005843 | Ga0068860_100070916 | Ga0068860_1000709162 | 298 |
| 385 | 3300006038 | Ga0075365_10104848 | Ga0075365_101048482 | 298 |
| 386 | 3300006042 | Ga0075368_10039933 | Ga0075368_100399332 | 298 |
| 387 | 3300006048 | Ga0075363_100182366 | Ga0075363_1001823661 | 298 |
| 388 | 3300006178 | Ga0075367_10005561 | Ga0075367_100055613 | 298 |
| 389 | 3300006186 | Ga0075369_10001899 | Ga0075369_100018995 | 298 |
| 390 | 3300009093 | Ga0105240_10000985 | Ga0105240_1000098524 | 298 |
| 391 | 3300009093 | Ga0105240_10001505 | Ga0105240_1000150521 | 298 |
| 392 | 3300009093 | Ga0105240_10005162 | Ga0105240_1000516217 | 298 |
| 393 | 3300009093 | Ga0105240_10080521 | Ga0105240_100805212 | 298 |
| 394 | 3300009177 | Ga0105248_10000227 | Ga0105248_100002275 | 298 |
| 395 | 3300009553 | Ga0105249_10000145 | Ga0105249_1000014541 | 298 |
| 396 | 3300009766 | Ga0123342_1021132 | Ga0123342_10211321 | 298 |
| 397 | 3300010375 | Ga0105239_10000080 | Ga0105239_10000080104 | 298 |
| 398 | 3300010375 | Ga0105239_10265937 | Ga0105239_102659372 | 298 |
| 399 | 3300021361 | Ga0213872_10001559 | Ga0213872_100015594 | 298 |
| 400 | 3300021361 | Ga0213872_10016889 | Ga0213872_100168894 | 298 |
| 401 | 3300021361 | Ga0213872_10051233 | Ga0213872_100512332 | 298 |
| 402 | 3300025206 | Ga0209435_107069 | Ga0209435_1070692 | 298 |
| 403 | 3300025207 | Ga0209760_100284 | Ga0209760_1002845 | 298 |
| 404 | 3300025208 | Ga0209436_100259 | Ga0209436_10025921 | 298 |
| 405 | 3300025224 | Ga0209784_100074 | Ga0209784_100074125 | 298 |
| 406 | 3300025231 | Ga0207427_100079 | Ga0207427_100079125 | 298 |
| 407 | 3300025233 | Ga0209437_100163 | Ga0209437_100163125 | 298 |
| 408 | 3300025242 | Ga0209258_100196 | Ga0209258_100196109 | 298 |
| 409 | 3300025246 | Ga0209646_1000369 | Ga0209646_100036924 | 298 |
| 410 | 3300025250 | Ga0209026_1000109 | Ga0209026_100010913 | 298 |
| 411 | 3300025254 | Ga0209148_1000001 | Ga0209148_100000113 | 298 |
| 412 | 3300025256 | Ga0209759_1001130 | Ga0209759_100113013 | 298 |
| 413 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000022218 | 298 |
| 414 | 3300025272 | Ga0209455_1000155 | Ga0209455_1000155106 | 298 |
| 415 | 3300025284 | Ga0209130_1000598 | Ga0209130_100059824 | 298 |
| 416 | 3300025292 | Ga0209676_1005120 | Ga0209676_100512010 | 298 |
| 417 | 3300025294 | Ga0209025_1000969 | Ga0209025_100096922 | 298 |
| 418 | 3300025294 | Ga0209025_1004327 | Ga0209025_10043275 | 298 |
| 419 | 3300025295 | Ga0209564_1000692 | Ga0209564_100069232 | 298 |
| 420 | 3300025297 | Ga0209758_1010618 | Ga0209758_10106183 | 298 |
| 421 | 3300025297 | Ga0209758_1011701 | Ga0209758_10117012 | 298 |
| 422 | 3300025297 | Ga0209758_1037846 | Ga0209758_10378462 | 298 |
| 423 | 3300025299 | Ga0209256_1001225 | Ga0209256_100122533 | 298 |
| 424 | 3300025302 | Ga0207426_1000779 | Ga0207426_100077924 | 298 |
| 425 | 3300025303 | Ga0209051_1002790 | Ga0209051_10027909 | 298 |
| 426 | 3300025303 | Ga0209051_1070565 | Ga0209051_10705651 | 298 |
| 427 | 3300025304 | Ga0209257_1003172 | Ga0209257_10031723 | 298 |
| 428 | 3300025711 | Ga0207696_1000077 | Ga0207696_100007744 | 298 |
| 429 | 3300025913 | Ga0207695_10000529 | Ga0207695_1000052923 | 298 |
| 430 | 3300025913 | Ga0207695_10001440 | Ga0207695_1000144018 | 298 |
| 431 | 3300025913 | Ga0207695_10020250 | Ga0207695_100202503 | 298 |
| 432 | 3300025941 | Ga0207711_10000969 | Ga0207711_1000096919 | 298 |
| 433 | 3300025949 | Ga0207667_10000228 | Ga0207667_1000022825 | 298 |
| 434 | 3300025961 | Ga0207712_10000124 | Ga0207712_1000012438 | 298 |
| 435 | 3300025961 | Ga0207712_10316039 | Ga0207712_103160391 | 298 |
| 436 | 3300025981 | Ga0207640_10000120 | Ga0207640_1000012010 | 298 |
| 437 | 3300025986 | Ga0207658_10000032 | Ga0207658_1000003234 | 298 |
| 438 | 3300026067 | Ga0207678_10000378 | Ga0207678_100003787 | 298 |
| 439 | 3300026078 | Ga0207702_10349444 | Ga0207702_103494442 | 298 |
| 440 | 3300028379 | Ga0268266_10000764 | Ga0268266_1000076440 | 298 |
| 441 | 3300028379 | Ga0268266_10174536 | Ga0268266_101745362 | 298 |
| 442 | 3300028381 | Ga0268264_10010225 | Ga0268264_100102257 | 298 |
| 443 | 3300039447 | Ga0436361_0645665 | Ga0436361_0645665_9231_10127 | 298 |
| 444 | 3300039447 | Ga0436361_0864259 | Ga0436361_0864259_1182_2078 | 298 |
| 445 | 3300039447 | Ga0436361_1035230 | Ga0436361_1035230_136_1032 | 298 |
| 446 | 3300042435 | Ga0439434_0024696 | Ga0439434_0024696_900_1802 | 298 |
| 447 | 3300045836 | Ga0466958_0018727 | Ga0466958_0018727_24_923 | 298 |
| 448 | 3300046507 | Ga0495606_0078264 | Ga0495606_0078264_717_1616 | 298 |
| 449 | 3300046530 | Ga0495654_0002386 | Ga0495654_0002386_9877_10776 | 298 |
| 450 | 3300046616 | Ga0495668_0000105 | Ga0495668_0000105_71717_72616 | 298 |
| 451 | 3300047472 | Ga0495686_0000769 | Ga0495686_0000769_6406_7305 | 298 |
| 452 | 3300048904 | Ga0496101_0012871 | Ga0496101_0012871_2724_3623 | 298 |
| 453 | 3300048907 | Ga0496104_0006478 | Ga0496104_0006478_2879_3778 | 298 |
| 454 | 3300048908 | Ga0496105_0004378 | Ga0496105_0004378_2600_3499 | 298 |
| 455 | 3300048909 | Ga0496106_0108491 | Ga0496106_0108491_1197_2096 | 298 |
| 456 | 3300048910 | Ga0496107_0056313 | Ga0496107_0056313_983_1882 | 298 |
| 457 | 3300048918 | Ga0496115_0037183 | Ga0496115_0037183_1125_2024 | 298 |
| 458 | 3300048920 | Ga0496117_0038843 | Ga0496117_0038843_2515_3414 | 298 |
| 459 | 3300048921 | Ga0496118_0018654 | Ga0496118_0018654_2032_2931 | 298 |
| 460 | 3300048922 | Ga0496119_0000537 | Ga0496119_0000537_25636_26535 | 298 |
| 461 | 3300048922 | Ga0496119_0000906 | Ga0496119_0000906_23234_24133 | 298 |
| 462 | 3300048923 | Ga0496120_0000055 | Ga0496120_0000055_26094_26993 | 298 |
| 463 | 3300048924 | Ga0496121_0000101 | Ga0496121_0000101_178155_179054 | 298 |
| 464 | 3300048924 | Ga0496121_0019715 | Ga0496121_0019715_495_1394 | 298 |
| 465 | 3300048924 | Ga0496121_0161229 | Ga0496121_0161229_585_1484 | 298 |
| 466 | 3300048925 | Ga0496122_0000302 | Ga0496122_0000302_14377_15276 | 298 |
| 467 | 3300048926 | Ga0496123_0000239 | Ga0496123_0000239_99001_99900 | 298 |
| 468 | 3300048929 | Ga0496126_0000896 | Ga0496126_0000896_24828_25727 | 298 |
| 469 | 3300048929 | Ga0496126_0037975 | Ga0496126_0037975_1626_2528 | 298 |
| 470 | 3300048929 | Ga0496126_0191634 | Ga0496126_0191634_640_1536 | 298 |
| 471 | 3300049570 | Ga0501033_0149227 | Ga0501033_0149227_38_937 | 298 |
| 472 | 3300049575 | Ga0501039_0108551 | Ga0501039_0108551_900_1799 | 298 |
| 473 | 3300049579 | Ga0501043_0081705 | Ga0501043_0081705_712_1611 | 298 |
| 474 | 3300049580 | Ga0501046_0215018 | Ga0501046_0215018_489_1388 | 298 |
| 475 | 3300049581 | Ga0501047_0155631 | Ga0501047_0155631_119_1018 | 298 |
| 476 | 3300049581 | Ga0501047_0259819 | Ga0501047_0259819_406_1305 | 298 |
| 477 | 3300053087 | Ga0500643_003087 | Ga0500643_003087_6554_7453 | 298 |
| 478 | 3300053093 | Ga0500651_0002913 | Ga0500651_0002913_228_1127 | 298 |
| 479 | 3300053093 | Ga0500651_0021159 | Ga0500651_0021159_3112_4011 | 298 |
| 480 | 3300053102 | Ga0500554_023792 | Ga0500554_023792_30_938 | 298 |
| 481 | 3300053120 | Ga0500597_000264 | Ga0500597_000264_6517_7416 | 298 |
| 482 | 3300053156 | Ga0500622_0018980 | Ga0500622_0018980_865_1764 | 298 |
| 483 | 3300061719 | Ga0466962_0004210 | Ga0466962_0004210_3673_4572 | 298 |
| 484 | iso_pu_bacteria | 2924150972 | 2924156927 | 298 |
| 485 | iso_pu_bacteria | 2924158325 | 2924163851 | 298 |
| 486 | iso_pu_bacteria | 2928163908 | 2928167230 | 298 |
| 487 | iso_pu_bacteria | 2937002841 | 2937002950 | 298 |
| 488 | iso_pu_bacteria | 2937098957 | 2937105079 | 298 |
| 489 | iso_pu_bacteria | 2957382221 | 2957386170 | 298 |
| 490 | iso_pu_bacteria | 2957415311 | 2957419732 | 298 |
| 491 | iso_pu_bacteria | 2960584000 | 2960587763 | 298 |
| 492 | iso_pu_bacteria | 2960645483 | 2960649540 | 298 |
| 493 | iso_pu_bacteria | 2960674078 | 2960679007 | 298 |
| 494 | iso_pu_bacteria | 2967671571 | 2967673351 | 298 |
| 495 | iso_pu_bacteria | 2967678726 | 2967679754 | 298 |
| 496 | iso_pu_bacteria | 2967699805 | 2967704760 | 298 |
| 497 | iso_pu_bacteria | 2970088815 | 2970093417 | 298 |
| 498 | iso_pu_bacteria | 2977551784 | 2977557629 | 298 |
| 499 | iso_pu_bacteria | 8003992118 | 8003996932 | 298 |
| 500 | 3300001979 | JGI24740J21852_10006148 | JGI24740J21852_100061483 | 299 |
| 501 | 3300002704 | JGI25155J39150_1000007 | JGI25155J39150_1000007202 | 299 |
| 502 | 3300002705 | JGI25156J39149_1000050 | JGI25156J39149_100005056 | 299 |
| 503 | 3300002737 | JGI25162J39368_1000418 | JGI25162J39368_100041810 | 299 |
| 504 | 3300002738 | JGI25154J39366_1000035 | JGI25154J39366_1000035117 | 299 |
| 505 | 3300002741 | JGI25157J39369_1000036 | JGI25157J39369_1000036101 | 299 |
| 506 | 3300003214 | JGI25165J46597_1000375 | JGI25165J46597_100037538 | 299 |
| 507 | 3300003316 | rootH1_10021276 | rootH1_100212762 | 299 |
| 508 | 3300003320 | rootH2_10052331 | rootH2_100523315 | 299 |
| 509 | 3300003322 | rootL2_10052043 | rootL2_100520432 | 299 |
| 510 | 3300003762 | Ga0055542_1019813 | Ga0055542_10198131 | 299 |
| 511 | 3300003790 | Ga0055528_1015817 | Ga0055528_10158172 | 299 |
| 512 | 3300003792 | Ga0055540_1007295 | Ga0055540_10072952 | 299 |
| 513 | 3300005518 | Ga0070699_100215654 | Ga0070699_1002156542 | 299 |
| 514 | 3300005614 | Ga0068856_100037139 | Ga0068856_1000371392 | 299 |
| 515 | 3300006048 | Ga0075363_100108742 | Ga0075363_1001087422 | 299 |
| 516 | 3300009545 | Ga0105237_10002159 | Ga0105237_1000215922 | 299 |
| 517 | 3300010375 | Ga0105239_10002299 | Ga0105239_1000229922 | 299 |
| 518 | 3300013104 | Ga0157370_10000131 | Ga0157370_100001316 | 299 |
| 519 | 3300013105 | Ga0157369_10399465 | Ga0157369_103994652 | 299 |
| 520 | 3300013306 | Ga0163162_10070294 | Ga0163162_100702942 | 299 |
| 521 | 3300014497 | Ga0182008_10030134 | Ga0182008_100301342 | 299 |
| 522 | 3300025206 | Ga0209435_100005 | Ga0209435_100005353 | 299 |
| 523 | 3300025228 | Ga0209672_103153 | Ga0209672_1031532 | 299 |
| 524 | 3300025233 | Ga0209437_100060 | Ga0209437_10006038 | 299 |
| 525 | 3300025246 | Ga0209646_1000011 | Ga0209646_1000011353 | 299 |
| 526 | 3300025250 | Ga0209026_1000008 | Ga0209026_1000008353 | 299 |
| 527 | 3300025254 | Ga0209148_1002897 | Ga0209148_10028972 | 299 |
| 528 | 3300025256 | Ga0209759_1000004 | Ga0209759_1000004353 | 299 |
| 529 | 3300025258 | Ga0209129_1000226 | Ga0209129_100022622 | 299 |
| 530 | 3300025261 | Ga0209233_1000275 | Ga0209233_100027537 | 299 |
| 531 | 3300025272 | Ga0209455_1020260 | Ga0209455_10202601 | 299 |
| 532 | 3300025273 | Ga0209673_1042173 | Ga0209673_10421731 | 299 |
| 533 | 3300025294 | Ga0209025_1001885 | Ga0209025_10018852 | 299 |
| 534 | 3300025294 | Ga0209025_1010204 | Ga0209025_10102046 | 299 |
| 535 | 3300025297 | Ga0209758_1008994 | Ga0209758_10089944 | 299 |
| 536 | 3300025297 | Ga0209758_1023429 | Ga0209758_10234293 | 299 |
| 537 | 3300025298 | Ga0209050_1007028 | Ga0209050_10070282 | 299 |
| 538 | 3300025299 | Ga0209256_1007631 | Ga0209256_10076314 | 299 |
| 539 | 3300025303 | Ga0209051_1000321 | Ga0209051_100032113 | 299 |
| 540 | 3300025304 | Ga0209257_1009080 | Ga0209257_10090806 | 299 |
| 541 | 3300025972 | Ga0207668_10143638 | Ga0207668_101436382 | 299 |
| 542 | 3300028794 | Ga0307515_10020126 | Ga0307515_100201264 | 299 |
| 543 | 3300031456 | Ga0307513_10013523 | Ga0307513_100135236 | 299 |
| 544 | 3300037466 | Ga0395898_0207809 | Ga0395898_0207809_448_1347 | 299 |
| 545 | 3300041413 | Ga0439465_0018317 | Ga0439465_0018317_827_1741 | 299 |
| 546 | 3300041413 | Ga0439465_0061691 | Ga0439465_0061691_280_1182 | 299 |
| 547 | 3300041492 | Ga0451835_0241946 | Ga0451835_0241946_1261_2163 | 299 |
| 548 | 3300041501 | Ga0451845_0706423 | Ga0451845_0706423_5603_6505 | 299 |
| 549 | 3300041505 | Ga0451849_0378119 | Ga0451849_0378119_147_1049 | 299 |
| 550 | 3300041511 | Ga0451855_1793643 | Ga0451855_1793643_119_1021 | 299 |
| 551 | 3300041512 | Ga0451853_2803005 | Ga0451853_2803005_316_1218 | 299 |
| 552 | 3300044694 | Ga0466963_0142432 | Ga0466963_0142432_317_1219 | 299 |
| 553 | 3300044765 | Ga0466970_0117238 | Ga0466970_0117238_303_1205 | 299 |
| 554 | 3300045049 | Ga0466959_0189387 | Ga0466959_0189387_324_1226 | 299 |
| 555 | 3300045836 | Ga0466958_0063994 | Ga0466958_0063994_143_1045 | 299 |
| 556 | 3300046459 | Ga0495629_0048881 | Ga0495629_0048881_385_1287 | 299 |
| 557 | 3300046460 | Ga0495638_0001061 | Ga0495638_0001061_21285_22193 | 299 |
| 558 | 3300046474 | Ga0495605_0013429 | Ga0495605_0013429_3409_4311 | 299 |
| 559 | 3300046476 | Ga0495662_0031509 | Ga0495662_0031509_810_1712 | 299 |
| 560 | 3300046492 | Ga0495585_0017367 | Ga0495585_0017367_1669_2571 | 299 |
| 561 | 3300046506 | Ga0495583_0090367 | Ga0495583_0090367_354_1256 | 299 |
| 562 | 3300046507 | Ga0495606_0041995 | Ga0495606_0041995_1271_2173 | 299 |
| 563 | 3300046515 | Ga0495620_0006745 | Ga0495620_0006745_3567_4469 | 299 |
| 564 | 3300046515 | Ga0495620_0007343 | Ga0495620_0007343_3978_4880 | 299 |
| 565 | 3300046519 | Ga0495632_0020467 | Ga0495632_0020467_1771_2673 | 299 |
| 566 | 3300046522 | Ga0495643_0018843 | Ga0495643_0018843_687_1589 | 299 |
| 567 | 3300046523 | Ga0495644_0070615 | Ga0495644_0070615_144_1046 | 299 |
| 568 | 3300046524 | Ga0495648_0018469 | Ga0495648_0018469_2224_3126 | 299 |
| 569 | 3300046529 | Ga0495652_0127870 | Ga0495652_0127870_782_1684 | 299 |
| 570 | 3300046533 | Ga0495640_0189403 | Ga0495640_0189403_366_1268 | 299 |
| 571 | 3300046538 | Ga0495609_0035576 | Ga0495609_0035576_1046_1948 | 299 |
| 572 | 3300046542 | Ga0495597_0011850 | Ga0495597_0011850_3161_4063 | 299 |
| 573 | 3300046558 | Ga0495633_0016046 | Ga0495633_0016046_1324_2226 | 299 |
| 574 | 3300046558 | Ga0495633_0046472 | Ga0495633_0046472_227_1129 | 299 |
| 575 | 3300046660 | Ga0495625_0007951 | Ga0495625_0007951_6195_7100 | 299 |
| 576 | 3300046660 | Ga0495625_0021355 | Ga0495625_0021355_2442_3344 | 299 |
| 577 | 3300046660 | Ga0495625_0023158 | Ga0495625_0023158_1614_2516 | 299 |
| 578 | 3300046660 | Ga0495625_0092782 | Ga0495625_0092782_1088_1990 | 299 |
| 579 | 3300046660 | Ga0495625_0207540 | Ga0495625_0207540_33_935 | 299 |
| 580 | 3300046665 | Ga0495661_0089528 | Ga0495661_0089528_232_1134 | 299 |
| 581 | 3300046674 | Ga0495588_0042797 | Ga0495588_0042797_972_1874 | 299 |
| 582 | 3300046675 | Ga0495657_0147439 | Ga0495657_0147439_154_1056 | 299 |
| 583 | 3300046690 | Ga0495624_0037538 | Ga0495624_0037538_2076_3059 | 299 |
| 584 | 3300046691 | Ga0495670_0038191 | Ga0495670_0038191_526_1428 | 299 |
| 585 | 3300046794 | Ga0495589_0055248 | Ga0495589_0055248_216_1118 | 299 |
| 586 | 3300046809 | Ga0495600_0021552 | Ga0495600_0021552_3154_4056 | 299 |
| 587 | 3300046810 | Ga0495660_0011631 | Ga0495660_0011631_3499_4401 | 299 |
| 588 | 3300047318 | Ga0495636_0006453 | Ga0495636_0006453_2894_3796 | 299 |
| 589 | 3300047472 | Ga0495686_0002120 | Ga0495686_0002120_13663_14565 | 299 |
| 590 | 3300047472 | Ga0495686_0014472 | Ga0495686_0014472_3533_4435 | 299 |
| 591 | 3300048904 | Ga0496101_0141082 | Ga0496101_0141082_162_1082 | 299 |
| 592 | 3300048909 | Ga0496106_0000028 | Ga0496106_0000028_136136_137038 | 299 |
| 593 | 3300048909 | Ga0496106_0033388 | Ga0496106_0033388_1148_2068 | 299 |
| 594 | 3300048910 | Ga0496107_0000291 | Ga0496107_0000291_3833_4753 | 299 |
| 595 | 3300048920 | Ga0496117_0150352 | Ga0496117_0150352_175_1077 | 299 |
| 596 | 3300048920 | Ga0496117_0172381 | Ga0496117_0172381_97_999 | 299 |
| 597 | 3300048921 | Ga0496118_0011225 | Ga0496118_0011225_4778_5680 | 299 |
| 598 | 3300048921 | Ga0496118_0195356 | Ga0496118_0195356_95_997 | 299 |
| 599 | 3300048922 | Ga0496119_0085573 | Ga0496119_0085573_823_1725 | 299 |
| 600 | 3300048923 | Ga0496120_0067515 | Ga0496120_0067515_47_949 | 299 |
| 601 | 3300048924 | Ga0496121_0002027 | Ga0496121_0002027_27412_28332 | 299 |
| 602 | 3300048924 | Ga0496121_0063007 | Ga0496121_0063007_785_1687 | 299 |
| 603 | 3300048925 | Ga0496122_0030501 | Ga0496122_0030501_2349_3251 | 299 |
| 604 | 3300048925 | Ga0496122_0054340 | Ga0496122_0054340_875_1777 | 299 |
| 605 | 3300048925 | Ga0496122_0171623 | Ga0496122_0171623_174_1076 | 299 |
| 606 | 3300048926 | Ga0496123_0009680 | Ga0496123_0009680_3867_4769 | 299 |
| 607 | 3300048926 | Ga0496123_0072420 | Ga0496123_0072420_1152_2054 | 299 |
| 608 | 3300048927 | Ga0496124_0043555 | Ga0496124_0043555_1146_2048 | 299 |
| 609 | 3300048927 | Ga0496124_0163240 | Ga0496124_0163240_292_1194 | 299 |
| 610 | 3300048928 | Ga0496125_0004359 | Ga0496125_0004359_9604_10506 | 299 |
| 611 | 3300049570 | Ga0501033_0389615 | Ga0501033_0389615_35_937 | 299 |
| 612 | 3300049572 | Ga0501036_0015259 | Ga0501036_0015259_878_1780 | 299 |
| 613 | 3300049590 | Ga0501074_0039318 | Ga0501074_0039318_721_1638 | 299 |
| 614 | 3300049823 | Ga0501044_0031639 | Ga0501044_0031639_2824_3726 | 299 |
| 615 | 3300050490 | nmdc:mga03n38_18109_c1 | nmdc:mga03n38_18109_c1_1777_2679 | 299 |
| 616 | 3300050493 | nmdc:mga0k408_76885_c1 | nmdc:mga0k408_76885_c1_96_998 | 299 |
| 617 | 3300053077 | Ga0495601_0204481 | Ga0495601_0204481_213_1115 | 299 |
| 618 | 3300053109 | Ga0500569_000971 | Ga0500569_000971_683_1585 | 299 |
| 619 | 3300053121 | Ga0500607_100305 | Ga0500607_100305_480_1382 | 299 |
| 620 | 3300053134 | Ga0500658_0001192 | Ga0500658_0001192_4057_4959 | 299 |
| 621 | 3300053135 | Ga0500659_0107780 | Ga0500659_0107780_57_959 | 299 |
| 622 | 3300053139 | Ga0500568_0001664 | Ga0500568_0001664_7643_8545 | 299 |
| 623 | 3300053153 | Ga0500616_0142798 | Ga0500616_0142798_67_969 | 299 |
| 624 | 3300009093 | Ga0105240_10161761 | Ga0105240_101617612 | 300 |
| 625 | 3300044683 | Ga0466965_0053560 | Ga0466965_0053560_616_1521 | 300 |
| 626 | 3300044693 | Ga0466961_0000643 | Ga0466961_0000643_10970_11875 | 300 |
| 627 | 3300044735 | Ga0466968_0061075 | Ga0466968_0061075_205_1110 | 300 |
| 628 | 3300044765 | Ga0466970_0031649 | Ga0466970_0031649_125_1030 | 300 |
| 629 | 3300044842 | Ga0466957_0079181 | Ga0466957_0079181_201_1106 | 300 |
| 630 | 3300046454 | Ga0495592_0056536 | Ga0495592_0056536_1561_2496 | 300 |
| 631 | 3300046463 | Ga0495653_0016662 | Ga0495653_0016662_1142_2059 | 300 |
| 632 | 3300046472 | Ga0495580_0075267 | Ga0495580_0075267_118_1035 | 300 |
| 633 | 3300046476 | Ga0495662_0000570 | Ga0495662_0000570_2069_2986 | 300 |
| 634 | 3300046477 | Ga0495664_0008493 | Ga0495664_0008493_1140_2057 | 300 |
| 635 | 3300046511 | Ga0495608_0080020 | Ga0495608_0080020_1063_1980 | 300 |
| 636 | 3300046516 | Ga0495628_0031555 | Ga0495628_0031555_1065_2000 | 300 |
| 637 | 3300046526 | Ga0495666_0002852 | Ga0495666_0002852_1625_2560 | 300 |
| 638 | 3300046531 | Ga0495665_0060186 | Ga0495665_0060186_833_1750 | 300 |
| 639 | 3300046533 | Ga0495640_0060789 | Ga0495640_0060789_1126_2043 | 300 |
| 640 | 3300046535 | Ga0495586_0100431 | Ga0495586_0100431_36_971 | 300 |
| 641 | 3300046543 | Ga0495645_0041356 | Ga0495645_0041356_1516_2451 | 300 |
| 642 | 3300046559 | Ga0495667_0009593 | Ga0495667_0009593_1139_2056 | 300 |
| 643 | 3300046642 | Ga0495634_0037605 | Ga0495634_0037605_1469_2404 | 300 |
| 644 | 3300046675 | Ga0495657_0004205 | Ga0495657_0004205_9073_10008 | 300 |
| 645 | 3300046678 | Ga0495599_0037866 | Ga0495599_0037866_1858_2793 | 300 |
| 646 | 3300046680 | Ga0495646_0016649 | Ga0495646_0016649_370_1287 | 300 |
| 647 | 3300046689 | Ga0495613_0023111 | Ga0495613_0023111_1469_2404 | 300 |
| 648 | 3300047319 | Ga0495674_0059369 | Ga0495674_0059369_718_1635 | 300 |
| 649 | 3300047444 | Ga0495675_0013119 | Ga0495675_0013119_1730_2665 | 300 |
| 650 | 3300047469 | Ga0495673_0000293 | Ga0495673_0000293_10121_11044 | 300 |
| 651 | 3300047471 | Ga0495684_0023089 | Ga0495684_0023089_1569_2504 | 300 |
| 652 | 3300048922 | Ga0496119_0089214 | Ga0496119_0089214_92_994 | 300 |
| 653 | 3300048927 | Ga0496124_0130032 | Ga0496124_0130032_206_1108 | 300 |
| 654 | 3300049571 | Ga0501034_0001153 | Ga0501034_0001153_30639_31550 | 300 |
| 655 | 3300049584 | Ga0501068_0008282 | Ga0501068_0008282_2494_3405 | 300 |
| 656 | 3300049823 | Ga0501044_0037972 | Ga0501044_0037972_2249_3160 | 300 |
| 657 | 3300053077 | Ga0495601_0000191 | Ga0495601_0000191_31053_31988 | 300 |
| 658 | 3300049570 | Ga0501033_0036676 | Ga0501033_0036676_1583_2491 | 301 |
| 659 | 3300049571 | Ga0501034_0215317 | Ga0501034_0215317_723_1631 | 301 |
| 660 | 3300049579 | Ga0501043_0185191 | Ga0501043_0185191_564_1472 | 301 |
| 661 | 3300049581 | Ga0501047_0057686 | Ga0501047_0057686_1526_2434 | 301 |
| 662 | 3300049822 | Ga0501035_0092218 | Ga0501035_0092218_1742_2650 | 301 |
| 663 | 3300049823 | Ga0501044_0365009 | Ga0501044_0365009_252_1160 | 301 |
| 664 | 3300053104 | Ga0500556_0143085 | Ga0500556_0143085_11_919 | 301 |
| 665 | 3300005530 | Ga0070679_100052069 | Ga0070679_1000520696 | 302 |
| 666 | 3300010375 | Ga0105239_10064026 | Ga0105239_100640263 | 302 |
| 667 | 3300025912 | Ga0207707_10182687 | Ga0207707_101826872 | 302 |
| 668 | 3300025921 | Ga0207652_10099821 | Ga0207652_100998213 | 302 |
| 669 | 3300046460 | Ga0495638_0008888 | Ga0495638_0008888_3459_4370 | 302 |
| 670 | 3300046501 | Ga0495607_0000006 | Ga0495607_0000006_233562_234473 | 302 |
| 671 | 3300048916 | Ga0496113_0096063 | Ga0496113_0096063_236_1147 | 302 |
| 672 | 3300053139 | Ga0500568_0003692 | Ga0500568_0003692_901_1824 | 302 |
| 673 | 3300053156 | Ga0500622_0000906 | Ga0500622_0000906_14825_15736 | 302 |
| 674 | 3300005614 | Ga0068856_100188542 | Ga0068856_1001885422 | 303 |
| 675 | 3300013105 | Ga0157369_10031912 | Ga0157369_100319124 | 303 |
| 676 | 3300025909 | Ga0207705_10049073 | Ga0207705_100490733 | 303 |
| 677 | 3300026078 | Ga0207702_10173265 | Ga0207702_101732653 | 303 |
| 678 | 3300041411 | Ga0439466_0006569 | Ga0439466_0006569_1789_2700 | 303 |
| 679 | 3300006844 | Ga0075428_100435820 | Ga0075428_1004358202 | 304 |
| 680 | 3300009094 | Ga0111539_10000323 | Ga0111539_100003235 | 304 |
| 681 | 3300009147 | Ga0114129_10671110 | Ga0114129_106711101 | 304 |
| 682 | 3300025922 | Ga0207646_10450407 | Ga0207646_104504071 | 304 |
| 683 | 3300027907 | Ga0207428_10000129 | Ga0207428_100001296 | 304 |
| 684 | 3300046542 | Ga0495597_0000005 | Ga0495597_0000005_65780_66715 | 304 |
| 685 | 3300046810 | Ga0495660_0002239 | Ga0495660_0002239_8788_9723 | 304 |
| 686 | 3300050511 | nmdc:mga08y16_51_c1 | nmdc:mga08y16_51_c1_99092_100102 | 304 |
| 687 | 3300046460 | Ga0495638_0000300 | Ga0495638_0000300_58149_59069 | 305 |
| 688 | 3300047320 | Ga0495672_0011865 | Ga0495672_0011865_3964_4884 | 305 |
| 689 | 3300047323 | Ga0495683_0042689 | Ga0495683_0042689_1180_2100 | 305 |
| 690 | 3300049459 | Ga0495678_014000 | Ga0495678_014000_1200_2120 | 305 |
| 691 | 3300053139 | Ga0500568_0002341 | Ga0500568_0002341_5734_6654 | 305 |
| 692 | 3300053153 | Ga0500616_0001502 | Ga0500616_0001502_10457_11377 | 305 |
| 693 | 3300001978 | JGI24747J21853_1002313 | JGI24747J21853_10023132 | 306 |
| 694 | 3300005435 | Ga0070714_100207444 | Ga0070714_1002074442 | 306 |
| 695 | 3300005563 | Ga0068855_100051022 | Ga0068855_1000510222 | 306 |
| 696 | 3300007788 | Ga0099795_10015083 | Ga0099795_100150833 | 306 |
| 697 | 3300009177 | Ga0105248_10007577 | Ga0105248_100075776 | 306 |
| 698 | 3300013306 | Ga0163162_10107680 | Ga0163162_101076802 | 306 |
| 699 | 3300025929 | Ga0207664_10293412 | Ga0207664_102934122 | 306 |
| 700 | 3300025972 | Ga0207668_10136143 | Ga0207668_101361432 | 306 |
| 701 | 3300027512 | Ga0209179_1017514 | Ga0209179_10175141 | 306 |
| 702 | 3300045976 | Ga0466967_0112250 | Ga0466967_0112250_821_1744 | 306 |
| 703 | 3300046524 | Ga0495648_0018841 | Ga0495648_0018841_2923_3843 | 306 |
| 704 | 3300046616 | Ga0495668_0076621 | Ga0495668_0076621_65_985 | 306 |
| 705 | 3300046692 | Ga0495671_0140452 | Ga0495671_0140452_180_1100 | 306 |
| 706 | 3300047320 | Ga0495672_0007690 | Ga0495672_0007690_5219_6139 | 306 |
| 707 | 3300047469 | Ga0495673_0002760 | Ga0495673_0002760_10642_11562 | 306 |
| 708 | 3300049571 | Ga0501034_0223643 | Ga0501034_0223643_353_1273 | 306 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3u9l-assembly1.cif.gz_A-2 | the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti | 0.9822 | 5 | 297 |
| 3u9l-assembly1.cif.gz_A-2 | the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti | 0.9754 | 5 | 297 |
| 2hsd-assembly1.cif.gz_A | the refined three-dimensional structure of 3alpha,20beta-hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases | 0.936 | 3 | 190 |
| 3tfo-assembly1.cif.gz_C | crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti | 0.9243 | 5 | 269 |
| 3tfo-assembly1.cif.gz_D | crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti | 0.9174 | 5 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u9lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9809 | 5 | 297 | 3.40.50.720 |
| 3u9lA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9741 | 5 | 297 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9411 | 95 | 190 | 3.40.50.720 |
| 2hsdA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.936 | 3 | 190 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9247 | 5 | 191 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3KIF3-F1-model_v4 | deleted | 0.9968 | 4 | 159 |
|
| AF-A4X7G9-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.9946 | 3 | 151 |
|
| AF-A0A7W7CRD4-F1-model_v4 | NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) | 0.9926 | 4 | 298 |
|
| AF-A0A1H8YFK9-F1-model_v4 | NADP-dependent 3-hydroxy acid dehydrogenase YdfG | 0.9908 | 4 | 298 |
|
| AF-A0A1E1VEH7-F1-model_v4 | Short-chain dehydrogenase/reductase SDR | 0.99 | 3 | 258 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar