F476595

General Info

Members Datasets Scaffolds Average Seq Length
708 426 599 299

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000323|Ga0111539_100003235
Length 336
Sequence VAVFQVLAIGKESIMRKVIVVTGASSGFGALAARQLAANGDIVYASMRDTQGNNAAKVRETAAYAAEHRVDLRTIELDVQSQKSVDAAIGRIIAENGRLDVIVHNAGHMVLGPAEAFTPQQYAELYDINVLGAQRVNRAALPHFRWRRQGLLVWVSSSSTRGGTPPFLGPYFASKAAMDALAVSYAGELARWGIETAIIVPGSFTRGTNHYAHSGTPDDRTVAAQYNNGPYRGVPEAIQKGLASLEPADADADAVGRAIADVVAMPFGKRPFRTTIDPLDDGAGIVNAVADRVRAELFRRIGMEDLLHPATDRNRRRSGPDQIPANDRQPVQFVQF

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2511231006 Pseudomonas sp. GM17 Isolate Nodule
3 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
4 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
5 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
6 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
7 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
8 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
9 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
10 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
11 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
12 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
13 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
14 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
15 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
16 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
17 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
18 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
19 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
20 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
21 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
22 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
23 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
24 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
25 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
26 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
27 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
28 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
29 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
30 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
31 2643221599 Rhizobium sp. Root708 Isolate Unclassified
32 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
33 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
34 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
35 2643221723 Ensifer sp. Root278 Isolate Unclassified
36 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
37 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
38 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
39 2738543009 Luteibacter sp. OK325 Isolate Unclassified
40 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
41 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
42 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
43 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
44 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
45 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
46 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
47 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
48 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
49 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
50 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
51 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
52 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
53 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
54 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
55 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
56 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
57 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
58 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
59 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
60 2909042592 Labrys sp. LIt4 Isolate Nodule
61 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
62 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
63 2919085039 Luteibacter sp. 1214 Isolate Unclassified
64 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
65 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
66 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
67 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
68 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
69 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
70 2928163908 Burkholderia sp. 567 Isolate Unclassified
71 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
72 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
73 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
74 2941471342 Luteibacter sp. 621 Isolate Unclassified
75 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
76 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
77 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
78 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
79 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
80 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
81 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
82 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
83 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
84 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
85 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
86 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
87 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
88 2996887358 Rhizobium sp. R711 Isolate Nodule
89 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
90 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
91 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
92 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
93 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
94 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
95 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
96 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
97 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
98 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
99 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
100 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
101 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
102 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
103 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
104 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
105 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
106 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
107 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
108 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
109 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
110 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
111 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
112 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
113 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
114 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
115 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
116 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
117 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
118 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
119 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
120 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
121 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
122 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
123 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
124 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
125 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
126 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
127 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
128 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
129 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
130 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
131 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
132 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
133 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
134 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
135 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
136 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
137 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
138 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
139 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
140 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
141 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
142 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
143 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
144 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
145 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
146 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
147 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
148 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
149 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
150 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
151 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
152 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
153 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
154 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
155 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
156 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
157 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
158 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
159 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
160 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
164 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
165 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
166 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
167 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
168 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
171 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
172 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
173 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
174 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
175 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
176 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
177 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
178 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
179 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
180 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
189 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
190 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
191 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
193 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
194 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
195 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
200 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
202 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
205 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
239 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
240 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
241 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
247 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
248 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
249 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
250 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
251 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
252 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
253 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
254 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
255 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
256 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
257 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
260 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
285 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
288 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
289 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
292 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
295 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
296 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
304 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
305 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
306 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
307 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
316 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
317 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
328 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
329 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
330 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
333 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
334 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
335 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
336 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
337 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
338 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
350 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
353 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
358 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
359 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
368 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
372 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
377 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
378 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
379 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
380 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
381 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
382 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
383 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
384 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
385 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
386 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
387 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
388 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
389 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
390 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
391 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
392 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
393 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
394 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
395 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
396 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
397 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
398 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
399 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
400 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
401 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
402 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
403 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
404 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
405 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
409 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
410 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
411 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
412 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
413 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
414 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
415 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
416 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
417 8005258706 Rhizobium sp. R693 Isolate Nodule
418 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
419 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
420 8005321885 Rhizobium sp. R72 Isolate Nodule
421 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
422 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
423 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
424 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
425 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
426 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.6
Metatranscriptomes 0
Isolates 15.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.15
Nodule 6.92
Rhizoplane 2.4
Rhizosphere 50.28
Stem 0
Stem Tuber 0
Unclassified 16.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1002313 3300001978 Bacteria 1540
2 JGI24740J21852_10006148 3300001979 Bacteria 5008
3 JGI25155J39150_1000007 3300002704 Bacteria 238857
4 JGI25156J39149_1000050 3300002705 Bacteria 89634
5 JGI25156J39149_1009817 3300002705 Bacteria 2295
6 JGI25162J39368_1000206 3300002737 Bacteria 62562
7 JGI25162J39368_1000418 3300002737 Bacteria 34635
8 JGI25154J39366_1000035 3300002738 Bacteria 172224
9 JGI25158J39367_1001462 3300002739 Bacteria 4132
10 JGI25157J39369_1000036 3300002741 Bacteria 133671
11 JGI25157J39369_1000331 3300002741 Bacteria 33478
12 JGI25157J39369_1000580 3300002741 Bacteria 21643
13 JGI25163J39215_1000434 3300002771 Bacteria 12920
14 JGI25164J39214_1000091 3300002772 Bacteria 90400
15 JGI25152J39213_1003362 3300002773 Bacteria 5489
16 JGI25152J39213_1003573 3300002773 Bacteria 5263
17 JGI25159J45721_1000175 3300002987 Bacteria 29637
18 JGI25151J46595_10000373 3300003187 Bacteria 46885
19 JGI25165J46597_1000196 3300003214 Bacteria 90400
20 JGI25165J46597_1000375 3300003214 Bacteria 49445
21 JGI25153J46596_10007668 3300003215 Bacteria 5263
22 JGI25153J46596_10011456 3300003215 Bacteria 3918
23 rootH1_10021276 3300003316 Bacteria 2697
24 rootH2_10052331 3300003320 Bacteria 11944
25 rootL2_10052043 3300003322 Bacteria 3812
26 JGI25160J50197_1000365 3300003354 Bacteria 29637
27 JGI25160J50197_1009247 3300003354 Bacteria 3674
28 JGI25161J50226_1000280 3300003374 Bacteria 29331
29 JGI25161J50226_1000331 3300003374 Bacteria 25691
30 JGI25404J52841_10002599 3300003659 Bacteria 3441
31 Ga0055538_1002018 3300003751 Bacteria 3289
32 Ga0055535_1000240 3300003761 Bacteria 57957
33 Ga0055535_1000375 3300003761 Bacteria 42689
34 Ga0055542_1000215 3300003762 Bacteria 70610
35 Ga0055542_1000244 3300003762 Bacteria 62562
36 Ga0055542_1019813 3300003762 Bacteria 997
37 Ga0055529_1000170 3300003763 Bacteria 90400
38 Ga0055526_1001092 3300003771 Bacteria 19774
39 Ga0055526_1002806 3300003771 Bacteria 11539
40 Ga0055524_1009480 3300003775 Bacteria 3955
41 Ga0055524_1018050 3300003775 Bacteria 2465
42 Ga0055528_1000864 3300003790 Bacteria 20538
43 Ga0055528_1015817 3300003790 Bacteria 2702
44 Ga0055540_1004874 3300003792 Bacteria 5871
45 Ga0055540_1007295 3300003792 Bacteria 4208
46 Ga0055540_1027147 3300003792 Bacteria 1374
47 Ga0055531_10020946 3300003794 Bacteria 2560
48 Ga0055543_1000372 3300004625 Bacteria 29554
49 Ga0055543_1000646 3300004625 Bacteria 18584
50 Ga0065165_1000199 3300005262 Bacteria 104204
51 Ga0065165_1001221 3300005262 Bacteria 29554
52 Ga0065165_1026237 3300005262 Bacteria 1920
53 Ga0065714_10002557 3300005288 Bacteria 15625
54 Ga0070661_100013998 3300005344 Bacteria 5641
55 Ga0070661_100044404 3300005344 Bacteria 3247
56 Ga0070674_100091000 3300005356 Bacteria 2202
57 Ga0070667_100000434 3300005367 Bacteria 44002
58 Ga0070667_100006154 3300005367 Bacteria 9973
59 Ga0070709_10037640 3300005434 Bacteria 2956
60 Ga0070714_100207444 3300005435 Bacteria 1795
61 Ga0070713_100011166 3300005436 Bacteria 6530
62 Ga0070711_100021813 3300005439 Bacteria 4145
63 Ga0070700_100295987 3300005441 Bacteria 1179
64 Ga0070694_100182492 3300005444 Bacteria 1553
65 Ga0070663_100000053 3300005455 Bacteria 52160
66 Ga0070699_100215654 3300005518 Bacteria 1709
67 Ga0070699_100374324 3300005518 Bacteria 1285
68 Ga0070679_100052069 3300005530 Bacteria 4079
69 Ga0070696_100014147 3300005546 Bacteria 5355
70 Ga0070696_100063955 3300005546 Bacteria 2578
71 Ga0070665_100027525 3300005548 Bacteria 5726
72 Ga0070665_100286607 3300005548 Bacteria 1649
73 Ga0068855_100029037 3300005563 Bacteria 6614
74 Ga0068855_100051022 3300005563 Bacteria 4874
75 Ga0068854_100000391 3300005578 Bacteria 27510
76 Ga0068856_100037139 3300005614 Bacteria 4779
77 Ga0068856_100188542 3300005614 Bacteria 2076
78 Ga0068861_100377894 3300005719 Bacteria 1251
79 Ga0068860_100070916 3300005843 Bacteria 3312
80 Ga0068860_100143228 3300005843 Bacteria 2298
81 Ga0068862_100045422 3300005844 Bacteria 3749
82 Ga0081455_10022242 3300005937 Bacteria 5931
83 Ga0081455_10040306 3300005937 Bacteria 4120
84 Ga0081455_10065672 3300005937 Bacteria 3033
85 Ga0081540_1001968 3300005983 Bacteria 17139
86 Ga0081540_1004717 3300005983 Bacteria 10312
87 Ga0075365_10104848 3300006038 Bacteria 1939
88 Ga0075368_10039933 3300006042 Bacteria 1841
89 Ga0075363_100108742 3300006048 Bacteria 1540
90 Ga0075363_100182366 3300006048 Bacteria 1195
91 Ga0070716_100008492 3300006173 Bacteria 5097
92 Ga0070716_100112198 3300006173 Bacteria 1692
93 Ga0070712_100012612 3300006175 Bacteria 5376
94 Ga0075367_10005561 3300006178 Bacteria 6278
95 Ga0075369_10001899 3300006186 Bacteria 7324
96 Ga0075369_10016370 3300006186 Bacteria 2991
97 Ga0075428_100435820 3300006844 Bacteria 1404
98 Ga0075436_100020617 3300006914 Bacteria 4524
99 Ga0099795_10015083 3300007788 Bacteria 2411
100 Ga0105250_10023960 3300009092 Bacteria 2460
101 Ga0105240_10000985 3300009093 Bacteria 50823
102 Ga0105240_10001505 3300009093 Bacteria 39693
103 Ga0105240_10005162 3300009093 Bacteria 19532
104 Ga0105240_10080521 3300009093 Bacteria 4005
105 Ga0105240_10161761 3300009093 Bacteria 2659
106 Ga0111539_10000323 3300009094 Bacteria 58458
107 Ga0105245_10361143 3300009098 Bacteria 1441
108 Ga0114129_10671110 3300009147 Bacteria 1335
109 Ga0105241_10092223 3300009174 Bacteria 2391
110 Ga0105248_10000227 3300009177 Bacteria 64494
111 Ga0105248_10007577 3300009177 Bacteria 11924
112 Ga0105237_10002159 3300009545 Bacteria 24750
113 Ga0105238_10000611 3300009551 Bacteria 37533
114 Ga0105249_10000145 3300009553 Bacteria 91408
115 Ga0105249_10096321 3300009553 Bacteria 2776
116 Ga0123342_1021132 3300009766 Bacteria 4623
117 Ga0105239_10000080 3300010375 Bacteria 134982
118 Ga0105239_10002299 3300010375 Bacteria 24398
119 Ga0105239_10064026 3300010375 Unclassified 4037
120 Ga0105239_10225837 3300010375 Bacteria 2100
121 Ga0105239_10265937 3300010375 Bacteria 1928
122 Ga0157370_10000131 3300013104 Bacteria 89805
123 Ga0157370_10087637 3300013104 Bacteria 2924
124 Ga0157369_10008814 3300013105 Bacteria 11557
125 Ga0157369_10031912 3300013105 Bacteria 5796
126 Ga0157369_10399465 3300013105 Bacteria 1426
127 Ga0157374_10462300 3300013296 Bacteria 1271
128 Ga0163162_10008330 3300013306 Bacteria 10113
129 Ga0163162_10070294 3300013306 Bacteria 3552
130 Ga0163162_10107680 3300013306 Bacteria 2883
131 Ga0157375_10145570 3300013308 Bacteria 2500
132 Ga0157380_10220533 3300014326 Bacteria 1696
133 Ga0182008_10030134 3300014497 Bacteria 2737
134 Ga0182008_10036340 3300014497 Bacteria 2465
135 Ga0182005_1000112 3300015265 Bacteria 58115
136 Ga0213872_10001285 3300021361 Bacteria 16783
137 Ga0213872_10001559 3300021361 Bacteria 14652
138 Ga0213872_10016889 3300021361 Bacteria 3382
139 Ga0213872_10051233 3300021361 Bacteria 1873
140 Ga0209435_100005 3300025206 Bacteria 573745
141 Ga0209435_107069 3300025206 Bacteria 1246
142 Ga0209760_100284 3300025207 Bacteria 18011
143 Ga0209436_100110 3300025208 Bacteria 41189
144 Ga0209436_100259 3300025208 Bacteria 24235
145 Ga0209784_100074 3300025224 Bacteria 144366
146 Ga0209672_101334 3300025228 Bacteria 9368
147 Ga0209672_103153 3300025228 Bacteria 3545
148 Ga0209147_111962 3300025229 Bacteria 946
149 Ga0207427_100079 3300025231 Bacteria 145096
150 Ga0207427_101222 3300025231 Bacteria 9942
151 Ga0209437_100060 3300025233 Bacteria 355034
152 Ga0209437_100163 3300025233 Bacteria 145370
153 Ga0209258_100196 3300025242 Bacteria 124063
154 Ga0209258_100290 3300025242 Bacteria 82647
155 Ga0207425_1001672 3300025245 Bacteria 8864
156 Ga0209646_1000011 3300025246 Bacteria 573745
157 Ga0209646_1000369 3300025246 Bacteria 29925
158 Ga0209026_1000008 3300025250 Bacteria 573745
159 Ga0209026_1000064 3300025250 Bacteria 211303
160 Ga0209026_1000109 3300025250 Bacteria 144563
161 Ga0209148_1000001 3300025254 Bacteria 2545271
162 Ga0209148_1000262 3300025254 Bacteria 82647
163 Ga0209148_1001305 3300025254 Bacteria 13334
164 Ga0209148_1002897 3300025254 Bacteria 5238
165 Ga0209759_1000004 3300025256 Bacteria 573745
166 Ga0209759_1000518 3300025256 Bacteria 41664
167 Ga0209759_1001130 3300025256 Bacteria 17123
168 Ga0209129_1000226 3300025258 Bacteria 63537
169 Ga0209129_1003999 3300025258 Bacteria 6057
170 Ga0209129_1005143 3300025258 Bacteria 4773
171 Ga0209233_1000002 3300025261 Bacteria 2501366
172 Ga0209233_1000275 3300025261 Bacteria 72941
173 Ga0209455_1000155 3300025272 Bacteria 121004
174 Ga0209455_1002312 3300025272 Bacteria 7460
175 Ga0209455_1020260 3300025272 Bacteria 1320
176 Ga0209673_1001495 3300025273 Bacteria 21722
177 Ga0209673_1042173 3300025273 Bacteria 1286
178 Ga0209130_1000023 3300025284 Bacteria 359355
179 Ga0209130_1000598 3300025284 Bacteria 34961
180 Ga0209676_1000286 3300025292 Bacteria 103478
181 Ga0209676_1005120 3300025292 Bacteria 6988
182 Ga0209025_1000969 3300025294 Bacteria 43045
183 Ga0209025_1001885 3300025294 Bacteria 24518
184 Ga0209025_1004327 3300025294 Bacteria 12409
185 Ga0209025_1010204 3300025294 Bacteria 6404
186 Ga0209025_1024943 3300025294 Bacteria 3065
187 Ga0209025_1060118 3300025294 Bacteria 1429
188 Ga0209564_1000393 3300025295 Bacteria 78338
189 Ga0209564_1000692 3300025295 Bacteria 49341
190 Ga0209758_1000390 3300025297 Bacteria 75869
191 Ga0209758_1000422 3300025297 Bacteria 71804
192 Ga0209758_1000792 3300025297 Bacteria 45045
193 Ga0209758_1005297 3300025297 Bacteria 10072
194 Ga0209758_1008994 3300025297 Bacteria 6315
195 Ga0209758_1009269 3300025297 Bacteria 6158
196 Ga0209758_1010618 3300025297 Bacteria 5480
197 Ga0209758_1011701 3300025297 Bacteria 5039
198 Ga0209758_1023429 3300025297 Bacteria 2791
199 Ga0209758_1037846 3300025297 Bacteria 1859
200 Ga0209758_1078282 3300025297 Bacteria 1010
201 Ga0209050_1007028 3300025298 Bacteria 6467
202 Ga0209256_1001225 3300025299 Bacteria 28613
203 Ga0209256_1004144 3300025299 Bacteria 9364
204 Ga0209256_1007631 3300025299 Bacteria 5271
205 Ga0207426_1000087 3300025302 Bacteria 288870
206 Ga0207426_1000779 3300025302 Bacteria 34961
207 Ga0207426_1004887 3300025302 Bacteria 6338
208 Ga0209051_1000321 3300025303 Bacteria 72390
209 Ga0209051_1002790 3300025303 Bacteria 12052
210 Ga0209051_1003739 3300025303 Bacteria 9784
211 Ga0209051_1008707 3300025303 Bacteria 5337
212 Ga0209051_1070565 3300025303 Bacteria 1053
213 Ga0209257_1003172 3300025304 Bacteria 14622
214 Ga0209257_1009080 3300025304 Bacteria 5436
215 Ga0207696_1000077 3300025711 Bacteria 209611
216 Ga0207696_1029952 3300025711 Bacteria 1658
217 Ga0207653_10058255 3300025885 Bacteria 1298
218 Ga0207692_10016657 3300025898 Bacteria 3261
219 Ga0207647_10000014 3300025904 Bacteria 143525
220 Ga0207699_10006403 3300025906 Bacteria 5697
221 Ga0207705_10049073 3300025909 Bacteria 3038
222 Ga0207707_10182687 3300025912 Bacteria 1831
223 Ga0207695_10000529 3300025913 Bacteria 80214
224 Ga0207695_10001440 3300025913 Bacteria 39881
225 Ga0207695_10020250 3300025913 Bacteria 7625
226 Ga0207652_10099821 3300025921 Bacteria 2562
227 Ga0207646_10450407 3300025922 Bacteria 1161
228 Ga0207681_10023218 3300025923 Bacteria 3965
229 Ga0207664_10293412 3300025929 Bacteria 1429
230 Ga0207706_10010266 3300025933 Bacteria 8562
231 Ga0207665_10096152 3300025939 Bacteria 2060
232 Ga0207711_10000969 3300025941 Bacteria 27463
233 Ga0207689_10003593 3300025942 Bacteria 14162
234 Ga0207667_10000228 3300025949 Bacteria 78952
235 Ga0207712_10000124 3300025961 Bacteria 83410
236 Ga0207712_10305377 3300025961 Bacteria 1308
237 Ga0207712_10316039 3300025961 Bacteria 1287
238 Ga0207668_10011193 3300025972 Bacteria 5445
239 Ga0207668_10136143 3300025972 Bacteria 1882
240 Ga0207668_10143638 3300025972 Bacteria 1839
241 Ga0207640_10000120 3300025981 Bacteria 59715
242 Ga0207658_10000032 3300025986 Bacteria 162260
243 Ga0207658_10111560 3300025986 Bacteria 2163
244 Ga0207678_10000378 3300026067 Bacteria 40708
245 Ga0207678_10117331 3300026067 Unclassified 2271
246 Ga0207708_10013899 3300026075 Bacteria 6018
247 Ga0207702_10173265 3300026078 Bacteria 1981
248 Ga0207702_10349444 3300026078 Bacteria 1414
249 Ga0207675_100020288 3300026118 Bacteria 6197
250 Ga0207675_100548234 3300026118 Bacteria 1155
251 Ga0209179_1017514 3300027512 Bacteria 1358
252 Ga0207428_10000129 3300027907 Bacteria 104467
253 Ga0268266_10000764 3300028379 Bacteria 42997
254 Ga0268266_10174536 3300028379 Bacteria 1953
255 Ga0268265_10006979 3300028380 Bacteria 7640
256 Ga0268264_10010225 3300028381 Bacteria 7765
257 Ga0307515_10020126 3300028794 Bacteria 11935
258 Ga0307512_10018529 3300030522 Bacteria 6358
259 Ga0307513_10013523 3300031456 Bacteria 10013
260 Ga0307507_10013205 3300033179 Bacteria 10067
261 Ga0307510_10017084 3300033180 Bacteria 8560
262 Ga0307510_10024486 3300033180 Bacteria 6973
263 Ga0307510_10248538 3300033180 Bacteria 1268
264 Ga0373936_0070981 3300035113 Bacteria 1435
265 Ga0395900_0000035 3300037418 Bacteria 254301
266 Ga0395898_0207809 3300037466 Bacteria 1868
267 Ga0395901_0033375 3300038443 Bacteria 5313
268 Ga0436361_0165235 3300039447 Bacteria 5547
269 Ga0436361_0431025 3300039447 Bacteria 3393
270 Ga0436361_0645665 3300039447 Bacteria 29461
271 Ga0436361_0864259 3300039447 Bacteria 3525
272 Ga0436361_1035230 3300039447 Bacteria 5145
273 Ga0439466_0006569 3300041411 Bacteria 4417
274 Ga0439465_0018317 3300041413 Bacteria 2188
275 Ga0439465_0025374 3300041413 Bacteria 1870
276 Ga0439465_0061691 3300041413 Bacteria 1243
277 Ga0451835_0241946 3300041492 Bacteria 5513
278 Ga0451845_0706423 3300041501 Bacteria 7524
279 Ga0451849_0378119 3300041505 Bacteria 2844
280 Ga0451855_1793643 3300041511 Bacteria 1482
281 Ga0451853_2803005 3300041512 Bacteria 3915
282 Ga0439456_009747 3300042013 Bacteria 1982
283 Ga0439462_0019976 3300042015 Bacteria 1746
284 Ga0439463_000088 3300042016 Bacteria 21428
285 Ga0439434_0024696 3300042435 Bacteria 1814
286 Ga0466969_0014693 3300044656 Bacteria 4115
287 Ga0466972_0159299 3300044658 Bacteria 1061
288 Ga0466982_0000002 3300044672 Bacteria 454900
289 Ga0466982_0001214 3300044672 Bacteria 9081
290 Ga0466965_0053560 3300044683 Bacteria 2005
291 Ga0466966_0014642 3300044684 Bacteria 5192
292 Ga0466966_0073888 3300044684 Bacteria 2132
293 Ga0466966_0097293 3300044684 Bacteria 1822
294 Ga0466961_0000643 3300044693 Bacteria 21937
295 Ga0466961_0000993 3300044693 Bacteria 17503
296 Ga0466961_0065787 3300044693 Bacteria 2303
297 Ga0466963_0142432 3300044694 Bacteria 1661
298 Ga0466964_0002071 3300044706 Bacteria 7055
299 Ga0466971_0005331 3300044719 Bacteria 5575
300 Ga0466968_0005525 3300044735 Bacteria 4734
301 Ga0466968_0061075 3300044735 Bacteria 1625
302 Ga0466970_0031649 3300044765 Bacteria 2794
303 Ga0466970_0108407 3300044765 Bacteria 1516
304 Ga0466970_0117238 3300044765 Bacteria 1456
305 Ga0466957_0000548 3300044842 Bacteria 18973
306 Ga0466957_0079181 3300044842 Bacteria 2044
307 Ga0466957_0398066 3300044842 Bacteria 941
308 Ga0466960_0003128 3300044901 Bacteria 6343
309 Ga0466959_0019933 3300045049 Bacteria 4937
310 Ga0466959_0114527 3300045049 Bacteria 1921
311 Ga0466959_0189387 3300045049 Bacteria 1436
312 Ga0466958_0018727 3300045836 Bacteria 4022
313 Ga0466958_0063994 3300045836 Bacteria 2243
314 Ga0466958_0082451 3300045836 Bacteria 1981
315 Ga0466967_0112250 3300045976 Bacteria 2506
316 Ga0495617_000066 3300046452 Bacteria 92026
317 Ga0495617_000091 3300046452 Bacteria 64325
318 Ga0495617_000176 3300046452 Bacteria 40516
319 Ga0495627_009919 3300046453 Bacteria 3486
320 Ga0495592_0056536 3300046454 Bacteria 2899
321 Ga0495590_0035118 3300046457 Bacteria 1750
322 Ga0495590_0095244 3300046457 Bacteria 1055
323 Ga0495629_0048881 3300046459 Bacteria 2965
324 Ga0495638_0000139 3300046460 Bacteria 114810
325 Ga0495638_0000300 3300046460 Bacteria 63643
326 Ga0495638_0001061 3300046460 Bacteria 26873
327 Ga0495638_0001453 3300046460 Bacteria 21399
328 Ga0495638_0008888 3300046460 Bacteria 7086
329 Ga0495638_0026773 3300046460 Bacteria 3736
330 Ga0495638_0154337 3300046460 Bacteria 1330
331 Ga0495653_0016662 3300046463 Bacteria 5979
332 Ga0495650_0051922 3300046471 Bacteria 1686
333 Ga0495580_0075267 3300046472 Bacteria 2356
334 Ga0495605_0013429 3300046474 Bacteria 4512
335 Ga0495605_0023646 3300046474 Bacteria 3227
336 Ga0495662_0000570 3300046476 Bacteria 16973
337 Ga0495662_0031509 3300046476 Bacteria 2561
338 Ga0495664_0008493 3300046477 Bacteria 5728
339 Ga0495585_0000112 3300046492 Bacteria 87291
340 Ga0495585_0017367 3300046492 Bacteria 4156
341 Ga0495607_0000006 3300046501 Bacteria 281664
342 Ga0495607_0000066 3300046501 Bacteria 103573
343 Ga0495607_0000067 3300046501 Bacteria 102663
344 Ga0495607_0004558 3300046501 Bacteria 10168
345 Ga0495607_0041453 3300046501 Bacteria 2735
346 Ga0495583_0036087 3300046506 Bacteria 2354
347 Ga0495583_0090367 3300046506 Bacteria 1319
348 Ga0495606_0003058 3300046507 Bacteria 18238
349 Ga0495606_0041995 3300046507 Bacteria 3062
350 Ga0495606_0078264 3300046507 Bacteria 2063
351 Ga0495608_0080020 3300046511 Bacteria 2124
352 Ga0495616_0011069 3300046513 Bacteria 5183
353 Ga0495620_0000066 3300046515 Bacteria 89405
354 Ga0495620_0006745 3300046515 Bacteria 6279
355 Ga0495620_0007343 3300046515 Bacteria 5999
356 Ga0495628_0031555 3300046516 Bacteria 4284
357 Ga0495631_0000124 3300046518 Bacteria 51693
358 Ga0495632_0020467 3300046519 Bacteria 3581
359 Ga0495632_0159835 3300046519 Bacteria 1038
360 Ga0495637_0023889 3300046520 Bacteria 2768
361 Ga0495643_0018843 3300046522 Bacteria 3998
362 Ga0495644_0070615 3300046523 Bacteria 1312
363 Ga0495648_0000331 3300046524 Bacteria 52275
364 Ga0495648_0002339 3300046524 Bacteria 17604
365 Ga0495648_0018469 3300046524 Bacteria 4933
366 Ga0495648_0018841 3300046524 Bacteria 4871
367 Ga0495663_0010954 3300046525 Bacteria 2524
368 Ga0495666_0002852 3300046526 Bacteria 8653
369 Ga0495652_0127870 3300046529 Bacteria 2016
370 Ga0495654_0002386 3300046530 Bacteria 12115
371 Ga0495665_0060186 3300046531 Bacteria 2005
372 Ga0495640_0060789 3300046533 Bacteria 2568
373 Ga0495640_0189403 3300046533 Bacteria 1308
374 Ga0495586_0100431 3300046535 Bacteria 1605
375 Ga0495609_0010003 3300046538 Bacteria 4567
376 Ga0495609_0035576 3300046538 Bacteria 2254
377 Ga0495609_0120269 3300046538 Bacteria 1129
378 Ga0495597_0000005 3300046542 Bacteria 286580
379 Ga0495597_0011850 3300046542 Bacteria 4220
380 Ga0495645_0041356 3300046543 Bacteria 3361
381 Ga0495633_0016046 3300046558 Bacteria 3874
382 Ga0495633_0046472 3300046558 Bacteria 2054
383 Ga0495667_0009593 3300046559 Bacteria 6563
384 Ga0495668_0000105 3300046616 Bacteria 133981
385 Ga0495668_0076621 3300046616 Bacteria 1836
386 Ga0495668_0104652 3300046616 Bacteria 1548
387 Ga0495634_0037605 3300046642 Bacteria 3306
388 Ga0495611_0000002 3300046648 Bacteria 705677
389 Ga0495611_0002278 3300046648 Bacteria 8885
390 Ga0495611_0017707 3300046648 Bacteria 3051
391 Ga0495611_0085927 3300046648 Bacteria 1451
392 Ga0495625_0000002 3300046660 Bacteria 813323
393 Ga0495625_0000648 3300046660 Bacteria 50041
394 Ga0495625_0007951 3300046660 Bacteria 9113
395 Ga0495625_0017683 3300046660 Bacteria 5578
396 Ga0495625_0021355 3300046660 Bacteria 4986
397 Ga0495625_0023158 3300046660 Bacteria 4746
398 Ga0495625_0057646 3300046660 Bacteria 2761
399 Ga0495625_0092782 3300046660 Bacteria 2086
400 Ga0495625_0153030 3300046660 Bacteria 1549
401 Ga0495625_0207540 3300046660 Bacteria 1289
402 Ga0495661_0001828 3300046665 Bacteria 17057
403 Ga0495661_0089528 3300046665 Bacteria 1754
404 Ga0495588_0042797 3300046674 Bacteria 2316
405 Ga0495657_0004205 3300046675 Bacteria 11524
406 Ga0495657_0147439 3300046675 Bacteria 1463
407 Ga0495599_0037866 3300046678 Bacteria 3029
408 Ga0495646_0016649 3300046680 Bacteria 4668
409 Ga0495613_0023111 3300046689 Bacteria 4633
410 Ga0495624_0037538 3300046690 Bacteria 3115
411 Ga0495670_0005355 3300046691 Bacteria 6310
412 Ga0495670_0028059 3300046691 Bacteria 2790
413 Ga0495670_0038191 3300046691 Bacteria 2394
414 Ga0495671_0000220 3300046692 Bacteria 49354
415 Ga0495671_0140452 3300046692 Bacteria 1177
416 Ga0495589_0000067 3300046794 Bacteria 99395
417 Ga0495589_0055248 3300046794 Bacteria 1957
418 Ga0495600_0021552 3300046809 Bacteria 4128
419 Ga0495660_0000432 3300046810 Bacteria 35230
420 Ga0495660_0002239 3300046810 Bacteria 12446
421 Ga0495660_0011631 3300046810 Bacteria 5105
422 Ga0495660_0139302 3300046810 Bacteria 1209
423 Ga0495636_0006453 3300047318 Bacteria 4609
424 Ga0495674_0059369 3300047319 Bacteria 3340
425 Ga0495672_0007690 3300047320 Bacteria 8072
426 Ga0495672_0011865 3300047320 Bacteria 6118
427 Ga0495672_0042575 3300047320 Bacteria 2737
428 Ga0495683_0042689 3300047323 Bacteria 2286
429 Ga0495683_0082989 3300047323 Bacteria 1561
430 Ga0495687_000136 3300047443 Bacteria 113298
431 Ga0495687_023120 3300047443 Bacteria 2974
432 Ga0495675_0013119 3300047444 Bacteria 5227
433 Ga0495679_000003 3300047446 Bacteria 787868
434 Ga0495673_0000293 3300047469 Bacteria 67070
435 Ga0495673_0002760 3300047469 Bacteria 12021
436 Ga0495673_0004862 3300047469 Bacteria 8302
437 Ga0495673_0016493 3300047469 Bacteria 3775
438 Ga0495684_0023089 3300047471 Bacteria 4784
439 Ga0495686_0000024 3300047472 Bacteria 400343
440 Ga0495686_0000769 3300047472 Bacteria 42306
441 Ga0495686_0002120 3300047472 Bacteria 19433
442 Ga0495686_0004287 3300047472 Bacteria 11814
443 Ga0495686_0014472 3300047472 Bacteria 5426
444 Ga0495686_0015344 3300047472 Bacteria 5236
445 Ga0495626_0067585 3300048091 Bacteria 1614
446 Ga0496100_0094557 3300048903 Bacteria 2047
447 Ga0496101_0012871 3300048904 Bacteria 5596
448 Ga0496101_0141082 3300048904 Bacteria 1836
449 Ga0496104_0006478 3300048907 Bacteria 10292
450 Ga0496105_0004378 3300048908 Bacteria 10632
451 Ga0496106_0000028 3300048909 Bacteria 143296
452 Ga0496106_0033388 3300048909 Bacteria 3840
453 Ga0496106_0108491 3300048909 Bacteria 2159
454 Ga0496107_0000291 3300048910 Bacteria 26731
455 Ga0496107_0056313 3300048910 Bacteria 2841
456 Ga0496113_0096063 3300048916 Bacteria 2291
457 Ga0496115_0037183 3300048918 Bacteria 3858
458 Ga0496117_0001480 3300048920 Bacteria 33719
459 Ga0496117_0010079 3300048920 Bacteria 8676
460 Ga0496117_0037920 3300048920 Bacteria 3583
461 Ga0496117_0038843 3300048920 Bacteria 3521
462 Ga0496117_0068594 3300048920 Bacteria 2393
463 Ga0496117_0150352 3300048920 Bacteria 1379
464 Ga0496117_0172381 3300048920 Bacteria 1254
465 Ga0496118_0000268 3300048921 Bacteria 91201
466 Ga0496118_0000374 3300048921 Bacteria 75346
467 Ga0496118_0000423 3300048921 Bacteria 70256
468 Ga0496118_0011225 3300048921 Bacteria 8770
469 Ga0496118_0018654 3300048921 Bacteria 6239
470 Ga0496118_0051128 3300048921 Bacteria 3164
471 Ga0496118_0195356 3300048921 Bacteria 1205
472 Ga0496119_0000537 3300048922 Bacteria 51588
473 Ga0496119_0000906 3300048922 Bacteria 38547
474 Ga0496119_0064067 3300048922 Bacteria 2184
475 Ga0496119_0085573 3300048922 Bacteria 1804
476 Ga0496119_0089214 3300048922 Bacteria 1756
477 Ga0496119_0137504 3300048922 Bacteria 1323
478 Ga0496120_0000055 3300048923 Bacteria 180856
479 Ga0496120_0067515 3300048923 Bacteria 1975
480 Ga0496121_0000101 3300048924 Bacteria 195984
481 Ga0496121_0000116 3300048924 Bacteria 177260
482 Ga0496121_0002027 3300048924 Bacteria 32114
483 Ga0496121_0019715 3300048924 Bacteria 6727
484 Ga0496121_0063007 3300048924 Bacteria 3033
485 Ga0496121_0161229 3300048924 Bacteria 1639
486 Ga0496121_0166376 3300048924 Bacteria 1606
487 Ga0496121_0240580 3300048924 Bacteria 1261
488 Ga0496122_0000302 3300048925 Bacteria 109564
489 Ga0496122_0030501 3300048925 Bacteria 4517
490 Ga0496122_0054340 3300048925 Bacteria 3009
491 Ga0496122_0117019 3300048925 Bacteria 1731
492 Ga0496122_0171623 3300048925 Bacteria 1306
493 Ga0496123_0000239 3300048926 Bacteria 110475
494 Ga0496123_0009680 3300048926 Bacteria 8641
495 Ga0496123_0038520 3300048926 Bacteria 3358
496 Ga0496123_0072420 3300048926 Bacteria 2144
497 Ga0496124_0043555 3300048927 Bacteria 3858
498 Ga0496124_0045276 3300048927 Bacteria 3773
499 Ga0496124_0049468 3300048927 Bacteria 3586
500 Ga0496124_0130032 3300048927 Bacteria 2001
501 Ga0496124_0163240 3300048927 Bacteria 1734
502 Ga0496125_0003171 3300048928 Bacteria 20382
503 Ga0496125_0004359 3300048928 Bacteria 16404
504 Ga0496126_0000896 3300048929 Bacteria 51766
505 Ga0496126_0037975 3300048929 Bacteria 4484
506 Ga0496126_0041077 3300048929 Bacteria 4284
507 Ga0496126_0052203 3300048929 Bacteria 3717
508 Ga0496126_0191634 3300048929 Bacteria 1731
509 Ga0495678_014000 3300049459 Bacteria 3744
510 Ga0495682_0009229 3300049460 Bacteria 3859
511 Ga0495682_0037073 3300049460 Bacteria 1794
512 Ga0501033_0036676 3300049570 Bacteria 3672
513 Ga0501033_0149227 3300049570 Bacteria 1687
514 Ga0501033_0389615 3300049570 Bacteria 973
515 Ga0501034_0001153 3300049571 Bacteria 36629
516 Ga0501034_0215317 3300049571 Bacteria 1875
517 Ga0501034_0223643 3300049571 Bacteria 1834
518 Ga0501036_0015259 3300049572 Bacteria 6414
519 Ga0501039_0108551 3300049575 Bacteria 2169
520 Ga0501043_0081705 3300049579 Bacteria 2539
521 Ga0501043_0185191 3300049579 Bacteria 1621
522 Ga0501046_0215018 3300049580 Bacteria 1425
523 Ga0501047_0057686 3300049581 Bacteria 3754
524 Ga0501047_0155631 3300049581 Bacteria 2159
525 Ga0501047_0259819 3300049581 Bacteria 1584
526 Ga0501068_0008282 3300049584 Bacteria 5778
527 Ga0501073_0094608 3300049589 Bacteria 2075
528 Ga0501074_0039318 3300049590 Bacteria 3426
529 Ga0501035_0092218 3300049822 Bacteria 2665
530 Ga0501044_0031639 3300049823 Bacteria 5568
531 Ga0501044_0037972 3300049823 Bacteria 5032
532 Ga0501044_0365009 3300049823 Bacteria 1361
533 nmdc:mga03n38_18109_c1 3300050490 Bacteria 2774
534 nmdc:mga0k408_76885_c1 3300050493 Bacteria 1951
535 nmdc:mga07m45_248833_c1 3300050496 Bacteria 1034
536 nmdc:mga08y16_51_c1 3300050511 Bacteria 105348
537 nmdc:mga08x19_46707_c1 3300050514 Bacteria 2770
538 Ga0495601_0000191 3300053077 Bacteria 32447
539 Ga0495601_0204481 3300053077 Bacteria 1290
540 Ga0500635_0004004 3300053080 Bacteria 3759
541 Ga0500643_000027 3300053087 Bacteria 251062
542 Ga0500643_000031 3300053087 Bacteria 204488
543 Ga0500643_000097 3300053087 Bacteria 92120
544 Ga0500643_003087 3300053087 Bacteria 8182
545 Ga0500583_0000703 3300053092 Bacteria 9741
546 Ga0500651_0002913 3300053093 Bacteria 9204
547 Ga0500651_0021159 3300053093 Bacteria 4053
548 Ga0500651_0074743 3300053093 Bacteria 2106
549 Ga0500566_0000009 3300053094 Bacteria 131668
550 Ga0500554_023792 3300053102 Bacteria 1727
551 Ga0500555_003009 3300053103 Bacteria 4818
552 Ga0500555_005778 3300053103 Bacteria 3512
553 Ga0500556_0003089 3300053104 Bacteria 4978
554 Ga0500556_0143085 3300053104 Bacteria 940
555 Ga0500562_004959 3300053108 Bacteria 3355
556 Ga0500569_000971 3300053109 Bacteria 5165
557 Ga0500569_003562 3300053109 Bacteria 3195
558 Ga0500572_000142 3300053111 Bacteria 24469
559 Ga0500572_037508 3300053111 Bacteria 1389
560 Ga0500592_014265 3300053116 Bacteria 1273
561 Ga0500595_003417 3300053119 Bacteria 7423
562 Ga0500597_000264 3300053120 Bacteria 10718
563 Ga0500607_100305 3300053121 Bacteria 1439
564 Ga0500608_012605 3300053122 Bacteria 3714
565 Ga0500652_013262 3300053131 Bacteria 2913
566 Ga0500652_045426 3300053131 Bacteria 1781
567 Ga0500658_0001192 3300053134 Bacteria 10585
568 Ga0500659_0107780 3300053135 Bacteria 1436
569 Ga0500559_0005792 3300053136 Bacteria 5633
570 Ga0500559_0101872 3300053136 Bacteria 1323
571 Ga0500564_010005 3300053138 Bacteria 4147
572 Ga0500568_0001664 3300053139 Bacteria 13928
573 Ga0500568_0002341 3300053139 Bacteria 11225
574 Ga0500568_0003692 3300053139 Bacteria 8400
575 Ga0500568_0004641 3300053139 Bacteria 7310
576 Ga0500573_0000067 3300053140 Bacteria 61890
577 Ga0500588_0019395 3300053146 Bacteria 1808
578 Ga0500590_087486 3300053148 Bacteria 1518
579 Ga0500603_000016 3300053150 Bacteria 56563
580 Ga0500604_0036277 3300053151 Bacteria 1470
581 Ga0500616_0001502 3300053153 Bacteria 22017
582 Ga0500616_0142798 3300053153 Bacteria 1116
583 Ga0500619_108657 3300053154 Bacteria 943
584 Ga0500622_0000906 3300053156 Bacteria 25193
585 Ga0500622_0018980 3300053156 Bacteria 3653
586 Ga0500622_0019176 3300053156 Bacteria 3633
587 Ga0500627_0035968 3300053158 Bacteria 2106
588 Ga0500627_0055148 3300053158 Bacteria 1739
589 Ga0500633_0000975 3300053160 Bacteria 5042
590 Ga0500638_030174 3300053162 Bacteria 2610
591 Ga0500638_104347 3300053162 Bacteria 1317
592 Ga0500639_000017 3300053163 Bacteria 114464
593 Ga0500636_0000456 3300053177 Bacteria 22340
594 Ga0500645_006226 3300053730 Bacteria 4282
595 Ga0500596_000049 3300053735 Bacteria 16202
596 Ga0500601_000025 3300053737 Bacteria 33788
597 Ga0466962_0004210 3300061719 Bacteria 6891
598 Ga0466962_0018712 3300061719 Bacteria 3330
599 Ga0466962_0086113 3300061719 Bacteria 1504

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0001480 Ga0496117_0001480_21681_22481 266
2 3300048921 Ga0496118_0000374 Ga0496118_0000374_21708_22508 266
3 3300005441 Ga0070700_100295987 Ga0070700_1002959871 268
4 3300025254 Ga0209148_1001305 Ga0209148_10013056 270
5 3300005518 Ga0070699_100374324 Ga0070699_1003743241 271
6 3300005546 Ga0070696_100014147 Ga0070696_1000141474 271
7 3300044658 Ga0466972_0159299 Ga0466972_0159299_33_851 271
8 3300044684 Ga0466966_0073888 Ga0466966_0073888_531_1349 271
9 3300002773 JGI25152J39213_1003362 JGI25152J39213_10033622 273
10 3300003215 JGI25153J46596_10011456 JGI25153J46596_100114563 273
11 3300003354 JGI25160J50197_1009247 JGI25160J50197_10092474 273
12 3300003374 JGI25161J50226_1000331 JGI25161J50226_100033122 273
13 3300003771 Ga0055526_1002806 Ga0055526_10028068 273
14 3300003775 Ga0055524_1009480 Ga0055524_10094802 273
15 3300003790 Ga0055528_1000864 Ga0055528_100086419 273
16 3300003792 Ga0055540_1004874 Ga0055540_10048746 273
17 3300004625 Ga0055543_1000646 Ga0055543_10006465 273
18 3300005262 Ga0065165_1026237 Ga0065165_10262372 273
19 3300005548 Ga0070665_100286607 Ga0070665_1002866072 273
20 3300025208 Ga0209436_100110 Ga0209436_10011030 273
21 3300025273 Ga0209673_1001495 Ga0209673_100149512 273
22 3300025284 Ga0209130_1000023 Ga0209130_1000023219 273
23 3300025295 Ga0209564_1000393 Ga0209564_100039326 273
24 3300025297 Ga0209758_1000390 Ga0209758_100039048 273
25 3300025299 Ga0209256_1004144 Ga0209256_10041446 273
26 3300025302 Ga0207426_1000087 Ga0207426_1000087143 273
27 3300025303 Ga0209051_1003739 Ga0209051_10037396 273
28 3300041413 Ga0439465_0025374 Ga0439465_0025374_218_1120 273
29 3300046501 Ga0495607_0041453 Ga0495607_0041453_1695_2597 273
30 3300046538 Ga0495609_0120269 Ga0495609_0120269_78_980 274
31 3300046660 Ga0495625_0153030 Ga0495625_0153030_380_1282 274
32 3300025297 Ga0209758_1078282 Ga0209758_10782821 275
33 3300046457 Ga0495590_0095244 Ga0495590_0095244_91_993 275
34 3300048091 Ga0495626_0067585 Ga0495626_0067585_30_932 275
35 3300048927 Ga0496124_0049468 Ga0496124_0049468_297_1199 275
36 3300053136 Ga0500559_0005792 Ga0500559_0005792_4778_5608 275
37 3300025258 Ga0209129_1005143 Ga0209129_10051433 276
38 3300025294 Ga0209025_1060118 Ga0209025_10601182 276
39 3300025297 Ga0209758_1000422 Ga0209758_10004222 276
40 3300053160 Ga0500633_0000975 Ga0500633_0000975_3046_3948 276
41 3300046501 Ga0495607_0004558 Ga0495607_0004558_4737_5633 278
42 3300045836 Ga0466958_0082451 Ga0466958_0082451_669_1568 280
43 3300046506 Ga0495583_0036087 Ga0495583_0036087_1476_2321 280
44 3300061719 Ga0466962_0086113 Ga0466962_0086113_316_1215 280
45 3300048903 Ga0496100_0094557 Ga0496100_0094557_21_872 282
46 3300050496 nmdc:mga07m45_248833_c1 nmdc:mga07m45_248833_c1_12_863 282
47 3300046460 Ga0495638_0154337 Ga0495638_0154337_43_963 283
48 3300039447 Ga0436361_0431025 Ga0436361_0431025_257_1144 284
49 3300002773 JGI25152J39213_1003573 JGI25152J39213_10035734 286
50 3300003215 JGI25153J46596_10007668 JGI25153J46596_100076684 286
51 3300025245 Ga0207425_1001672 Ga0207425_10016722 286
52 3300025258 Ga0209129_1003999 Ga0209129_10039993 286
53 3300025294 Ga0209025_1024943 Ga0209025_10249432 286
54 3300025297 Ga0209758_1000792 Ga0209758_100079238 286
55 iso_pu_bacteria 2977516862 2977521676 286
56 3300053140 Ga0500573_0000067 Ga0500573_0000067_36714_37613 287
57 3300006173 Ga0070716_100112198 Ga0070716_1001121981 288
58 3300025292 Ga0209676_1000286 Ga0209676_100028626 288
59 3300046507 Ga0495606_0003058 Ga0495606_0003058_4894_5796 288
60 3300046524 Ga0495648_0002339 Ga0495648_0002339_12497_13396 288
61 3300046525 Ga0495663_0010954 Ga0495663_0010954_1606_2505 288
62 3300046648 Ga0495611_0002278 Ga0495611_0002278_1843_2742 288
63 3300046660 Ga0495625_0000648 Ga0495625_0000648_27934_28833 288
64 3300046691 Ga0495670_0005355 Ga0495670_0005355_1789_2688 288
65 3300047443 Ga0495687_000136 Ga0495687_000136_4217_5116 288
66 3300047472 Ga0495686_0004287 Ga0495686_0004287_6622_7524 288
67 3300048924 Ga0496121_0240580 Ga0496121_0240580_216_1118 288
68 3300053092 Ga0500583_0000703 Ga0500583_0000703_4691_5590 288
69 iso_pu_bacteria 2841957949 2841961257 288
70 3300046471 Ga0495650_0051922 Ga0495650_0051922_745_1647 289
71 3300047443 Ga0495687_023120 Ga0495687_023120_1984_2856 289
72 3300053109 Ga0500569_003562 Ga0500569_003562_2263_3135 289
73 3300053119 Ga0500595_003417 Ga0500595_003417_4748_5620 289
74 3300053146 Ga0500588_0019395 Ga0500588_0019395_461_1333 289
75 3300006186 Ga0075369_10016370 Ga0075369_100163703 290
76 3300025231 Ga0207427_101222 Ga0207427_1012227 291
77 3300003659 JGI25404J52841_10002599 JGI25404J52841_100025993 292
78 3300005937 Ga0081455_10040306 Ga0081455_100403064 292
79 3300005983 Ga0081540_1001968 Ga0081540_10019683 292
80 3300005983 Ga0081540_1004717 Ga0081540_10047174 292
81 3300053080 Ga0500635_0004004 Ga0500635_0004004_1263_2144 292
82 3300053093 Ga0500651_0074743 Ga0500651_0074743_860_1741 292
83 3300053111 Ga0500572_037508 Ga0500572_037508_294_1175 292
84 3300053122 Ga0500608_012605 Ga0500608_012605_937_1818 292
85 3300053136 Ga0500559_0101872 Ga0500559_0101872_16_897 292
86 3300053138 Ga0500564_010005 Ga0500564_010005_3079_3960 292
87 3300053148 Ga0500590_087486 Ga0500590_087486_78_959 292
88 3300053154 Ga0500619_108657 Ga0500619_108657_51_932 292
89 3300053162 Ga0500638_104347 Ga0500638_104347_375_1256 292
90 3300053177 Ga0500636_0000456 Ga0500636_0000456_18381_19262 292
91 3300053737 Ga0500601_000025 Ga0500601_000025_22784_23665 292
92 iso_pu_bacteria 2593339238 2595448944 292
93 iso_pu_bacteria 2738543009 2739225924 292
94 iso_pu_bacteria 2818991449 2819617828 292
95 iso_pu_bacteria 2824600985 2824604872 292
96 iso_pu_bacteria 2824609381 2824611377 292
97 iso_pu_bacteria 2824653114 2824656064 292
98 iso_pu_bacteria 2876761206 2876764475 292
99 iso_pu_bacteria 2884960567 2884961938 292
100 iso_pu_bacteria 2888419890 2888421605 292
101 3300025297 Ga0209758_1005297 Ga0209758_10052974 293
102 iso_pu_bacteria 2511231006 2511265279 293
103 iso_pu_bacteria 2597489887 2597855458 293
104 iso_pu_bacteria 2599185185 2599485344 293
105 iso_pu_bacteria 2599185257 2599806488 293
106 iso_pu_bacteria 2599185354 2600201146 293
107 iso_pu_bacteria 2671180172 2671772139 293
108 iso_pu_bacteria 2884338543 2884338894 293
109 iso_pu_bacteria 2919085039 2919086411 293
110 iso_pu_bacteria 2941471342 2941471972 293
111 iso_pu_bacteria 8005301065 8005306227 293
112 iso_pu_bacteria 8005688590 8005694076 293
113 3300005937 Ga0081455_10022242 Ga0081455_100222424 294
114 3300025939 Ga0207665_10096152 Ga0207665_100961522 294
115 3300046501 Ga0495607_0000066 Ga0495607_0000066_82250_83185 294
116 3300046520 Ga0495637_0023889 Ga0495637_0023889_1559_2494 294
117 3300047320 Ga0495672_0042575 Ga0495672_0042575_1450_2385 294
118 iso_pu_bacteria 2510917028 2511182805 294
119 iso_pu_bacteria 2513237138 2513869760 294
120 iso_pu_bacteria 2534681796 2535517331 294
121 iso_pu_bacteria 2582581294 2585204586 294
122 iso_pu_bacteria 2582581867 2585402851 294
123 iso_pu_bacteria 2582581867 2585403944 294
124 iso_pu_bacteria 2585427590 2585823487 294
125 iso_pu_bacteria 2585427590 2585825175 294
126 iso_pu_bacteria 2643221599 2644003012 294
127 iso_pu_bacteria 2643221723 2644672122 294
128 iso_pu_bacteria 2857504554 2857507260 294
129 iso_pu_bacteria 2876761206 2876765390 294
130 iso_pu_bacteria 2896384573 2896390935 294
131 iso_pu_bacteria 2909042592 2909048136 294
132 iso_pu_bacteria 2923556063 2923562020 294
133 iso_pu_bacteria 2928135762 2928135817 294
134 iso_pu_bacteria 2928531327 2928533353 294
135 iso_pu_bacteria 2957415311 2957420911 294
136 iso_pu_bacteria 2996887358 2996892620 294
137 iso_pu_bacteria 3005452660 3005455148 294
138 iso_pu_bacteria 8005258706 8005264753 294
139 iso_pu_bacteria 8005321885 8005327147 294
140 3300044656 Ga0466969_0014693 Ga0466969_0014693_2183_3073 295
141 3300044684 Ga0466966_0097293 Ga0466966_0097293_553_1443 295
142 3300044693 Ga0466961_0065787 Ga0466961_0065787_252_1142 295
143 3300044765 Ga0466970_0108407 Ga0466970_0108407_523_1413 295
144 3300044842 Ga0466957_0000548 Ga0466957_0000548_6363_7253 295
145 3300045049 Ga0466959_0019933 Ga0466959_0019933_3086_3976 295
146 3300048922 Ga0496119_0064067 Ga0496119_0064067_1171_2091 295
147 iso_pu_bacteria 2513237144 2513910555 295
148 iso_pu_bacteria 2513237162 2514017821 295
149 iso_pu_bacteria 2551306085 2551683215 295
150 iso_pu_bacteria 2551306089 2551709168 295
151 iso_pu_bacteria 2551306089 2551714063 295
152 iso_pu_bacteria 2582581299 2585230764 295
153 iso_pu_bacteria 2582581304 2585257773 295
154 iso_pu_bacteria 2582581308 2585280505 295
155 iso_pu_bacteria 2582581315 2585322777 295
156 iso_pu_bacteria 2585427527 2585532732 295
157 iso_pu_bacteria 2585427530 2585554252 295
158 iso_pu_bacteria 2585427608 2585898743 295
159 iso_pu_bacteria 2615840626 2616307139 295
160 iso_pu_bacteria 2615840698 2616554740 295
161 iso_pu_bacteria 2617270742 2617383093 295
162 iso_pu_bacteria 2643221634 2644196750 295
163 iso_pu_bacteria 2643221643 2644237984 295
164 iso_pu_bacteria 2643221689 2644497927 295
165 iso_pu_bacteria 2667528174 2671111977 295
166 iso_pu_bacteria 2724679232 2725949291 295
167 iso_pu_bacteria 2818991448 2819609799 295
168 iso_pu_bacteria 2818991453 2819639901 295
169 iso_pu_bacteria 2838029111 2838034022 295
170 iso_pu_bacteria 2842475841 2842480810 295
171 iso_pu_bacteria 2842482326 2842483585 295
172 iso_pu_bacteria 2842502639 2842507379 295
173 iso_pu_bacteria 2874168670 2874169225 295
174 iso_pu_bacteria 2882456835 2882463315 295
175 iso_pu_bacteria 2896384573 2896389829 295
176 iso_pu_bacteria 2916048683 2916048732 295
177 iso_pu_bacteria 2916076590 2916082863 295
178 iso_pu_bacteria 2919100787 2919105679 295
179 iso_pu_bacteria 2919408235 2919410481 295
180 iso_pu_bacteria 2957402308 2957406613 295
181 iso_pu_bacteria 2970054988 2970058958 295
182 iso_pu_bacteria 3005409236 3005409312 295
183 iso_pu_bacteria 3005416602 3005418687 295
184 iso_pu_bacteria 3005445848 3005448918 295
185 iso_pu_bacteria 8005314921 8005318421 295
186 iso_pu_bacteria 8005484373 8005488695 295
187 iso_pu_bacteria 8005563573 8005568490 295
188 iso_pu_bacteria 8005645114 8005645924 295
189 iso_pu_bacteria 8005682033 8005682398 295
190 3300003761 Ga0055535_1000375 Ga0055535_100037518 296
191 3300003762 Ga0055542_1000215 Ga0055542_100021518 296
192 3300005262 Ga0065165_1000199 Ga0065165_100019961 296
193 3300005344 Ga0070661_100013998 Ga0070661_1000139985 296
194 3300005356 Ga0070674_100091000 Ga0070674_1000910001 296
195 3300005367 Ga0070667_100006154 Ga0070667_1000061542 296
196 3300005434 Ga0070709_10037640 Ga0070709_100376403 296
197 3300005436 Ga0070713_100011166 Ga0070713_1000111664 296
198 3300005439 Ga0070711_100021813 Ga0070711_1000218132 296
199 3300005444 Ga0070694_100182492 Ga0070694_1001824922 296
200 3300005546 Ga0070696_100063955 Ga0070696_1000639552 296
201 3300005719 Ga0068861_100377894 Ga0068861_1003778942 296
202 3300005843 Ga0068860_100143228 Ga0068860_1001432281 296
203 3300005937 Ga0081455_10065672 Ga0081455_100656722 296
204 3300006173 Ga0070716_100008492 Ga0070716_1000084926 296
205 3300006175 Ga0070712_100012612 Ga0070712_1000126123 296
206 3300009092 Ga0105250_10023960 Ga0105250_100239602 296
207 3300009098 Ga0105245_10361143 Ga0105245_103611432 296
208 3300009553 Ga0105249_10096321 Ga0105249_100963212 296
209 3300010375 Ga0105239_10225837 Ga0105239_102258372 296
210 3300013296 Ga0157374_10462300 Ga0157374_104623002 296
211 3300013306 Ga0163162_10008330 Ga0163162_100083302 296
212 3300013308 Ga0157375_10145570 Ga0157375_101455702 296
213 3300014326 Ga0157380_10220533 Ga0157380_102205332 296
214 3300025228 Ga0209672_101334 Ga0209672_1013346 296
215 3300025229 Ga0209147_111962 Ga0209147_1119621 296
216 3300025242 Ga0209258_100290 Ga0209258_10029029 296
217 3300025254 Ga0209148_1000262 Ga0209148_100026229 296
218 3300025272 Ga0209455_1002312 Ga0209455_10023124 296
219 3300025297 Ga0209758_1009269 Ga0209758_10092692 296
220 3300025302 Ga0207426_1004887 Ga0207426_10048875 296
221 3300025303 Ga0209051_1008707 Ga0209051_10087076 296
222 3300025711 Ga0207696_1029952 Ga0207696_10299521 296
223 3300025885 Ga0207653_10058255 Ga0207653_100582551 296
224 3300025898 Ga0207692_10016657 Ga0207692_100166572 296
225 3300025906 Ga0207699_10006403 Ga0207699_100064035 296
226 3300025923 Ga0207681_10023218 Ga0207681_100232183 296
227 3300025933 Ga0207706_10010266 Ga0207706_100102664 296
228 3300025942 Ga0207689_10003593 Ga0207689_100035938 296
229 3300025961 Ga0207712_10305377 Ga0207712_103053772 296
230 3300025972 Ga0207668_10011193 Ga0207668_100111932 296
231 3300025986 Ga0207658_10111560 Ga0207658_101115602 296
232 3300026067 Ga0207678_10117331 Ga0207678_101173312 296
233 3300026075 Ga0207708_10013899 Ga0207708_100138993 296
234 3300026118 Ga0207675_100020288 Ga0207675_1000202888 296
235 3300026118 Ga0207675_100548234 Ga0207675_1005482342 296
236 3300028380 Ga0268265_10006979 Ga0268265_100069794 296
237 3300033179 Ga0307507_10013205 Ga0307507_100132054 296
238 3300033180 Ga0307510_10024486 Ga0307510_100244864 296
239 3300033180 Ga0307510_10248538 Ga0307510_102485382 296
240 3300035113 Ga0373936_0070981 Ga0373936_0070981_511_1404 296
241 3300044672 Ga0466982_0000002 Ga0466982_0000002_280555_281496 296
242 3300044672 Ga0466982_0001214 Ga0466982_0001214_2102_2995 296
243 3300044684 Ga0466966_0014642 Ga0466966_0014642_2609_3550 296
244 3300044693 Ga0466961_0000993 Ga0466961_0000993_13170_14063 296
245 3300044706 Ga0466964_0002071 Ga0466964_0002071_3568_4509 296
246 3300044719 Ga0466971_0005331 Ga0466971_0005331_3183_4124 296
247 3300044735 Ga0466968_0005525 Ga0466968_0005525_3470_4411 296
248 3300044842 Ga0466957_0398066 Ga0466957_0398066_15_908 296
249 3300044901 Ga0466960_0003128 Ga0466960_0003128_3090_4031 296
250 3300045049 Ga0466959_0114527 Ga0466959_0114527_169_1110 296
251 3300046452 Ga0495617_000091 Ga0495617_000091_23320_24213 296
252 3300046452 Ga0495617_000176 Ga0495617_000176_31358_32251 296
253 3300046460 Ga0495638_0000139 Ga0495638_0000139_46782_47675 296
254 3300046460 Ga0495638_0001453 Ga0495638_0001453_10914_11807 296
255 3300046492 Ga0495585_0000112 Ga0495585_0000112_48457_49350 296
256 3300046501 Ga0495607_0000067 Ga0495607_0000067_100607_101500 296
257 3300046513 Ga0495616_0011069 Ga0495616_0011069_1597_2490 296
258 3300046515 Ga0495620_0000066 Ga0495620_0000066_23320_24213 296
259 3300046518 Ga0495631_0000124 Ga0495631_0000124_2311_3204 296
260 3300046519 Ga0495632_0159835 Ga0495632_0159835_17_928 296
261 3300046524 Ga0495648_0000331 Ga0495648_0000331_2226_3119 296
262 3300046538 Ga0495609_0010003 Ga0495609_0010003_2061_2954 296
263 3300046616 Ga0495668_0104652 Ga0495668_0104652_322_1215 296
264 3300046648 Ga0495611_0000002 Ga0495611_0000002_546880_547773 296
265 3300046648 Ga0495611_0017707 Ga0495611_0017707_586_1479 296
266 3300046648 Ga0495611_0085927 Ga0495611_0085927_459_1352 296
267 3300046660 Ga0495625_0000002 Ga0495625_0000002_551365_552258 296
268 3300046665 Ga0495661_0001828 Ga0495661_0001828_15515_16408 296
269 3300046692 Ga0495671_0000220 Ga0495671_0000220_13587_14480 296
270 3300046794 Ga0495589_0000067 Ga0495589_0000067_21300_22193 296
271 3300046810 Ga0495660_0000432 Ga0495660_0000432_15193_16086 296
272 3300046810 Ga0495660_0139302 Ga0495660_0139302_183_1094 296
273 3300047323 Ga0495683_0082989 Ga0495683_0082989_582_1538 296
274 3300047446 Ga0495679_000003 Ga0495679_000003_248176_249069 296
275 3300047469 Ga0495673_0004862 Ga0495673_0004862_697_1590 296
276 3300047469 Ga0495673_0016493 Ga0495673_0016493_1714_2607 296
277 3300047472 Ga0495686_0015344 Ga0495686_0015344_4332_5225 296
278 3300048920 Ga0496117_0068594 Ga0496117_0068594_1213_2106 296
279 3300048921 Ga0496118_0051128 Ga0496118_0051128_1307_2200 296
280 3300048922 Ga0496119_0137504 Ga0496119_0137504_80_973 296
281 3300048924 Ga0496121_0166376 Ga0496121_0166376_468_1361 296
282 3300048927 Ga0496124_0045276 Ga0496124_0045276_241_1134 296
283 3300048929 Ga0496126_0041077 Ga0496126_0041077_1392_2285 296
284 3300048929 Ga0496126_0052203 Ga0496126_0052203_2219_3136 296
285 3300049460 Ga0495682_0009229 Ga0495682_0009229_643_1536 296
286 3300053087 Ga0500643_000031 Ga0500643_000031_41151_42044 296
287 3300053087 Ga0500643_000097 Ga0500643_000097_67334_68227 296
288 3300053094 Ga0500566_0000009 Ga0500566_0000009_79449_80342 296
289 3300053103 Ga0500555_003009 Ga0500555_003009_3033_3926 296
290 3300053103 Ga0500555_005778 Ga0500555_005778_800_1693 296
291 3300053104 Ga0500556_0003089 Ga0500556_0003089_3854_4747 296
292 3300053108 Ga0500562_004959 Ga0500562_004959_754_1647 296
293 3300053111 Ga0500572_000142 Ga0500572_000142_8003_8896 296
294 3300053131 Ga0500652_013262 Ga0500652_013262_43_936 296
295 3300053131 Ga0500652_045426 Ga0500652_045426_846_1739 296
296 3300053139 Ga0500568_0004641 Ga0500568_0004641_6128_7021 296
297 3300053150 Ga0500603_000016 Ga0500603_000016_51790_52683 296
298 3300053151 Ga0500604_0036277 Ga0500604_0036277_529_1422 296
299 3300053156 Ga0500622_0019176 Ga0500622_0019176_811_1704 296
300 3300053158 Ga0500627_0035968 Ga0500627_0035968_313_1206 296
301 3300053158 Ga0500627_0055148 Ga0500627_0055148_719_1612 296
302 3300053162 Ga0500638_030174 Ga0500638_030174_975_1868 296
303 3300053163 Ga0500639_000017 Ga0500639_000017_31970_32863 296
304 3300053730 Ga0500645_006226 Ga0500645_006226_2845_3738 296
305 3300053735 Ga0500596_000049 Ga0500596_000049_4992_5885 296
306 3300061719 Ga0466962_0018712 Ga0466962_0018712_1116_2057 296
307 iso_pu_bacteria 2511231027 2511388523 296
308 iso_pu_bacteria 2582581280 2585151975 296
309 iso_pu_bacteria 2582581293 2585194539 296
310 iso_pu_bacteria 2842871566 2842875366 296
311 iso_pu_bacteria 8005542996 8005546146 296
312 3300002705 JGI25156J39149_1009817 JGI25156J39149_10098172 297
313 3300002741 JGI25157J39369_1000331 JGI25157J39369_100033112 297
314 3300005288 Ga0065714_10002557 Ga0065714_1000255712 297
315 3300005344 Ga0070661_100044404 Ga0070661_1000444042 297
316 3300005548 Ga0070665_100027525 Ga0070665_1000275253 297
317 3300005844 Ga0068862_100045422 Ga0068862_1000454222 297
318 3300006914 Ga0075436_100020617 Ga0075436_1000206173 297
319 3300009174 Ga0105241_10092223 Ga0105241_100922233 297
320 3300009551 Ga0105238_10000611 Ga0105238_1000061126 297
321 3300013104 Ga0157370_10087637 Ga0157370_100876372 297
322 3300013105 Ga0157369_10008814 Ga0157369_1000881411 297
323 3300014497 Ga0182008_10036340 Ga0182008_100363402 297
324 3300015265 Ga0182005_1000112 Ga0182005_100011243 297
325 3300021361 Ga0213872_10001285 Ga0213872_100012855 297
326 3300025250 Ga0209026_1000064 Ga0209026_1000064174 297
327 3300025256 Ga0209759_1000518 Ga0209759_100051812 297
328 3300025904 Ga0207647_10000014 Ga0207647_1000001420 297
329 3300030522 Ga0307512_10018529 Ga0307512_100185293 297
330 3300033180 Ga0307510_10017084 Ga0307510_100170843 297
331 3300037418 Ga0395900_0000035 Ga0395900_0000035_49176_50096 297
332 3300038443 Ga0395901_0033375 Ga0395901_0033375_1694_2614 297
333 3300039447 Ga0436361_0165235 Ga0436361_0165235_2184_3077 297
334 3300042013 Ga0439456_009747 Ga0439456_009747_1034_1930 297
335 3300042015 Ga0439462_0019976 Ga0439462_0019976_198_1094 297
336 3300042016 Ga0439463_000088 Ga0439463_000088_6031_6927 297
337 3300046452 Ga0495617_000066 Ga0495617_000066_27891_28787 297
338 3300046453 Ga0495627_009919 Ga0495627_009919_1391_2287 297
339 3300046457 Ga0495590_0035118 Ga0495590_0035118_688_1584 297
340 3300046460 Ga0495638_0026773 Ga0495638_0026773_938_1834 297
341 3300046474 Ga0495605_0023646 Ga0495605_0023646_1422_2318 297
342 3300046660 Ga0495625_0017683 Ga0495625_0017683_1348_2244 297
343 3300046660 Ga0495625_0057646 Ga0495625_0057646_815_1711 297
344 3300046691 Ga0495670_0028059 Ga0495670_0028059_817_1713 297
345 3300047472 Ga0495686_0000024 Ga0495686_0000024_36964_37860 297
346 3300048920 Ga0496117_0010079 Ga0496117_0010079_2926_3822 297
347 3300048920 Ga0496117_0037920 Ga0496117_0037920_183_1079 297
348 3300048921 Ga0496118_0000268 Ga0496118_0000268_72003_72899 297
349 3300048921 Ga0496118_0000423 Ga0496118_0000423_8058_8954 297
350 3300048924 Ga0496121_0000116 Ga0496121_0000116_176301_177197 297
351 3300048925 Ga0496122_0117019 Ga0496122_0117019_42_938 297
352 3300048926 Ga0496123_0038520 Ga0496123_0038520_987_1883 297
353 3300048928 Ga0496125_0003171 Ga0496125_0003171_8675_9571 297
354 3300049460 Ga0495682_0037073 Ga0495682_0037073_397_1293 297
355 3300049589 Ga0501073_0094608 Ga0501073_0094608_256_1155 297
356 3300050514 nmdc:mga08x19_46707_c1 nmdc:mga08x19_46707_c1_1781_2689 297
357 3300053087 Ga0500643_000027 Ga0500643_000027_63438_64334 297
358 3300053116 Ga0500592_014265 Ga0500592_014265_157_1053 297
359 iso_pu_bacteria 2521172590 2521557203 297
360 3300002737 JGI25162J39368_1000206 JGI25162J39368_100020613 298
361 3300002739 JGI25158J39367_1001462 JGI25158J39367_10014624 298
362 3300002741 JGI25157J39369_1000580 JGI25157J39369_10005808 298
363 3300002771 JGI25163J39215_1000434 JGI25163J39215_10004348 298
364 3300002772 JGI25164J39214_1000091 JGI25164J39214_100009181 298
365 3300002987 JGI25159J45721_1000175 JGI25159J45721_100017525 298
366 3300003187 JGI25151J46595_10000373 JGI25151J46595_1000037334 298
367 3300003214 JGI25165J46597_1000196 JGI25165J46597_100019681 298
368 3300003354 JGI25160J50197_1000365 JGI25160J50197_100036525 298
369 3300003374 JGI25161J50226_1000280 JGI25161J50226_100028015 298
370 3300003751 Ga0055538_1002018 Ga0055538_10020184 298
371 3300003761 Ga0055535_1000240 Ga0055535_100024051 298
372 3300003762 Ga0055542_1000244 Ga0055542_100024413 298
373 3300003763 Ga0055529_1000170 Ga0055529_100017081 298
374 3300003771 Ga0055526_1001092 Ga0055526_100109227 298
375 3300003775 Ga0055524_1018050 Ga0055524_10180504 298
376 3300003792 Ga0055540_1027147 Ga0055540_10271471 298
377 3300003794 Ga0055531_10020946 Ga0055531_100209461 298
378 3300004625 Ga0055543_1000372 Ga0055543_100037225 298
379 3300005262 Ga0065165_1001221 Ga0065165_100122125 298
380 3300005367 Ga0070667_100000434 Ga0070667_10000043411 298
381 3300005455 Ga0070663_100000053 Ga0070663_10000005314 298
382 3300005563 Ga0068855_100029037 Ga0068855_1000290376 298
383 3300005578 Ga0068854_100000391 Ga0068854_1000003916 298
384 3300005843 Ga0068860_100070916 Ga0068860_1000709162 298
385 3300006038 Ga0075365_10104848 Ga0075365_101048482 298
386 3300006042 Ga0075368_10039933 Ga0075368_100399332 298
387 3300006048 Ga0075363_100182366 Ga0075363_1001823661 298
388 3300006178 Ga0075367_10005561 Ga0075367_100055613 298
389 3300006186 Ga0075369_10001899 Ga0075369_100018995 298
390 3300009093 Ga0105240_10000985 Ga0105240_1000098524 298
391 3300009093 Ga0105240_10001505 Ga0105240_1000150521 298
392 3300009093 Ga0105240_10005162 Ga0105240_1000516217 298
393 3300009093 Ga0105240_10080521 Ga0105240_100805212 298
394 3300009177 Ga0105248_10000227 Ga0105248_100002275 298
395 3300009553 Ga0105249_10000145 Ga0105249_1000014541 298
396 3300009766 Ga0123342_1021132 Ga0123342_10211321 298
397 3300010375 Ga0105239_10000080 Ga0105239_10000080104 298
398 3300010375 Ga0105239_10265937 Ga0105239_102659372 298
399 3300021361 Ga0213872_10001559 Ga0213872_100015594 298
400 3300021361 Ga0213872_10016889 Ga0213872_100168894 298
401 3300021361 Ga0213872_10051233 Ga0213872_100512332 298
402 3300025206 Ga0209435_107069 Ga0209435_1070692 298
403 3300025207 Ga0209760_100284 Ga0209760_1002845 298
404 3300025208 Ga0209436_100259 Ga0209436_10025921 298
405 3300025224 Ga0209784_100074 Ga0209784_100074125 298
406 3300025231 Ga0207427_100079 Ga0207427_100079125 298
407 3300025233 Ga0209437_100163 Ga0209437_100163125 298
408 3300025242 Ga0209258_100196 Ga0209258_100196109 298
409 3300025246 Ga0209646_1000369 Ga0209646_100036924 298
410 3300025250 Ga0209026_1000109 Ga0209026_100010913 298
411 3300025254 Ga0209148_1000001 Ga0209148_100000113 298
412 3300025256 Ga0209759_1001130 Ga0209759_100113013 298
413 3300025261 Ga0209233_1000002 Ga0209233_10000022218 298
414 3300025272 Ga0209455_1000155 Ga0209455_1000155106 298
415 3300025284 Ga0209130_1000598 Ga0209130_100059824 298
416 3300025292 Ga0209676_1005120 Ga0209676_100512010 298
417 3300025294 Ga0209025_1000969 Ga0209025_100096922 298
418 3300025294 Ga0209025_1004327 Ga0209025_10043275 298
419 3300025295 Ga0209564_1000692 Ga0209564_100069232 298
420 3300025297 Ga0209758_1010618 Ga0209758_10106183 298
421 3300025297 Ga0209758_1011701 Ga0209758_10117012 298
422 3300025297 Ga0209758_1037846 Ga0209758_10378462 298
423 3300025299 Ga0209256_1001225 Ga0209256_100122533 298
424 3300025302 Ga0207426_1000779 Ga0207426_100077924 298
425 3300025303 Ga0209051_1002790 Ga0209051_10027909 298
426 3300025303 Ga0209051_1070565 Ga0209051_10705651 298
427 3300025304 Ga0209257_1003172 Ga0209257_10031723 298
428 3300025711 Ga0207696_1000077 Ga0207696_100007744 298
429 3300025913 Ga0207695_10000529 Ga0207695_1000052923 298
430 3300025913 Ga0207695_10001440 Ga0207695_1000144018 298
431 3300025913 Ga0207695_10020250 Ga0207695_100202503 298
432 3300025941 Ga0207711_10000969 Ga0207711_1000096919 298
433 3300025949 Ga0207667_10000228 Ga0207667_1000022825 298
434 3300025961 Ga0207712_10000124 Ga0207712_1000012438 298
435 3300025961 Ga0207712_10316039 Ga0207712_103160391 298
436 3300025981 Ga0207640_10000120 Ga0207640_1000012010 298
437 3300025986 Ga0207658_10000032 Ga0207658_1000003234 298
438 3300026067 Ga0207678_10000378 Ga0207678_100003787 298
439 3300026078 Ga0207702_10349444 Ga0207702_103494442 298
440 3300028379 Ga0268266_10000764 Ga0268266_1000076440 298
441 3300028379 Ga0268266_10174536 Ga0268266_101745362 298
442 3300028381 Ga0268264_10010225 Ga0268264_100102257 298
443 3300039447 Ga0436361_0645665 Ga0436361_0645665_9231_10127 298
444 3300039447 Ga0436361_0864259 Ga0436361_0864259_1182_2078 298
445 3300039447 Ga0436361_1035230 Ga0436361_1035230_136_1032 298
446 3300042435 Ga0439434_0024696 Ga0439434_0024696_900_1802 298
447 3300045836 Ga0466958_0018727 Ga0466958_0018727_24_923 298
448 3300046507 Ga0495606_0078264 Ga0495606_0078264_717_1616 298
449 3300046530 Ga0495654_0002386 Ga0495654_0002386_9877_10776 298
450 3300046616 Ga0495668_0000105 Ga0495668_0000105_71717_72616 298
451 3300047472 Ga0495686_0000769 Ga0495686_0000769_6406_7305 298
452 3300048904 Ga0496101_0012871 Ga0496101_0012871_2724_3623 298
453 3300048907 Ga0496104_0006478 Ga0496104_0006478_2879_3778 298
454 3300048908 Ga0496105_0004378 Ga0496105_0004378_2600_3499 298
455 3300048909 Ga0496106_0108491 Ga0496106_0108491_1197_2096 298
456 3300048910 Ga0496107_0056313 Ga0496107_0056313_983_1882 298
457 3300048918 Ga0496115_0037183 Ga0496115_0037183_1125_2024 298
458 3300048920 Ga0496117_0038843 Ga0496117_0038843_2515_3414 298
459 3300048921 Ga0496118_0018654 Ga0496118_0018654_2032_2931 298
460 3300048922 Ga0496119_0000537 Ga0496119_0000537_25636_26535 298
461 3300048922 Ga0496119_0000906 Ga0496119_0000906_23234_24133 298
462 3300048923 Ga0496120_0000055 Ga0496120_0000055_26094_26993 298
463 3300048924 Ga0496121_0000101 Ga0496121_0000101_178155_179054 298
464 3300048924 Ga0496121_0019715 Ga0496121_0019715_495_1394 298
465 3300048924 Ga0496121_0161229 Ga0496121_0161229_585_1484 298
466 3300048925 Ga0496122_0000302 Ga0496122_0000302_14377_15276 298
467 3300048926 Ga0496123_0000239 Ga0496123_0000239_99001_99900 298
468 3300048929 Ga0496126_0000896 Ga0496126_0000896_24828_25727 298
469 3300048929 Ga0496126_0037975 Ga0496126_0037975_1626_2528 298
470 3300048929 Ga0496126_0191634 Ga0496126_0191634_640_1536 298
471 3300049570 Ga0501033_0149227 Ga0501033_0149227_38_937 298
472 3300049575 Ga0501039_0108551 Ga0501039_0108551_900_1799 298
473 3300049579 Ga0501043_0081705 Ga0501043_0081705_712_1611 298
474 3300049580 Ga0501046_0215018 Ga0501046_0215018_489_1388 298
475 3300049581 Ga0501047_0155631 Ga0501047_0155631_119_1018 298
476 3300049581 Ga0501047_0259819 Ga0501047_0259819_406_1305 298
477 3300053087 Ga0500643_003087 Ga0500643_003087_6554_7453 298
478 3300053093 Ga0500651_0002913 Ga0500651_0002913_228_1127 298
479 3300053093 Ga0500651_0021159 Ga0500651_0021159_3112_4011 298
480 3300053102 Ga0500554_023792 Ga0500554_023792_30_938 298
481 3300053120 Ga0500597_000264 Ga0500597_000264_6517_7416 298
482 3300053156 Ga0500622_0018980 Ga0500622_0018980_865_1764 298
483 3300061719 Ga0466962_0004210 Ga0466962_0004210_3673_4572 298
484 iso_pu_bacteria 2924150972 2924156927 298
485 iso_pu_bacteria 2924158325 2924163851 298
486 iso_pu_bacteria 2928163908 2928167230 298
487 iso_pu_bacteria 2937002841 2937002950 298
488 iso_pu_bacteria 2937098957 2937105079 298
489 iso_pu_bacteria 2957382221 2957386170 298
490 iso_pu_bacteria 2957415311 2957419732 298
491 iso_pu_bacteria 2960584000 2960587763 298
492 iso_pu_bacteria 2960645483 2960649540 298
493 iso_pu_bacteria 2960674078 2960679007 298
494 iso_pu_bacteria 2967671571 2967673351 298
495 iso_pu_bacteria 2967678726 2967679754 298
496 iso_pu_bacteria 2967699805 2967704760 298
497 iso_pu_bacteria 2970088815 2970093417 298
498 iso_pu_bacteria 2977551784 2977557629 298
499 iso_pu_bacteria 8003992118 8003996932 298
500 3300001979 JGI24740J21852_10006148 JGI24740J21852_100061483 299
501 3300002704 JGI25155J39150_1000007 JGI25155J39150_1000007202 299
502 3300002705 JGI25156J39149_1000050 JGI25156J39149_100005056 299
503 3300002737 JGI25162J39368_1000418 JGI25162J39368_100041810 299
504 3300002738 JGI25154J39366_1000035 JGI25154J39366_1000035117 299
505 3300002741 JGI25157J39369_1000036 JGI25157J39369_1000036101 299
506 3300003214 JGI25165J46597_1000375 JGI25165J46597_100037538 299
507 3300003316 rootH1_10021276 rootH1_100212762 299
508 3300003320 rootH2_10052331 rootH2_100523315 299
509 3300003322 rootL2_10052043 rootL2_100520432 299
510 3300003762 Ga0055542_1019813 Ga0055542_10198131 299
511 3300003790 Ga0055528_1015817 Ga0055528_10158172 299
512 3300003792 Ga0055540_1007295 Ga0055540_10072952 299
513 3300005518 Ga0070699_100215654 Ga0070699_1002156542 299
514 3300005614 Ga0068856_100037139 Ga0068856_1000371392 299
515 3300006048 Ga0075363_100108742 Ga0075363_1001087422 299
516 3300009545 Ga0105237_10002159 Ga0105237_1000215922 299
517 3300010375 Ga0105239_10002299 Ga0105239_1000229922 299
518 3300013104 Ga0157370_10000131 Ga0157370_100001316 299
519 3300013105 Ga0157369_10399465 Ga0157369_103994652 299
520 3300013306 Ga0163162_10070294 Ga0163162_100702942 299
521 3300014497 Ga0182008_10030134 Ga0182008_100301342 299
522 3300025206 Ga0209435_100005 Ga0209435_100005353 299
523 3300025228 Ga0209672_103153 Ga0209672_1031532 299
524 3300025233 Ga0209437_100060 Ga0209437_10006038 299
525 3300025246 Ga0209646_1000011 Ga0209646_1000011353 299
526 3300025250 Ga0209026_1000008 Ga0209026_1000008353 299
527 3300025254 Ga0209148_1002897 Ga0209148_10028972 299
528 3300025256 Ga0209759_1000004 Ga0209759_1000004353 299
529 3300025258 Ga0209129_1000226 Ga0209129_100022622 299
530 3300025261 Ga0209233_1000275 Ga0209233_100027537 299
531 3300025272 Ga0209455_1020260 Ga0209455_10202601 299
532 3300025273 Ga0209673_1042173 Ga0209673_10421731 299
533 3300025294 Ga0209025_1001885 Ga0209025_10018852 299
534 3300025294 Ga0209025_1010204 Ga0209025_10102046 299
535 3300025297 Ga0209758_1008994 Ga0209758_10089944 299
536 3300025297 Ga0209758_1023429 Ga0209758_10234293 299
537 3300025298 Ga0209050_1007028 Ga0209050_10070282 299
538 3300025299 Ga0209256_1007631 Ga0209256_10076314 299
539 3300025303 Ga0209051_1000321 Ga0209051_100032113 299
540 3300025304 Ga0209257_1009080 Ga0209257_10090806 299
541 3300025972 Ga0207668_10143638 Ga0207668_101436382 299
542 3300028794 Ga0307515_10020126 Ga0307515_100201264 299
543 3300031456 Ga0307513_10013523 Ga0307513_100135236 299
544 3300037466 Ga0395898_0207809 Ga0395898_0207809_448_1347 299
545 3300041413 Ga0439465_0018317 Ga0439465_0018317_827_1741 299
546 3300041413 Ga0439465_0061691 Ga0439465_0061691_280_1182 299
547 3300041492 Ga0451835_0241946 Ga0451835_0241946_1261_2163 299
548 3300041501 Ga0451845_0706423 Ga0451845_0706423_5603_6505 299
549 3300041505 Ga0451849_0378119 Ga0451849_0378119_147_1049 299
550 3300041511 Ga0451855_1793643 Ga0451855_1793643_119_1021 299
551 3300041512 Ga0451853_2803005 Ga0451853_2803005_316_1218 299
552 3300044694 Ga0466963_0142432 Ga0466963_0142432_317_1219 299
553 3300044765 Ga0466970_0117238 Ga0466970_0117238_303_1205 299
554 3300045049 Ga0466959_0189387 Ga0466959_0189387_324_1226 299
555 3300045836 Ga0466958_0063994 Ga0466958_0063994_143_1045 299
556 3300046459 Ga0495629_0048881 Ga0495629_0048881_385_1287 299
557 3300046460 Ga0495638_0001061 Ga0495638_0001061_21285_22193 299
558 3300046474 Ga0495605_0013429 Ga0495605_0013429_3409_4311 299
559 3300046476 Ga0495662_0031509 Ga0495662_0031509_810_1712 299
560 3300046492 Ga0495585_0017367 Ga0495585_0017367_1669_2571 299
561 3300046506 Ga0495583_0090367 Ga0495583_0090367_354_1256 299
562 3300046507 Ga0495606_0041995 Ga0495606_0041995_1271_2173 299
563 3300046515 Ga0495620_0006745 Ga0495620_0006745_3567_4469 299
564 3300046515 Ga0495620_0007343 Ga0495620_0007343_3978_4880 299
565 3300046519 Ga0495632_0020467 Ga0495632_0020467_1771_2673 299
566 3300046522 Ga0495643_0018843 Ga0495643_0018843_687_1589 299
567 3300046523 Ga0495644_0070615 Ga0495644_0070615_144_1046 299
568 3300046524 Ga0495648_0018469 Ga0495648_0018469_2224_3126 299
569 3300046529 Ga0495652_0127870 Ga0495652_0127870_782_1684 299
570 3300046533 Ga0495640_0189403 Ga0495640_0189403_366_1268 299
571 3300046538 Ga0495609_0035576 Ga0495609_0035576_1046_1948 299
572 3300046542 Ga0495597_0011850 Ga0495597_0011850_3161_4063 299
573 3300046558 Ga0495633_0016046 Ga0495633_0016046_1324_2226 299
574 3300046558 Ga0495633_0046472 Ga0495633_0046472_227_1129 299
575 3300046660 Ga0495625_0007951 Ga0495625_0007951_6195_7100 299
576 3300046660 Ga0495625_0021355 Ga0495625_0021355_2442_3344 299
577 3300046660 Ga0495625_0023158 Ga0495625_0023158_1614_2516 299
578 3300046660 Ga0495625_0092782 Ga0495625_0092782_1088_1990 299
579 3300046660 Ga0495625_0207540 Ga0495625_0207540_33_935 299
580 3300046665 Ga0495661_0089528 Ga0495661_0089528_232_1134 299
581 3300046674 Ga0495588_0042797 Ga0495588_0042797_972_1874 299
582 3300046675 Ga0495657_0147439 Ga0495657_0147439_154_1056 299
583 3300046690 Ga0495624_0037538 Ga0495624_0037538_2076_3059 299
584 3300046691 Ga0495670_0038191 Ga0495670_0038191_526_1428 299
585 3300046794 Ga0495589_0055248 Ga0495589_0055248_216_1118 299
586 3300046809 Ga0495600_0021552 Ga0495600_0021552_3154_4056 299
587 3300046810 Ga0495660_0011631 Ga0495660_0011631_3499_4401 299
588 3300047318 Ga0495636_0006453 Ga0495636_0006453_2894_3796 299
589 3300047472 Ga0495686_0002120 Ga0495686_0002120_13663_14565 299
590 3300047472 Ga0495686_0014472 Ga0495686_0014472_3533_4435 299
591 3300048904 Ga0496101_0141082 Ga0496101_0141082_162_1082 299
592 3300048909 Ga0496106_0000028 Ga0496106_0000028_136136_137038 299
593 3300048909 Ga0496106_0033388 Ga0496106_0033388_1148_2068 299
594 3300048910 Ga0496107_0000291 Ga0496107_0000291_3833_4753 299
595 3300048920 Ga0496117_0150352 Ga0496117_0150352_175_1077 299
596 3300048920 Ga0496117_0172381 Ga0496117_0172381_97_999 299
597 3300048921 Ga0496118_0011225 Ga0496118_0011225_4778_5680 299
598 3300048921 Ga0496118_0195356 Ga0496118_0195356_95_997 299
599 3300048922 Ga0496119_0085573 Ga0496119_0085573_823_1725 299
600 3300048923 Ga0496120_0067515 Ga0496120_0067515_47_949 299
601 3300048924 Ga0496121_0002027 Ga0496121_0002027_27412_28332 299
602 3300048924 Ga0496121_0063007 Ga0496121_0063007_785_1687 299
603 3300048925 Ga0496122_0030501 Ga0496122_0030501_2349_3251 299
604 3300048925 Ga0496122_0054340 Ga0496122_0054340_875_1777 299
605 3300048925 Ga0496122_0171623 Ga0496122_0171623_174_1076 299
606 3300048926 Ga0496123_0009680 Ga0496123_0009680_3867_4769 299
607 3300048926 Ga0496123_0072420 Ga0496123_0072420_1152_2054 299
608 3300048927 Ga0496124_0043555 Ga0496124_0043555_1146_2048 299
609 3300048927 Ga0496124_0163240 Ga0496124_0163240_292_1194 299
610 3300048928 Ga0496125_0004359 Ga0496125_0004359_9604_10506 299
611 3300049570 Ga0501033_0389615 Ga0501033_0389615_35_937 299
612 3300049572 Ga0501036_0015259 Ga0501036_0015259_878_1780 299
613 3300049590 Ga0501074_0039318 Ga0501074_0039318_721_1638 299
614 3300049823 Ga0501044_0031639 Ga0501044_0031639_2824_3726 299
615 3300050490 nmdc:mga03n38_18109_c1 nmdc:mga03n38_18109_c1_1777_2679 299
616 3300050493 nmdc:mga0k408_76885_c1 nmdc:mga0k408_76885_c1_96_998 299
617 3300053077 Ga0495601_0204481 Ga0495601_0204481_213_1115 299
618 3300053109 Ga0500569_000971 Ga0500569_000971_683_1585 299
619 3300053121 Ga0500607_100305 Ga0500607_100305_480_1382 299
620 3300053134 Ga0500658_0001192 Ga0500658_0001192_4057_4959 299
621 3300053135 Ga0500659_0107780 Ga0500659_0107780_57_959 299
622 3300053139 Ga0500568_0001664 Ga0500568_0001664_7643_8545 299
623 3300053153 Ga0500616_0142798 Ga0500616_0142798_67_969 299
624 3300009093 Ga0105240_10161761 Ga0105240_101617612 300
625 3300044683 Ga0466965_0053560 Ga0466965_0053560_616_1521 300
626 3300044693 Ga0466961_0000643 Ga0466961_0000643_10970_11875 300
627 3300044735 Ga0466968_0061075 Ga0466968_0061075_205_1110 300
628 3300044765 Ga0466970_0031649 Ga0466970_0031649_125_1030 300
629 3300044842 Ga0466957_0079181 Ga0466957_0079181_201_1106 300
630 3300046454 Ga0495592_0056536 Ga0495592_0056536_1561_2496 300
631 3300046463 Ga0495653_0016662 Ga0495653_0016662_1142_2059 300
632 3300046472 Ga0495580_0075267 Ga0495580_0075267_118_1035 300
633 3300046476 Ga0495662_0000570 Ga0495662_0000570_2069_2986 300
634 3300046477 Ga0495664_0008493 Ga0495664_0008493_1140_2057 300
635 3300046511 Ga0495608_0080020 Ga0495608_0080020_1063_1980 300
636 3300046516 Ga0495628_0031555 Ga0495628_0031555_1065_2000 300
637 3300046526 Ga0495666_0002852 Ga0495666_0002852_1625_2560 300
638 3300046531 Ga0495665_0060186 Ga0495665_0060186_833_1750 300
639 3300046533 Ga0495640_0060789 Ga0495640_0060789_1126_2043 300
640 3300046535 Ga0495586_0100431 Ga0495586_0100431_36_971 300
641 3300046543 Ga0495645_0041356 Ga0495645_0041356_1516_2451 300
642 3300046559 Ga0495667_0009593 Ga0495667_0009593_1139_2056 300
643 3300046642 Ga0495634_0037605 Ga0495634_0037605_1469_2404 300
644 3300046675 Ga0495657_0004205 Ga0495657_0004205_9073_10008 300
645 3300046678 Ga0495599_0037866 Ga0495599_0037866_1858_2793 300
646 3300046680 Ga0495646_0016649 Ga0495646_0016649_370_1287 300
647 3300046689 Ga0495613_0023111 Ga0495613_0023111_1469_2404 300
648 3300047319 Ga0495674_0059369 Ga0495674_0059369_718_1635 300
649 3300047444 Ga0495675_0013119 Ga0495675_0013119_1730_2665 300
650 3300047469 Ga0495673_0000293 Ga0495673_0000293_10121_11044 300
651 3300047471 Ga0495684_0023089 Ga0495684_0023089_1569_2504 300
652 3300048922 Ga0496119_0089214 Ga0496119_0089214_92_994 300
653 3300048927 Ga0496124_0130032 Ga0496124_0130032_206_1108 300
654 3300049571 Ga0501034_0001153 Ga0501034_0001153_30639_31550 300
655 3300049584 Ga0501068_0008282 Ga0501068_0008282_2494_3405 300
656 3300049823 Ga0501044_0037972 Ga0501044_0037972_2249_3160 300
657 3300053077 Ga0495601_0000191 Ga0495601_0000191_31053_31988 300
658 3300049570 Ga0501033_0036676 Ga0501033_0036676_1583_2491 301
659 3300049571 Ga0501034_0215317 Ga0501034_0215317_723_1631 301
660 3300049579 Ga0501043_0185191 Ga0501043_0185191_564_1472 301
661 3300049581 Ga0501047_0057686 Ga0501047_0057686_1526_2434 301
662 3300049822 Ga0501035_0092218 Ga0501035_0092218_1742_2650 301
663 3300049823 Ga0501044_0365009 Ga0501044_0365009_252_1160 301
664 3300053104 Ga0500556_0143085 Ga0500556_0143085_11_919 301
665 3300005530 Ga0070679_100052069 Ga0070679_1000520696 302
666 3300010375 Ga0105239_10064026 Ga0105239_100640263 302
667 3300025912 Ga0207707_10182687 Ga0207707_101826872 302
668 3300025921 Ga0207652_10099821 Ga0207652_100998213 302
669 3300046460 Ga0495638_0008888 Ga0495638_0008888_3459_4370 302
670 3300046501 Ga0495607_0000006 Ga0495607_0000006_233562_234473 302
671 3300048916 Ga0496113_0096063 Ga0496113_0096063_236_1147 302
672 3300053139 Ga0500568_0003692 Ga0500568_0003692_901_1824 302
673 3300053156 Ga0500622_0000906 Ga0500622_0000906_14825_15736 302
674 3300005614 Ga0068856_100188542 Ga0068856_1001885422 303
675 3300013105 Ga0157369_10031912 Ga0157369_100319124 303
676 3300025909 Ga0207705_10049073 Ga0207705_100490733 303
677 3300026078 Ga0207702_10173265 Ga0207702_101732653 303
678 3300041411 Ga0439466_0006569 Ga0439466_0006569_1789_2700 303
679 3300006844 Ga0075428_100435820 Ga0075428_1004358202 304
680 3300009094 Ga0111539_10000323 Ga0111539_100003235 304
681 3300009147 Ga0114129_10671110 Ga0114129_106711101 304
682 3300025922 Ga0207646_10450407 Ga0207646_104504071 304
683 3300027907 Ga0207428_10000129 Ga0207428_100001296 304
684 3300046542 Ga0495597_0000005 Ga0495597_0000005_65780_66715 304
685 3300046810 Ga0495660_0002239 Ga0495660_0002239_8788_9723 304
686 3300050511 nmdc:mga08y16_51_c1 nmdc:mga08y16_51_c1_99092_100102 304
687 3300046460 Ga0495638_0000300 Ga0495638_0000300_58149_59069 305
688 3300047320 Ga0495672_0011865 Ga0495672_0011865_3964_4884 305
689 3300047323 Ga0495683_0042689 Ga0495683_0042689_1180_2100 305
690 3300049459 Ga0495678_014000 Ga0495678_014000_1200_2120 305
691 3300053139 Ga0500568_0002341 Ga0500568_0002341_5734_6654 305
692 3300053153 Ga0500616_0001502 Ga0500616_0001502_10457_11377 305
693 3300001978 JGI24747J21853_1002313 JGI24747J21853_10023132 306
694 3300005435 Ga0070714_100207444 Ga0070714_1002074442 306
695 3300005563 Ga0068855_100051022 Ga0068855_1000510222 306
696 3300007788 Ga0099795_10015083 Ga0099795_100150833 306
697 3300009177 Ga0105248_10007577 Ga0105248_100075776 306
698 3300013306 Ga0163162_10107680 Ga0163162_101076802 306
699 3300025929 Ga0207664_10293412 Ga0207664_102934122 306
700 3300025972 Ga0207668_10136143 Ga0207668_101361432 306
701 3300027512 Ga0209179_1017514 Ga0209179_10175141 306
702 3300045976 Ga0466967_0112250 Ga0466967_0112250_821_1744 306
703 3300046524 Ga0495648_0018841 Ga0495648_0018841_2923_3843 306
704 3300046616 Ga0495668_0076621 Ga0495668_0076621_65_985 306
705 3300046692 Ga0495671_0140452 Ga0495671_0140452_180_1100 306
706 3300047320 Ga0495672_0007690 Ga0495672_0007690_5219_6139 306
707 3300047469 Ga0495673_0002760 Ga0495673_0002760_10642_11562 306
708 3300049571 Ga0501034_0223643 Ga0501034_0223643_353_1273 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

17

216

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

23

240

0.87

PF08659

KR

KR domain

18

192

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

19

239

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u9l-assembly1.cif.gz_A-2 the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti 0.9822 5 297
3u9l-assembly1.cif.gz_A-2 the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti 0.9754 5 297
2hsd-assembly1.cif.gz_A the refined three-dimensional structure of 3alpha,20beta-hydroxysteroid dehydrogenase and possible roles of the residues conserved in short-chain dehydrogenases 0.936 3 190
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9243 5 269
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9174 5 265
ID Description Score Start End Superfamily
3u9lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9809 5 297 3.40.50.720
3u9lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9741 5 297 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9411 95 190 3.40.50.720
2hsdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.936 3 190 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9247 5 191 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3KIF3-F1-model_v4 deleted 0.9968 4 159
AF-A4X7G9-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9946 3 151
AF-A0A7W7CRD4-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9926 4 298
AF-A0A1H8YFK9-F1-model_v4 NADP-dependent 3-hydroxy acid dehydrogenase YdfG 0.9908 4 298
AF-A0A1E1VEH7-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.99 3 258

Feature Viewer

pLDDT pTM Quality
92.11 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map