F476486

General Info

Members Datasets Scaffolds Average Seq Length
706 361 1412 91

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0215219|Ga0373933_0215219_490_837
Length 109
Sequence MRAETRRAGRGDLAVTYIITEPCIDVMDKSVDCIHESGRMLVIDPEECIDCGACEPECPVEAIFPEDALPDKWNAFVEINYAYDKGAAVVDELTQKYAVENNVQNEPIE

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
97 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
98 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
117 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
202 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
217 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
221 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
222 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
223 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
224 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
225 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
226 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
229 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
262 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
263 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
283 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
288 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
289 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
292 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
310 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
311 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
312 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
329 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
330 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
331 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
332 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
333 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
334 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
335 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
336 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
340 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
341 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
342 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
348 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
351 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
354 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 1.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 9.92
Rhizosphere 89.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0215219 3300035724 Bacteria 1232
2 JGI24737J22298_10159499 3300001990 Bacteria 666
3 JGI24742J22300_10087163 3300002244 Bacteria 595
4 JGI24751J29686_10043076 3300002459 Bacteria 933
5 JGI25407J50210_10009553 3300003373 Bacteria 2459
6 JGI25407J50210_10105274 3300003373 Bacteria 697
7 Ga0058859_11656751 3300004798 Bacteria 550
8 Ga0070676_10149709 3300005328 Bacteria 1493
9 Ga0070683_100278649 3300005329 Bacteria 1591
10 Ga0070683_100484079 3300005329 Bacteria 1182
11 Ga0070683_100498378 3300005329 Bacteria 1163
12 Ga0070683_100524440 3300005329 Bacteria 1132
13 Ga0070690_100015506 3300005330 Bacteria 4548
14 Ga0070670_100036039 3300005331 Bacteria 4258
15 Ga0070680_100808603 3300005336 Bacteria 808
16 Ga0070680_101197889 3300005336 Bacteria 657
17 Ga0070680_101364601 3300005336 Bacteria 614
18 Ga0070682_100033554 3300005337 Bacteria 3120
19 Ga0070682_100090423 3300005337 Bacteria 2002
20 Ga0070689_100011400 3300005340 Bacteria 6367
21 Ga0070689_100275630 3300005340 Bacteria 1394
22 Ga0070691_10048903 3300005341 Bacteria 2014
23 Ga0070687_100004900 3300005343 Bacteria 5372
24 Ga0070661_100454121 3300005344 Bacteria 1020
25 Ga0070692_10099297 3300005345 Bacteria 1594
26 Ga0070692_10169102 3300005345 Bacteria 1259
27 Ga0070668_100734602 3300005347 Bacteria 873
28 Ga0070668_100900717 3300005347 Bacteria 791
29 Ga0070669_100776964 3300005353 Bacteria 813
30 Ga0070675_100137721 3300005354 Bacteria 2084
31 Ga0070675_100413889 3300005354 Bacteria 1204
32 Ga0070671_100320123 3300005355 Bacteria 1321
33 Ga0070671_100565092 3300005355 Bacteria 981
34 Ga0070671_101763731 3300005355 Bacteria 550
35 Ga0070674_100208719 3300005356 Bacteria 1512
36 Ga0070674_100672841 3300005356 Bacteria 882
37 Ga0070673_100074774 3300005364 Bacteria 2731
38 Ga0070673_102137321 3300005364 Bacteria 532
39 Ga0070688_100003816 3300005365 Bacteria 7812
40 Ga0070688_100276444 3300005365 Bacteria 1205
41 Ga0070659_100006869 3300005366 Bacteria 8244
42 Ga0070659_100579322 3300005366 Bacteria 963
43 Ga0070659_100940073 3300005366 Bacteria 757
44 Ga0070667_100481136 3300005367 Bacteria 1137
45 Ga0070711_100263708 3300005439 Bacteria 1356
46 Ga0070705_100063523 3300005440 Bacteria 2202
47 Ga0070705_100145123 3300005440 Bacteria 1567
48 Ga0070705_100225276 3300005440 Bacteria 1301
49 Ga0070700_100006192 3300005441 Bacteria 6378
50 Ga0070700_100206715 3300005441 Bacteria 1383
51 Ga0070700_100311560 3300005441 Bacteria 1153
52 Ga0070700_100549446 3300005441 Bacteria 897
53 Ga0070694_100221425 3300005444 Bacteria 1419
54 Ga0070694_100238167 3300005444 Bacteria 1372
55 Ga0070694_100995817 3300005444 Bacteria 696
56 Ga0070708_100490447 3300005445 Bacteria 1159
57 Ga0070708_100873164 3300005445 Bacteria 845
58 Ga0070663_100134303 3300005455 Bacteria 1882
59 Ga0070678_100281709 3300005456 Bacteria 1406
60 Ga0070662_100040018 3300005457 Bacteria 3336
61 Ga0070681_10290798 3300005458 Bacteria 1544
62 Ga0070681_10744552 3300005458 Bacteria 896
63 Ga0068867_100018210 3300005459 Bacteria 4991
64 Ga0068867_100500027 3300005459 Bacteria 1045
65 Ga0068867_100781882 3300005459 Bacteria 850
66 Ga0070685_10113869 3300005466 Bacteria 1671
67 Ga0070706_100514454 3300005467 Bacteria 1113
68 Ga0070707_102209755 3300005468 Bacteria 518
69 Ga0070698_100022281 3300005471 Bacteria 6628
70 Ga0070698_100082668 3300005471 Bacteria 3203
71 Ga0070698_101420579 3300005471 Bacteria 645
72 Ga0070699_100050352 3300005518 Bacteria 3606
73 Ga0070699_100288580 3300005518 Bacteria 1471
74 Ga0070699_100617848 3300005518 Bacteria 989
75 Ga0070679_100357296 3300005530 Bacteria 1408
76 Ga0070684_100027971 3300005535 Bacteria 4765
77 Ga0070684_100138019 3300005535 Bacteria 2203
78 Ga0070684_100220013 3300005535 Bacteria 1732
79 Ga0070684_100344804 3300005535 Bacteria 1369
80 Ga0070697_100077363 3300005536 Bacteria 2736
81 Ga0070697_100234608 3300005536 Bacteria 1565
82 Ga0070697_100849142 3300005536 Bacteria 809
83 Ga0070697_101504292 3300005536 Bacteria 602
84 Ga0068853_100639430 3300005539 Bacteria 1012
85 Ga0070672_100098764 3300005543 Bacteria 2365
86 Ga0070672_100524934 3300005543 Bacteria 1026
87 Ga0070686_100004377 3300005544 Bacteria 7784
88 Ga0070686_100284456 3300005544 Bacteria 1221
89 Ga0070696_100006955 3300005546 Bacteria 7553
90 Ga0070696_100071548 3300005546 Bacteria 2441
91 Ga0070696_101011041 3300005546 Bacteria 695
92 Ga0070693_100134308 3300005547 Bacteria 1550
93 Ga0070693_101277033 3300005547 Bacteria 567
94 Ga0070665_101450863 3300005548 Bacteria 695
95 Ga0070664_100030578 3300005564 Bacteria 4493
96 Ga0070664_100420174 3300005564 Bacteria 1224
97 Ga0070664_100546479 3300005564 Bacteria 1071
98 Ga0070664_100921101 3300005564 Bacteria 820
99 Ga0068857_100027184 3300005577 Bacteria 5046
100 Ga0068857_100030217 3300005577 Bacteria 4782
101 Ga0068857_102158617 3300005577 Bacteria 547
102 Ga0068857_102331831 3300005577 Bacteria 525
103 Ga0068854_100103070 3300005578 Bacteria 2142
104 Ga0068854_100754145 3300005578 Bacteria 845
105 Ga0068856_100126000 3300005614 Bacteria 2564
106 Ga0070702_100007071 3300005615 Bacteria 5354
107 Ga0068852_100022059 3300005616 Bacteria 5097
108 Ga0068852_100774253 3300005616 Bacteria 973
109 Ga0068859_100137104 3300005617 Bacteria 2520
110 Ga0068859_102765314 3300005617 Bacteria 539
111 Ga0068864_100086000 3300005618 Bacteria 2765
112 Ga0068864_100675894 3300005618 Bacteria 1007
113 Ga0068864_102365372 3300005618 Bacteria 538
114 Ga0068866_10098729 3300005718 Bacteria 1607
115 Ga0068861_101046552 3300005719 Bacteria 782
116 Ga0068861_102040050 3300005719 Bacteria 573
117 Ga0068870_10003863 3300005840 Bacteria 6388
118 Ga0068870_10208673 3300005840 Bacteria 1188
119 Ga0068863_100723886 3300005841 Bacteria 990
120 Ga0068858_100055220 3300005842 Bacteria 3671
121 Ga0068858_100631815 3300005842 Bacteria 1040
122 Ga0068860_100004060 3300005843 Bacteria 15025
123 Ga0068860_102363218 3300005843 Bacteria 552
124 Ga0068862_100186136 3300005844 Bacteria 1866
125 Ga0081455_10004505 3300005937 Bacteria 15573
126 Ga0081455_10007154 3300005937 Bacteria 11808
127 Ga0081455_10091640 3300005937 Bacteria 2461
128 Ga0081538_10000240 3300005981 Bacteria 62124
129 Ga0081538_10002585 3300005981 Bacteria 17561
130 Ga0081538_10036113 3300005981 Bacteria 3231
131 Ga0081540_1093167 3300005983 Bacteria 1320
132 Ga0070717_10887563 3300006028 Bacteria 812
133 Ga0075365_10928082 3300006038 Bacteria 614
134 Ga0075432_10326724 3300006058 Bacteria 644
135 Ga0070716_100557134 3300006173 Bacteria 855
136 Ga0070712_100070694 3300006175 Bacteria 2495
137 Ga0070712_100363249 3300006175 Bacteria 1188
138 Ga0070712_100434365 3300006175 Bacteria 1090
139 Ga0075367_10511627 3300006178 Bacteria 762
140 Ga0097621_100087269 3300006237 Bacteria 2605
141 Ga0097621_101137549 3300006237 Bacteria 734
142 Ga0075428_100204411 3300006844 Bacteria 2135
143 Ga0075428_100469260 3300006844 Bacteria 1347
144 Ga0075428_101623726 3300006844 Bacteria 676
145 Ga0075428_101680577 3300006844 Bacteria 663
146 Ga0075428_102000985 3300006844 Bacteria 600
147 Ga0075431_100065436 3300006847 Bacteria 3754
148 Ga0075433_10253621 3300006852 Bacteria 1561
149 Ga0075433_10398127 3300006852 Bacteria 1215
150 Ga0075433_10626417 3300006852 Bacteria 944
151 Ga0075433_10739040 3300006852 Bacteria 861
152 Ga0075434_100103255 3300006871 Bacteria 2859
153 Ga0068865_100110705 3300006881 Bacteria 2026
154 Ga0068865_100390119 3300006881 Bacteria 1138
155 Ga0068865_101364949 3300006881 Bacteria 632
156 Ga0097620_100137097 3300006931 Bacteria 2520
157 Ga0097620_102765048 3300006931 Bacteria 539
158 Ga0075435_100552860 3300007076 Bacteria 997
159 Ga0111539_10002272 3300009094 Bacteria 25576
160 Ga0111539_10040587 3300009094 Bacteria 5601
161 Ga0111539_10451625 3300009094 Bacteria 1497
162 Ga0111539_10994997 3300009094 Bacteria 975
163 Ga0111539_12125552 3300009094 Bacteria 651
164 Ga0111539_12929904 3300009094 Bacteria 552
165 Ga0105245_10046707 3300009098 Bacteria 3869
166 Ga0105245_10187661 3300009098 Bacteria 1979
167 Ga0105245_10256949 3300009098 Bacteria 1699
168 Ga0105245_10912698 3300009098 Bacteria 920
169 Ga0105247_10050427 3300009101 Bacteria 2561
170 Ga0114129_10019250 3300009147 Bacteria 9724
171 Ga0114129_10083439 3300009147 Bacteria 4439
172 Ga0114129_10742920 3300009147 Bacteria 1257
173 Ga0114129_10979982 3300009147 Bacteria 1066
174 Ga0114129_11858363 3300009147 Bacteria 731
175 Ga0114129_12816128 3300009147 Bacteria 578
176 Ga0105243_10015460 3300009148 Bacteria 5767
177 Ga0105243_10438802 3300009148 Bacteria 1222
178 Ga0105243_10508009 3300009148 Bacteria 1143
179 Ga0105243_11626979 3300009148 Bacteria 673
180 Ga0105241_10094162 3300009174 Bacteria 2368
181 Ga0105242_10047340 3300009176 Bacteria 3491
182 Ga0105248_10051124 3300009177 Bacteria 4638
183 Ga0105248_11247964 3300009177 Bacteria 840
184 Ga0105248_12061870 3300009177 Bacteria 648
185 Ga0105237_11970621 3300009545 Bacteria 592
186 Ga0105238_10712162 3300009551 Bacteria 1016
187 Ga0105238_12674923 3300009551 Bacteria 535
188 Ga0105249_10006756 3300009553 Bacteria 9996
189 Ga0105249_10129149 3300009553 Bacteria 2411
190 Ga0105249_10910758 3300009553 Bacteria 946
191 Ga0105249_10991108 3300009553 Bacteria 909
192 Ga0105239_10128806 3300010375 Bacteria 2813
193 Ga0105239_13137395 3300010375 Bacteria 538
194 Ga0105246_10344307 3300011119 Bacteria 1219
195 Ga0105246_10599021 3300011119 Bacteria 952
196 Ga0105246_10758086 3300011119 Bacteria 857
197 Ga0157344_1025678 3300012476 Bacteria 536
198 Ga0157337_1000969 3300012483 Bacteria 1390
199 Ga0157315_1026828 3300012508 Bacteria 649
200 Ga0157373_11253780 3300013100 Bacteria 560
201 Ga0157373_11278433 3300013100 Bacteria 555
202 Ga0157370_11296431 3300013104 Bacteria 656
203 Ga0157370_12028227 3300013104 Bacteria 516
204 Ga0157369_10035964 3300013105 Bacteria 5428
205 Ga0157369_10583990 3300013105 Bacteria 1154
206 Ga0157374_10529927 3300013296 Bacteria 1184
207 Ga0157374_11084149 3300013296 Bacteria 821
208 Ga0157378_10003446 3300013297 Bacteria 14024
209 Ga0163162_10137854 3300013306 Bacteria 2551
210 Ga0157372_11000944 3300013307 Bacteria 968
211 Ga0157372_11303705 3300013307 Bacteria 838
212 Ga0157372_11910317 3300013307 Bacteria 682
213 Ga0157375_10013278 3300013308 Bacteria 7325
214 Ga0157375_11516010 3300013308 Bacteria 791
215 Ga0163163_10008650 3300014325 Bacteria 9054
216 Ga0163163_10786814 3300014325 Bacteria 1015
217 Ga0157380_10033356 3300014326 Bacteria 3964
218 Ga0182008_10298628 3300014497 Bacteria 842
219 Ga0157377_10007842 3300014745 Bacteria 5176
220 Ga0157377_10219495 3300014745 Bacteria 1216
221 Ga0157379_10084518 3300014968 Bacteria 2844
222 Ga0157379_10973229 3300014968 Bacteria 808
223 Ga0157376_10278680 3300014969 Bacteria 1574
224 Ga0157376_10391186 3300014969 Bacteria 1342
225 Ga0157376_10519221 3300014969 Bacteria 1174
226 Ga0182006_1053905 3300015261 Bacteria 1540
227 Ga0182006_1242283 3300015261 Bacteria 592
228 Ga0163161_10064380 3300017792 Bacteria 2674
229 Ga0206353_11559060 3300020082 Bacteria 2001
230 Ga0213873_10007348 3300021358 Bacteria 2203
231 Ga0213871_10002315 3300021441 Bacteria 3483
232 Ga0207653_10028703 3300025885 Bacteria 1790
233 Ga0207642_10032257 3300025899 Bacteria 2203
234 Ga0207710_10118324 3300025900 Bacteria 1263
235 Ga0207688_10126286 3300025901 Bacteria 1496
236 Ga0207643_10001789 3300025908 Bacteria 11965
237 Ga0207643_10688886 3300025908 Bacteria 660
238 Ga0207705_10612733 3300025909 Bacteria 847
239 Ga0207684_11147625 3300025910 Bacteria 645
240 Ga0207707_10835692 3300025912 Bacteria 765
241 Ga0207660_11030656 3300025917 Bacteria 671
242 Ga0207660_11317392 3300025917 Bacteria 586
243 Ga0207662_10000237 3300025918 Bacteria 25500
244 Ga0207649_10087818 3300025920 Bacteria 2029
245 Ga0207681_10642878 3300025923 Bacteria 879
246 Ga0207681_10904150 3300025923 Bacteria 739
247 Ga0207650_10356623 3300025925 Bacteria 1204
248 Ga0207659_10010535 3300025926 Bacteria 5812
249 Ga0207687_10027593 3300025927 Bacteria 3811
250 Ga0207687_10751710 3300025927 Bacteria 830
251 Ga0207700_10037748 3300025928 Bacteria 3501
252 Ga0207700_10103004 3300025928 Bacteria 2281
253 Ga0207664_10527829 3300025929 Bacteria 1058
254 Ga0207644_10309324 3300025931 Bacteria 1275
255 Ga0207644_10529163 3300025931 Bacteria 974
256 Ga0207690_10466257 3300025932 Bacteria 1017
257 Ga0207690_10517329 3300025932 Bacteria 967
258 Ga0207706_10032167 3300025933 Bacteria 4671
259 Ga0207686_10783383 3300025934 Bacteria 763
260 Ga0207709_10027266 3300025935 Bacteria 3289
261 Ga0207709_10865606 3300025935 Bacteria 733
262 Ga0207670_10250582 3300025936 Bacteria 1368
263 Ga0207670_10325848 3300025936 Bacteria 1210
264 Ga0207670_10867188 3300025936 Bacteria 755
265 Ga0207669_10171024 3300025937 Bacteria 1546
266 Ga0207704_10456914 3300025938 Bacteria 1020
267 Ga0207704_11669478 3300025938 Bacteria 548
268 Ga0207665_10453012 3300025939 Bacteria 985
269 Ga0207691_10012785 3300025940 Bacteria 8035
270 Ga0207711_10226028 3300025941 Bacteria 1713
271 Ga0207689_10512985 3300025942 Bacteria 1005
272 Ga0207689_10792094 3300025942 Bacteria 800
273 Ga0207661_10191482 3300025944 Bacteria 1793
274 Ga0207661_10451894 3300025944 Bacteria 1170
275 Ga0207661_12111172 3300025944 Bacteria 509
276 Ga0207679_10364574 3300025945 Bacteria 1263
277 Ga0207679_11277072 3300025945 Bacteria 674
278 Ga0207667_10769222 3300025949 Bacteria 961
279 Ga0207651_10127559 3300025960 Bacteria 1941
280 Ga0207651_10599117 3300025960 Bacteria 963
281 Ga0207712_10068519 3300025961 Bacteria 2543
282 Ga0207712_10625568 3300025961 Bacteria 933
283 Ga0207712_11051097 3300025961 Bacteria 724
284 Ga0207668_10230153 3300025972 Bacteria 1494
285 Ga0207640_10146008 3300025981 Bacteria 1731
286 Ga0207640_10931003 3300025981 Bacteria 761
287 Ga0207640_10963821 3300025981 Bacteria 748
288 Ga0207658_10429120 3300025986 Bacteria 1167
289 Ga0207703_10088091 3300026035 Bacteria 2604
290 Ga0207703_10487315 3300026035 Bacteria 1156
291 Ga0207703_11950554 3300026035 Bacteria 563
292 Ga0207639_10092058 3300026041 Bacteria 2429
293 Ga0207639_12263996 3300026041 Bacteria 505
294 Ga0207678_10015566 3300026067 Bacteria 6688
295 Ga0207708_10007304 3300026075 Bacteria 8171
296 Ga0207708_10244044 3300026075 Bacteria 1445
297 Ga0207708_10256758 3300026075 Bacteria 1410
298 Ga0207702_10058200 3300026078 Bacteria 3288
299 Ga0207641_10707988 3300026088 Bacteria 992
300 Ga0207641_11650941 3300026088 Bacteria 643
301 Ga0207648_10001684 3300026089 Bacteria 24233
302 Ga0207648_10562546 3300026089 Bacteria 1048
303 Ga0207648_11053909 3300026089 Bacteria 762
304 Ga0207676_10854240 3300026095 Bacteria 890
305 Ga0207674_10027111 3300026116 Bacteria 6069
306 Ga0207674_10032996 3300026116 Bacteria 5425
307 Ga0207675_100067548 3300026118 Bacteria 3342
308 Ga0207675_100376852 3300026118 Bacteria 1395
309 Ga0207675_100457238 3300026118 Bacteria 1266
310 Ga0207683_10052641 3300026121 Bacteria 3567
311 Ga0207698_10063639 3300026142 Bacteria 2888
312 Ga0209999_1059138 3300027543 Bacteria 728
313 Ga0210002_1106016 3300027617 Bacteria 510
314 Ga0209971_1119350 3300027682 Bacteria 648
315 Ga0209974_10037398 3300027876 Bacteria 1612
316 Ga0207428_10006328 3300027907 Bacteria 10947
317 Ga0207428_10218425 3300027907 Bacteria 1430
318 Ga0207428_10396899 3300027907 Bacteria 1010
319 Ga0268266_10256326 3300028379 Bacteria 1620
320 Ga0268265_10196532 3300028380 Bacteria 1746
321 Ga0268264_10068651 3300028381 Bacteria 2996
322 Ga0268264_12304378 3300028381 Bacteria 545
323 Ga0265338_10945442 3300028800 Bacteria 585
324 Ga0265325_10359618 3300031241 Bacteria 642
325 Ga0265327_10015346 3300031251 Bacteria 4949
326 Ga0265316_10646096 3300031344 Bacteria 748
327 Ga0307408_100060910 3300031548 Bacteria 2753
328 Ga0307408_100085518 3300031548 Bacteria 2368
329 Ga0307408_100117131 3300031548 Bacteria 2057
330 Ga0307405_10109650 3300031731 Bacteria 1867
331 Ga0307405_10143618 3300031731 Bacteria 1668
332 Ga0307413_10019744 3300031824 Bacteria 3568
333 Ga0307410_10004596 3300031852 Bacteria 7164
334 Ga0307406_10030841 3300031901 Bacteria 3259
335 Ga0307406_10404829 3300031901 Bacteria 1083
336 Ga0307407_10001098 3300031903 Bacteria 9443
337 Ga0307407_11469542 3300031903 Bacteria 538
338 Ga0307412_10065059 3300031911 Bacteria 2466
339 Ga0307412_10180365 3300031911 Bacteria 1588
340 Ga0307412_11448172 3300031911 Bacteria 623
341 Ga0307409_100013896 3300031995 Bacteria 5207
342 Ga0307416_100000904 3300032002 Bacteria 15682
343 Ga0307416_100041773 3300032002 Bacteria 3574
344 Ga0307416_100206885 3300032002 Bacteria 1867
345 Ga0307416_101027658 3300032002 Bacteria 928
346 Ga0307416_101678467 3300032002 Bacteria 740
347 Ga0307414_10039191 3300032004 Bacteria 3190
348 Ga0307411_10246349 3300032005 Bacteria 1402
349 Ga0307415_100004099 3300032126 Bacteria 7520
350 Ga0307415_100103427 3300032126 Bacteria 2095
351 Ga0373950_0164137 3300034818 Bacteria 515
352 Ga0373934_0100557 3300035086 Bacteria 1169
353 Ga0373952_0051874 3300035092 Bacteria 980
354 Ga0373941_0192595 3300035115 Bacteria 771
355 Ga0373953_0070354 3300035117 Bacteria 1443
356 Ga0373954_0040886 3300035118 Bacteria 2161
357 Ga0373960_0424203 3300035121 Bacteria 517
358 Ga0373946_0413211 3300035171 Bacteria 683
359 Ga0373955_0474584 3300035172 Bacteria 763
360 Ga0373942_0079965 3300035207 Bacteria 969
361 Ga0373961_0427376 3300035241 Bacteria 513
362 Ga0373962_0245608 3300035242 Bacteria 620
363 Ga0373924_0111660 3300035410 Bacteria 1182
364 Ga0373931_0125146 3300035691 Bacteria 1473
365 Ga0373935_0055212 3300035692 Bacteria 2531
366 Ga0373937_0162707 3300036401 Bacteria 2092
367 Ga0395899_0002898 3300037312 Bacteria 13785
368 Ga0395899_0041850 3300037312 Bacteria 3421
369 Ga0395899_0124192 3300037312 Bacteria 1846
370 Ga0395899_0299025 3300037312 Bacteria 1090
371 Ga0395899_0509680 3300037312 Bacteria 779
372 Ga0395900_0038387 3300037418 Bacteria 4935
373 Ga0395900_0080879 3300037418 Bacteria 3339
374 Ga0395900_0082293 3300037418 Bacteria 3307
375 Ga0395900_0125629 3300037418 Bacteria 2631
376 Ga0395900_0126057 3300037418 Bacteria 2626
377 Ga0395900_0651759 3300037418 Bacteria 989
378 Ga0395900_0995387 3300037418 Bacteria 758
379 Ga0395900_1266213 3300037418 Bacteria 652
380 Ga0395898_0007360 3300037466 Bacteria 11686
381 Ga0395898_0020580 3300037466 Bacteria 6701
382 Ga0395898_0031910 3300037466 Bacteria 5260
383 Ga0395898_0142255 3300037466 Bacteria 2297
384 Ga0395898_0331309 3300037466 Bacteria 1451
385 Ga0395898_0439711 3300037466 Bacteria 1242
386 Ga0395898_0638129 3300037466 Bacteria 1007
387 Ga0395898_1000409 3300037466 Bacteria 772
388 Ga0395905_0039849 3300037471 Bacteria 4408
389 Ga0395905_0073515 3300037471 Bacteria 3204
390 Ga0395905_0077321 3300037471 Bacteria 3118
391 Ga0395905_0109850 3300037471 Bacteria 2589
392 Ga0395905_0152799 3300037471 Bacteria 2171
393 Ga0395905_0187841 3300037471 Bacteria 1939
394 Ga0395901_0021218 3300038443 Bacteria 6652
395 Ga0395901_0021517 3300038443 Bacteria 6608
396 Ga0395901_0060354 3300038443 Bacteria 3946
397 Ga0395901_0086522 3300038443 Bacteria 3277
398 Ga0395901_0111459 3300038443 Bacteria 2873
399 Ga0395901_0153011 3300038443 Bacteria 2423
400 Ga0395901_0410548 3300038443 Bacteria 1390
401 Ga0395901_1233502 3300038443 Bacteria 712
402 Ga0242420_000859 3300038996 Bacteria 3741
403 Ga0436365_0473746 3300039437 Bacteria 749
404 Ga0436365_0851166 3300039437 Bacteria 1412
405 Ga0436360_0095646 3300039438 Bacteria 838
406 Ga0436360_0901858 3300039438 Bacteria 4491
407 Ga0436362_0026788 3300039453 Bacteria 1012
408 Ga0436362_0141011 3300039453 Bacteria 3388
409 Ga0439439_0085607 3300041406 Bacteria 856
410 Ga0439461_0086530 3300041410 Bacteria 746
411 Ga0439461_0145975 3300041410 Bacteria 608
412 Ga0439466_0046192 3300041411 Bacteria 1439
413 Ga0439465_0140677 3300041413 Bacteria 857
414 Ga0451789_0214170 3300041443 Bacteria 923
415 Ga0439451_071014 3300042009 Bacteria 697
416 Ga0450914_001396 3300042118 Bacteria 1504
417 Ga0450917_003298 3300042120 Bacteria 1166
418 Ga0450922_022659 3300042124 Bacteria 655
419 Ga0450910_017161 3300042147 Bacteria 1076
420 Ga0439446_0033002 3300042156 Bacteria 1503
421 Ga0439434_0069991 3300042435 Bacteria 1104
422 Ga0439434_0365322 3300042435 Bacteria 505
423 Ga0439435_0087305 3300042436 Bacteria 943
424 Ga0439459_0024711 3300042438 Bacteria 1181
425 Ga0439460_0322011 3300042461 Bacteria 542
426 Ga0466966_0227600 3300044684 Bacteria 1125
427 Ga0466961_0004522 3300044693 Bacteria 8722
428 Ga0466961_0129919 3300044693 Bacteria 1579
429 Ga0466963_0045086 3300044694 Bacteria 2903
430 Ga0466963_0065430 3300044694 Bacteria 2437
431 Ga0466963_0370864 3300044694 Bacteria 1008
432 Ga0466964_0017025 3300044706 Bacteria 2780
433 Ga0466964_0098342 3300044706 Bacteria 1285
434 Ga0466971_0000971 3300044719 Bacteria 11773
435 Ga0466970_0129549 3300044765 Bacteria 1385
436 Ga0466957_0019150 3300044842 Bacteria 4025
437 Ga0466957_0183257 3300044842 Bacteria 1368
438 Ga0466959_0001767 3300045049 Bacteria 13474
439 Ga0451576_0392396 3300045051 Bacteria 1455
440 Ga0466958_0032583 3300045836 Bacteria 3101
441 Ga0466958_0033308 3300045836 Bacteria 3069
442 Ga0466967_0016795 3300045976 Bacteria 5785
443 Ga0466967_0037497 3300045976 Bacteria 4149
444 Ga0466967_0071417 3300045976 Bacteria 3108
445 Ga0466967_0082853 3300045976 Bacteria 2900
446 Ga0466967_0087550 3300045976 Bacteria 2824
447 Ga0466967_0194051 3300045976 Bacteria 1920
448 Ga0466967_0297675 3300045976 Bacteria 1551
449 Ga0466967_0856629 3300045976 Bacteria 903
450 Ga0466967_1616934 3300045976 Bacteria 645
451 Ga0495627_118966 3300046453 Bacteria 747
452 Ga0495590_0052256 3300046457 Bacteria 1428
453 Ga0495641_0494497 3300046461 Bacteria 557
454 Ga0495651_0129691 3300046462 Bacteria 1842
455 Ga0495653_0089552 3300046463 Bacteria 2254
456 Ga0495653_0400563 3300046463 Bacteria 872
457 Ga0495605_0070692 3300046474 Bacteria 1650
458 Ga0495605_0176084 3300046474 Bacteria 943
459 Ga0495662_0625522 3300046476 Bacteria 526
460 Ga0495584_0126171 3300046491 Bacteria 1297
461 Ga0495585_0321824 3300046492 Bacteria 756
462 Ga0495607_0282001 3300046501 Bacteria 788
463 Ga0495583_0433555 3300046506 Bacteria 515
464 Ga0495608_0108276 3300046511 Bacteria 1787
465 Ga0495608_0483358 3300046511 Bacteria 751
466 Ga0495618_0229320 3300046514 Bacteria 1170
467 Ga0495628_0539716 3300046516 Bacteria 838
468 Ga0495628_0809890 3300046516 Bacteria 655
469 Ga0495630_0101819 3300046517 Bacteria 2173
470 Ga0495630_0312628 3300046517 Bacteria 1201
471 Ga0495630_0700242 3300046517 Bacteria 775
472 Ga0495631_0104780 3300046518 Bacteria 1217
473 Ga0495632_0163704 3300046519 Bacteria 1024
474 Ga0495637_0103078 3300046520 Bacteria 1113
475 Ga0495637_0283653 3300046520 Bacteria 590
476 Ga0495644_0050527 3300046523 Bacteria 1561
477 Ga0495644_0162987 3300046523 Bacteria 855
478 Ga0495663_0038142 3300046525 Bacteria 1451
479 Ga0495663_0340727 3300046525 Bacteria 545
480 Ga0495642_0013358 3300046528 Bacteria 3175
481 Ga0495642_0247190 3300046528 Bacteria 780
482 Ga0495652_0159220 3300046529 Bacteria 1755
483 Ga0495652_0466651 3300046529 Bacteria 881
484 Ga0495652_0678530 3300046529 Bacteria 695
485 Ga0495640_0333906 3300046533 Bacteria 937
486 Ga0495586_0268516 3300046535 Bacteria 975
487 Ga0495598_0039477 3300046537 Bacteria 1373
488 Ga0495609_0058883 3300046538 Bacteria 1699
489 Ga0495633_0137042 3300046558 Bacteria 1132
490 Ga0495667_0016704 3300046559 Bacteria 4956
491 Ga0495667_0090217 3300046559 Bacteria 1986
492 Ga0495667_0294934 3300046559 Bacteria 1028
493 Ga0495667_0356909 3300046559 Bacteria 923
494 Ga0495667_0959836 3300046559 Bacteria 522
495 Ga0495656_0018932 3300046615 Bacteria 2651
496 Ga0495656_0139976 3300046615 Bacteria 1160
497 Ga0495656_0166621 3300046615 Bacteria 1074
498 Ga0495656_0322017 3300046615 Bacteria 796
499 Ga0495634_0159299 3300046642 Bacteria 1424
500 Ga0495634_0171225 3300046642 Bacteria 1364
501 Ga0495634_0204807 3300046642 Bacteria 1224
502 Ga0495611_0124386 3300046648 Bacteria 1203
503 Ga0495635_0181983 3300046663 Bacteria 1428
504 Ga0495635_0215938 3300046663 Bacteria 1298
505 Ga0495659_0159306 3300046664 Bacteria 910
506 Ga0495657_0040527 3300046675 Bacteria 3194
507 Ga0495657_0155565 3300046675 Bacteria 1417
508 Ga0495657_0267301 3300046675 Bacteria 1026
509 Ga0495599_0869680 3300046678 Bacteria 512
510 Ga0495623_0401753 3300046679 Bacteria 737
511 Ga0495646_0152428 3300046680 Bacteria 1285
512 Ga0495669_0131803 3300046684 Bacteria 1177
513 Ga0495669_0259092 3300046684 Bacteria 836
514 Ga0495669_0423644 3300046684 Bacteria 646
515 Ga0495613_0300497 3300046689 Bacteria 1111
516 Ga0495624_0142110 3300046690 Bacteria 1470
517 Ga0495589_0306121 3300046794 Bacteria 736
518 Ga0495600_0484756 3300046809 Bacteria 761
519 Ga0495660_0531301 3300046810 Bacteria 500
520 Ga0495604_0471009 3300047317 Bacteria 818
521 Ga0495604_0697375 3300047317 Bacteria 645
522 Ga0495604_0873870 3300047317 Bacteria 563
523 Ga0495636_0123538 3300047318 Bacteria 1147
524 Ga0495636_0131199 3300047318 Bacteria 1115
525 Ga0495676_0159844 3300047321 Bacteria 1595
526 Ga0495676_0772083 3300047321 Bacteria 620
527 Ga0495680_0002837 3300047322 Bacteria 17416
528 Ga0495680_0016214 3300047322 Bacteria 6407
529 Ga0495680_0264285 3300047322 Bacteria 1216
530 Ga0495683_0484471 3300047323 Bacteria 504
531 Ga0495687_138806 3300047443 Bacteria 849
532 Ga0495675_0296064 3300047444 Bacteria 962
533 Ga0495684_0009748 3300047471 Bacteria 7411
534 Ga0495684_0014916 3300047471 Bacteria 5985
535 Ga0495684_0845089 3300047471 Bacteria 594
536 Ga0495602_0929179 3300048088 Bacteria 577
537 Ga0496100_0074729 3300048903 Bacteria 2271
538 Ga0496100_0340760 3300048903 Bacteria 1130
539 Ga0496100_0479709 3300048903 Bacteria 956
540 Ga0496100_1329938 3300048903 Bacteria 567
541 Ga0496100_1545140 3300048903 Bacteria 524
542 Ga0496101_0104332 3300048904 Bacteria 2126
543 Ga0496101_0355964 3300048904 Bacteria 1151
544 Ga0496101_0470468 3300048904 Bacteria 992
545 Ga0496101_0554154 3300048904 Bacteria 909
546 Ga0496101_1234382 3300048904 Bacteria 585
547 Ga0496102_0201073 3300048905 Bacteria 1878
548 Ga0496104_0005098 3300048907 Bacteria 11464
549 Ga0496104_0151334 3300048907 Bacteria 2227
550 Ga0496104_0158667 3300048907 Bacteria 2170
551 Ga0496104_0188293 3300048907 Bacteria 1975
552 Ga0496104_0215908 3300048907 Bacteria 1830
553 Ga0496104_0316236 3300048907 Bacteria 1474
554 Ga0496104_0956680 3300048907 Bacteria 761
555 Ga0496105_0002794 3300048908 Bacteria 12764
556 Ga0496105_0038494 3300048908 Bacteria 3939
557 Ga0496105_0091710 3300048908 Bacteria 2509
558 Ga0496105_0307589 3300048908 Bacteria 1273
559 Ga0496105_0474474 3300048908 Bacteria 985
560 Ga0496105_0732390 3300048908 Bacteria 756
561 Ga0496105_0876647 3300048908 Bacteria 678
562 Ga0496105_1173908 3300048908 Bacteria 566
563 Ga0496106_0172803 3300048909 Bacteria 1713
564 Ga0496106_0197766 3300048909 Bacteria 1599
565 Ga0496106_0287226 3300048909 Bacteria 1318
566 Ga0496106_1148925 3300048909 Bacteria 607
567 Ga0496107_0953777 3300048910 Bacteria 624
568 Ga0496108_0020577 3300048911 Bacteria 5422
569 Ga0496108_0038707 3300048911 Bacteria 3973
570 Ga0496108_0099911 3300048911 Bacteria 2474
571 Ga0496108_0189382 3300048911 Bacteria 1783
572 Ga0496108_0244306 3300048911 Bacteria 1562
573 Ga0496108_1260722 3300048911 Bacteria 623
574 Ga0496109_0020613 3300048912 Bacteria 5823
575 Ga0496109_0043729 3300048912 Bacteria 4060
576 Ga0496109_0061457 3300048912 Bacteria 3434
577 Ga0496109_0377775 3300048912 Bacteria 1339
578 Ga0496109_0716441 3300048912 Bacteria 938
579 Ga0496109_0776217 3300048912 Bacteria 896
580 Ga0496109_2022606 3300048912 Bacteria 508
581 Ga0496110_0008791 3300048913 Bacteria 8138
582 Ga0496110_0013634 3300048913 Bacteria 6729
583 Ga0496110_0063612 3300048913 Bacteria 3260
584 Ga0496110_0438681 3300048913 Bacteria 1190
585 Ga0496110_0647550 3300048913 Bacteria 956
586 Ga0496110_0658909 3300048913 Bacteria 947
587 Ga0496111_0009841 3300048914 Bacteria 6391
588 Ga0496111_0012957 3300048914 Bacteria 5659
589 Ga0496111_0799660 3300048914 Bacteria 683
590 Ga0496111_1010368 3300048914 Bacteria 596
591 Ga0496112_0012288 3300048915 Bacteria 7863
592 Ga0496112_0361682 3300048915 Bacteria 1393
593 Ga0496112_0513699 3300048915 Bacteria 1133
594 Ga0496112_1035404 3300048915 Bacteria 740
595 Ga0496112_1586333 3300048915 Bacteria 568
596 Ga0496113_0101444 3300048916 Bacteria 2231
597 Ga0496113_0627853 3300048916 Bacteria 860
598 Ga0496114_0357020 3300048917 Bacteria 1293
599 Ga0496114_0419537 3300048917 Bacteria 1185
600 Ga0496114_1323514 3300048917 Bacteria 607
601 Ga0496115_0020286 3300048918 Bacteria 5126
602 Ga0496115_0398176 3300048918 Bacteria 1117
603 Ga0496115_0854939 3300048918 Bacteria 704
604 Ga0496115_0959933 3300048918 Bacteria 656
605 Ga0496115_1033174 3300048918 Bacteria 626
606 Ga0496126_0138835 3300048929 Bacteria 2094
607 Ga0501292_075571 3300049515 Bacteria 633
608 Ga0501293_033660 3300049516 Bacteria 558
609 Ga0501031_0457693 3300049568 Bacteria 824
610 Ga0501033_0013479 3300049570 Bacteria 6222
611 Ga0501033_1041244 3300049570 Bacteria 546
612 Ga0501036_0398146 3300049572 Bacteria 1149
613 Ga0501037_0558792 3300049573 Bacteria 772
614 Ga0501038_0127182 3300049574 Bacteria 2096
615 Ga0501039_0168589 3300049575 Bacteria 1721
616 Ga0501039_0171289 3300049575 Bacteria 1707
617 Ga0501039_1231993 3300049575 Bacteria 578
618 Ga0501040_0009322 3300049576 Bacteria 6394
619 Ga0501041_0054198 3300049577 Bacteria 2446
620 Ga0501041_0357219 3300049577 Bacteria 924
621 Ga0501042_0131267 3300049578 Bacteria 1805
622 Ga0501048_0107480 3300049582 Bacteria 1970
623 Ga0501048_0173616 3300049582 Bacteria 1527
624 Ga0501067_0000314 3300049583 Bacteria 26636
625 Ga0501068_0000349 3300049584 Bacteria 23215
626 Ga0501068_0085790 3300049584 Bacteria 1938
627 Ga0501068_1071047 3300049584 Bacteria 533
628 Ga0501069_0011099 3300049585 Bacteria 4779
629 Ga0501069_0033204 3300049585 Bacteria 2842
630 Ga0501069_0274073 3300049585 Bacteria 987
631 Ga0501070_0093602 3300049586 Bacteria 2486
632 Ga0501070_1390042 3300049586 Bacteria 534
633 Ga0501071_0004326 3300049587 Bacteria 9002
634 Ga0501071_0369168 3300049587 Bacteria 1093
635 Ga0501071_0794534 3300049587 Bacteria 729
636 Ga0501071_0979609 3300049587 Bacteria 653
637 Ga0501072_0180960 3300049588 Bacteria 1681
638 Ga0501072_0583689 3300049588 Bacteria 881
639 Ga0501072_0823885 3300049588 Bacteria 726
640 Ga0501074_0047242 3300049590 Bacteria 3112
641 Ga0501074_0203523 3300049590 Bacteria 1411
642 Ga0501075_0060033 3300049591 Bacteria 2865
643 Ga0501076_0272278 3300049592 Bacteria 1387
644 Ga0501076_1263065 3300049592 Bacteria 607
645 Ga0501076_1281209 3300049592 Bacteria 603
646 Ga0501077_0350241 3300049593 Bacteria 942
647 Ga0501208_144839 3300049655 Bacteria 537
648 Ga0501209_069816 3300049656 Bacteria 997
649 Ga0501238_070635 3300049671 Bacteria 542
650 Ga0501221_148890 3300049704 Bacteria 619
651 Ga0501234_079181 3300049707 Bacteria 577
652 Ga0501079_0073479 3300049741 Bacteria 2643
653 Ga0501079_0349213 3300049741 Bacteria 1159
654 Ga0501079_0465129 3300049741 Bacteria 993
655 Ga0501079_0530085 3300049741 Bacteria 926
656 Ga0501079_0879897 3300049741 Bacteria 705
657 Ga0501079_1347081 3300049741 Bacteria 562
658 Ga0501080_1834738 3300049742 Bacteria 509
659 Ga0501081_0015047 3300049743 Bacteria 5105
660 Ga0501271_021714 3300049768 Bacteria 748
661 Ga0501275_094447 3300049772 Bacteria 501
662 Ga0501035_0630813 3300049822 Bacteria 871
663 Ga0501035_1087289 3300049822 Bacteria 625
664 Ga0501045_1304043 3300049824 Bacteria 528
665 nmdc:mga05p37_26949_c1 3300050507 Bacteria 6992
666 nmdc:mga05p37_451163_c1 3300050507 Bacteria 1488
667 nmdc:mga05p37_550876_c1 3300050507 Bacteria 1313
668 nmdc:mga05p37_970578_c1 3300050507 Bacteria 907
669 nmdc:mga08y16_1866217_c1 3300050511 Bacteria 553
670 nmdc:mga08y16_413865_c1 3300050511 Bacteria 1378
671 nmdc:mga08y16_58291_c1 3300050511 Bacteria 4035
672 nmdc:mga08y16_619910_c1 3300050511 Bacteria 1089
673 nmdc:mga08y16_78142_c1 3300050511 Bacteria 3450
674 nmdc:mga0n895_153171_c1 3300050512 Bacteria 2336
675 nmdc:mga0n895_1644697_c1 3300050512 Bacteria 606
676 nmdc:mga0rr50_751231_c1 3300050513 Bacteria 832
677 nmdc:mga0a205_173064_c1 3300050515 Bacteria 2055
678 nmdc:mga0a205_400278_c1 3300050515 Bacteria 1237
679 Ga0495601_0147141 3300053077 Bacteria 1538
680 Ga0495601_0378310 3300053077 Bacteria 919
681 Ga0495601_0764565 3300053077 Bacteria 614
682 Ga0495601_0791411 3300053077 Bacteria 602
683 Ga0495655_0208215 3300053083 Bacteria 642
684 Ga0495595_0003079 3300053084 Bacteria 6595
685 Ga0495595_0008224 3300053084 Bacteria 4283
686 Ga0495619_0070819 3300053085 Bacteria 2332
687 Ga0495619_0160628 3300053085 Bacteria 1552
688 Ga0495619_0371901 3300053085 Bacteria 988
689 Ga0495619_0878549 3300053085 Bacteria 604
690 Ga0501084_0024306 3300054114 Bacteria 5053
691 Ga0501084_0211544 3300054114 Bacteria 1636
692 Ga0501084_1159531 3300054114 Bacteria 648
693 Ga0587070_133554 3300059491 Bacteria 606
694 Ga0587082_060835 3300059504 Bacteria 744
695 Ga0587089_103707 3300059509 Bacteria 518
696 Ga0587062_096861 3300059639 Bacteria 569
697 Ga0587062_126594 3300059639 Bacteria 521
698 Ga0587076_080924 3300059645 Bacteria 693
699 Ga0501082_0533166 3300060353 Bacteria 1026
700 Ga0501082_0833087 3300060353 Bacteria 807
701 Ga0501082_1097232 3300060353 Bacteria 696
702 Ga0466962_0001733 3300061719 Bacteria 10253
703 Ga0530510_0034859 3300061734 Bacteria 3626
704 Ga0530510_0111190 3300061734 Bacteria 2007
705 Ga0530510_0190060 3300061734 Bacteria 1524
706 Ga0530510_0191777 3300061734 Bacteria 1517
707 Ga0373933_0215219
708 JGI24737J22298_10159499
709 JGI24742J22300_10087163
710 JGI24751J29686_10043076
711 JGI25407J50210_10009553
712 JGI25407J50210_10105274
713 Ga0058859_11656751
714 Ga0070676_10149709
715 Ga0070683_100278649
716 Ga0070683_100484079
717 Ga0070683_100498378
718 Ga0070683_100524440
719 Ga0070690_100015506
720 Ga0070670_100036039
721 Ga0070680_100808603
722 Ga0070680_101197889
723 Ga0070680_101364601
724 Ga0070682_100033554
725 Ga0070682_100090423
726 Ga0070689_100011400
727 Ga0070689_100275630
728 Ga0070691_10048903
729 Ga0070687_100004900
730 Ga0070661_100454121
731 Ga0070692_10099297
732 Ga0070692_10169102
733 Ga0070668_100734602
734 Ga0070668_100900717
735 Ga0070669_100776964
736 Ga0070675_100137721
737 Ga0070675_100413889
738 Ga0070671_100320123
739 Ga0070671_100565092
740 Ga0070671_101763731
741 Ga0070674_100208719
742 Ga0070674_100672841
743 Ga0070673_100074774
744 Ga0070673_102137321
745 Ga0070688_100003816
746 Ga0070688_100276444
747 Ga0070659_100006869
748 Ga0070659_100579322
749 Ga0070659_100940073
750 Ga0070667_100481136
751 Ga0070711_100263708
752 Ga0070705_100063523
753 Ga0070705_100145123
754 Ga0070705_100225276
755 Ga0070700_100006192
756 Ga0070700_100206715
757 Ga0070700_100311560
758 Ga0070700_100549446
759 Ga0070694_100221425
760 Ga0070694_100238167
761 Ga0070694_100995817
762 Ga0070708_100490447
763 Ga0070708_100873164
764 Ga0070663_100134303
765 Ga0070678_100281709
766 Ga0070662_100040018
767 Ga0070681_10290798
768 Ga0070681_10744552
769 Ga0068867_100018210
770 Ga0068867_100500027
771 Ga0068867_100781882
772 Ga0070685_10113869
773 Ga0070706_100514454
774 Ga0070707_102209755
775 Ga0070698_100022281
776 Ga0070698_100082668
777 Ga0070698_101420579
778 Ga0070699_100050352
779 Ga0070699_100288580
780 Ga0070699_100617848
781 Ga0070679_100357296
782 Ga0070684_100027971
783 Ga0070684_100138019
784 Ga0070684_100220013
785 Ga0070684_100344804
786 Ga0070697_100077363
787 Ga0070697_100234608
788 Ga0070697_100849142
789 Ga0070697_101504292
790 Ga0068853_100639430
791 Ga0070672_100098764
792 Ga0070672_100524934
793 Ga0070686_100004377
794 Ga0070686_100284456
795 Ga0070696_100006955
796 Ga0070696_100071548
797 Ga0070696_101011041
798 Ga0070693_100134308
799 Ga0070693_101277033
800 Ga0070665_101450863
801 Ga0070664_100030578
802 Ga0070664_100420174
803 Ga0070664_100546479
804 Ga0070664_100921101
805 Ga0068857_100027184
806 Ga0068857_100030217
807 Ga0068857_102158617
808 Ga0068857_102331831
809 Ga0068854_100103070
810 Ga0068854_100754145
811 Ga0068856_100126000
812 Ga0070702_100007071
813 Ga0068852_100022059
814 Ga0068852_100774253
815 Ga0068859_100137104
816 Ga0068859_102765314
817 Ga0068864_100086000
818 Ga0068864_100675894
819 Ga0068864_102365372
820 Ga0068866_10098729
821 Ga0068861_101046552
822 Ga0068861_102040050
823 Ga0068870_10003863
824 Ga0068870_10208673
825 Ga0068863_100723886
826 Ga0068858_100055220
827 Ga0068858_100631815
828 Ga0068860_100004060
829 Ga0068860_102363218
830 Ga0068862_100186136
831 Ga0081455_10004505
832 Ga0081455_10007154
833 Ga0081455_10091640
834 Ga0081538_10000240
835 Ga0081538_10002585
836 Ga0081538_10036113
837 Ga0081540_1093167
838 Ga0070717_10887563
839 Ga0075365_10928082
840 Ga0075432_10326724
841 Ga0070716_100557134
842 Ga0070712_100070694
843 Ga0070712_100363249
844 Ga0070712_100434365
845 Ga0075367_10511627
846 Ga0097621_100087269
847 Ga0097621_101137549
848 Ga0075428_100204411
849 Ga0075428_100469260
850 Ga0075428_101623726
851 Ga0075428_101680577
852 Ga0075428_102000985
853 Ga0075431_100065436
854 Ga0075433_10253621
855 Ga0075433_10398127
856 Ga0075433_10626417
857 Ga0075433_10739040
858 Ga0075434_100103255
859 Ga0068865_100110705
860 Ga0068865_100390119
861 Ga0068865_101364949
862 Ga0097620_100137097
863 Ga0097620_102765048
864 Ga0075435_100552860
865 Ga0111539_10002272
866 Ga0111539_10040587
867 Ga0111539_10451625
868 Ga0111539_10994997
869 Ga0111539_12125552
870 Ga0111539_12929904
871 Ga0105245_10046707
872 Ga0105245_10187661
873 Ga0105245_10256949
874 Ga0105245_10912698
875 Ga0105247_10050427
876 Ga0114129_10019250
877 Ga0114129_10083439
878 Ga0114129_10742920
879 Ga0114129_10979982
880 Ga0114129_11858363
881 Ga0114129_12816128
882 Ga0105243_10015460
883 Ga0105243_10438802
884 Ga0105243_10508009
885 Ga0105243_11626979
886 Ga0105241_10094162
887 Ga0105242_10047340
888 Ga0105248_10051124
889 Ga0105248_11247964
890 Ga0105248_12061870
891 Ga0105237_11970621
892 Ga0105238_10712162
893 Ga0105238_12674923
894 Ga0105249_10006756
895 Ga0105249_10129149
896 Ga0105249_10910758
897 Ga0105249_10991108
898 Ga0105239_10128806
899 Ga0105239_13137395
900 Ga0105246_10344307
901 Ga0105246_10599021
902 Ga0105246_10758086
903 Ga0157344_1025678
904 Ga0157337_1000969
905 Ga0157315_1026828
906 Ga0157373_11253780
907 Ga0157373_11278433
908 Ga0157370_11296431
909 Ga0157370_12028227
910 Ga0157369_10035964
911 Ga0157369_10583990
912 Ga0157374_10529927
913 Ga0157374_11084149
914 Ga0157378_10003446
915 Ga0163162_10137854
916 Ga0157372_11000944
917 Ga0157372_11303705
918 Ga0157372_11910317
919 Ga0157375_10013278
920 Ga0157375_11516010
921 Ga0163163_10008650
922 Ga0163163_10786814
923 Ga0157380_10033356
924 Ga0182008_10298628
925 Ga0157377_10007842
926 Ga0157377_10219495
927 Ga0157379_10084518
928 Ga0157379_10973229
929 Ga0157376_10278680
930 Ga0157376_10391186
931 Ga0157376_10519221
932 Ga0182006_1053905
933 Ga0182006_1242283
934 Ga0163161_10064380
935 Ga0206353_11559060
936 Ga0213873_10007348
937 Ga0213871_10002315
938 Ga0207653_10028703
939 Ga0207642_10032257
940 Ga0207710_10118324
941 Ga0207688_10126286
942 Ga0207643_10001789
943 Ga0207643_10688886
944 Ga0207705_10612733
945 Ga0207684_11147625
946 Ga0207707_10835692
947 Ga0207660_11030656
948 Ga0207660_11317392
949 Ga0207662_10000237
950 Ga0207649_10087818
951 Ga0207681_10642878
952 Ga0207681_10904150
953 Ga0207650_10356623
954 Ga0207659_10010535
955 Ga0207687_10027593
956 Ga0207687_10751710
957 Ga0207700_10037748
958 Ga0207700_10103004
959 Ga0207664_10527829
960 Ga0207644_10309324
961 Ga0207644_10529163
962 Ga0207690_10466257
963 Ga0207690_10517329
964 Ga0207706_10032167
965 Ga0207686_10783383
966 Ga0207709_10027266
967 Ga0207709_10865606
968 Ga0207670_10250582
969 Ga0207670_10325848
970 Ga0207670_10867188
971 Ga0207669_10171024
972 Ga0207704_10456914
973 Ga0207704_11669478
974 Ga0207665_10453012
975 Ga0207691_10012785
976 Ga0207711_10226028
977 Ga0207689_10512985
978 Ga0207689_10792094
979 Ga0207661_10191482
980 Ga0207661_10451894
981 Ga0207661_12111172
982 Ga0207679_10364574
983 Ga0207679_11277072
984 Ga0207667_10769222
985 Ga0207651_10127559
986 Ga0207651_10599117
987 Ga0207712_10068519
988 Ga0207712_10625568
989 Ga0207712_11051097
990 Ga0207668_10230153
991 Ga0207640_10146008
992 Ga0207640_10931003
993 Ga0207640_10963821
994 Ga0207658_10429120
995 Ga0207703_10088091
996 Ga0207703_10487315
997 Ga0207703_11950554
998 Ga0207639_10092058
999 Ga0207639_12263996
1000 Ga0207678_10015566
1001 Ga0207708_10007304
1002 Ga0207708_10244044
1003 Ga0207708_10256758
1004 Ga0207702_10058200
1005 Ga0207641_10707988
1006 Ga0207641_11650941
1007 Ga0207648_10001684
1008 Ga0207648_10562546
1009 Ga0207648_11053909
1010 Ga0207676_10854240
1011 Ga0207674_10027111
1012 Ga0207674_10032996
1013 Ga0207675_100067548
1014 Ga0207675_100376852
1015 Ga0207675_100457238
1016 Ga0207683_10052641
1017 Ga0207698_10063639
1018 Ga0209999_1059138
1019 Ga0210002_1106016
1020 Ga0209971_1119350
1021 Ga0209974_10037398
1022 Ga0207428_10006328
1023 Ga0207428_10218425
1024 Ga0207428_10396899
1025 Ga0268266_10256326
1026 Ga0268265_10196532
1027 Ga0268264_10068651
1028 Ga0268264_12304378
1029 Ga0265338_10945442
1030 Ga0265325_10359618
1031 Ga0265327_10015346
1032 Ga0265316_10646096
1033 Ga0307408_100060910
1034 Ga0307408_100085518
1035 Ga0307408_100117131
1036 Ga0307405_10109650
1037 Ga0307405_10143618
1038 Ga0307413_10019744
1039 Ga0307410_10004596
1040 Ga0307406_10030841
1041 Ga0307406_10404829
1042 Ga0307407_10001098
1043 Ga0307407_11469542
1044 Ga0307412_10065059
1045 Ga0307412_10180365
1046 Ga0307412_11448172
1047 Ga0307409_100013896
1048 Ga0307416_100000904
1049 Ga0307416_100041773
1050 Ga0307416_100206885
1051 Ga0307416_101027658
1052 Ga0307416_101678467
1053 Ga0307414_10039191
1054 Ga0307411_10246349
1055 Ga0307415_100004099
1056 Ga0307415_100103427
1057 Ga0373950_0164137
1058 Ga0373934_0100557
1059 Ga0373952_0051874
1060 Ga0373941_0192595
1061 Ga0373953_0070354
1062 Ga0373954_0040886
1063 Ga0373960_0424203
1064 Ga0373946_0413211
1065 Ga0373955_0474584
1066 Ga0373942_0079965
1067 Ga0373961_0427376
1068 Ga0373962_0245608
1069 Ga0373924_0111660
1070 Ga0373931_0125146
1071 Ga0373935_0055212
1072 Ga0373937_0162707
1073 Ga0395899_0002898
1074 Ga0395899_0041850
1075 Ga0395899_0124192
1076 Ga0395899_0299025
1077 Ga0395899_0509680
1078 Ga0395900_0038387
1079 Ga0395900_0080879
1080 Ga0395900_0082293
1081 Ga0395900_0125629
1082 Ga0395900_0126057
1083 Ga0395900_0651759
1084 Ga0395900_0995387
1085 Ga0395900_1266213
1086 Ga0395898_0007360
1087 Ga0395898_0020580
1088 Ga0395898_0031910
1089 Ga0395898_0142255
1090 Ga0395898_0331309
1091 Ga0395898_0439711
1092 Ga0395898_0638129
1093 Ga0395898_1000409
1094 Ga0395905_0039849
1095 Ga0395905_0073515
1096 Ga0395905_0077321
1097 Ga0395905_0109850
1098 Ga0395905_0152799
1099 Ga0395905_0187841
1100 Ga0395901_0021218
1101 Ga0395901_0021517
1102 Ga0395901_0060354
1103 Ga0395901_0086522
1104 Ga0395901_0111459
1105 Ga0395901_0153011
1106 Ga0395901_0410548
1107 Ga0395901_1233502
1108 Ga0242420_000859
1109 Ga0436365_0473746
1110 Ga0436365_0851166
1111 Ga0436360_0095646
1112 Ga0436360_0901858
1113 Ga0436362_0026788
1114 Ga0436362_0141011
1115 Ga0439439_0085607
1116 Ga0439461_0086530
1117 Ga0439461_0145975
1118 Ga0439466_0046192
1119 Ga0439465_0140677
1120 Ga0451789_0214170
1121 Ga0439451_071014
1122 Ga0450914_001396
1123 Ga0450917_003298
1124 Ga0450922_022659
1125 Ga0450910_017161
1126 Ga0439446_0033002
1127 Ga0439434_0069991
1128 Ga0439434_0365322
1129 Ga0439435_0087305
1130 Ga0439459_0024711
1131 Ga0439460_0322011
1132 Ga0466966_0227600
1133 Ga0466961_0004522
1134 Ga0466961_0129919
1135 Ga0466963_0045086
1136 Ga0466963_0065430
1137 Ga0466963_0370864
1138 Ga0466964_0017025
1139 Ga0466964_0098342
1140 Ga0466971_0000971
1141 Ga0466970_0129549
1142 Ga0466957_0019150
1143 Ga0466957_0183257
1144 Ga0466959_0001767
1145 Ga0451576_0392396
1146 Ga0466958_0032583
1147 Ga0466958_0033308
1148 Ga0466967_0016795
1149 Ga0466967_0037497
1150 Ga0466967_0071417
1151 Ga0466967_0082853
1152 Ga0466967_0087550
1153 Ga0466967_0194051
1154 Ga0466967_0297675
1155 Ga0466967_0856629
1156 Ga0466967_1616934
1157 Ga0495627_118966
1158 Ga0495590_0052256
1159 Ga0495641_0494497
1160 Ga0495651_0129691
1161 Ga0495653_0089552
1162 Ga0495653_0400563
1163 Ga0495605_0070692
1164 Ga0495605_0176084
1165 Ga0495662_0625522
1166 Ga0495584_0126171
1167 Ga0495585_0321824
1168 Ga0495607_0282001
1169 Ga0495583_0433555
1170 Ga0495608_0108276
1171 Ga0495608_0483358
1172 Ga0495618_0229320
1173 Ga0495628_0539716
1174 Ga0495628_0809890
1175 Ga0495630_0101819
1176 Ga0495630_0312628
1177 Ga0495630_0700242
1178 Ga0495631_0104780
1179 Ga0495632_0163704
1180 Ga0495637_0103078
1181 Ga0495637_0283653
1182 Ga0495644_0050527
1183 Ga0495644_0162987
1184 Ga0495663_0038142
1185 Ga0495663_0340727
1186 Ga0495642_0013358
1187 Ga0495642_0247190
1188 Ga0495652_0159220
1189 Ga0495652_0466651
1190 Ga0495652_0678530
1191 Ga0495640_0333906
1192 Ga0495586_0268516
1193 Ga0495598_0039477
1194 Ga0495609_0058883
1195 Ga0495633_0137042
1196 Ga0495667_0016704
1197 Ga0495667_0090217
1198 Ga0495667_0294934
1199 Ga0495667_0356909
1200 Ga0495667_0959836
1201 Ga0495656_0018932
1202 Ga0495656_0139976
1203 Ga0495656_0166621
1204 Ga0495656_0322017
1205 Ga0495634_0159299
1206 Ga0495634_0171225
1207 Ga0495634_0204807
1208 Ga0495611_0124386
1209 Ga0495635_0181983
1210 Ga0495635_0215938
1211 Ga0495659_0159306
1212 Ga0495657_0040527
1213 Ga0495657_0155565
1214 Ga0495657_0267301
1215 Ga0495599_0869680
1216 Ga0495623_0401753
1217 Ga0495646_0152428
1218 Ga0495669_0131803
1219 Ga0495669_0259092
1220 Ga0495669_0423644
1221 Ga0495613_0300497
1222 Ga0495624_0142110
1223 Ga0495589_0306121
1224 Ga0495600_0484756
1225 Ga0495660_0531301
1226 Ga0495604_0471009
1227 Ga0495604_0697375
1228 Ga0495604_0873870
1229 Ga0495636_0123538
1230 Ga0495636_0131199
1231 Ga0495676_0159844
1232 Ga0495676_0772083
1233 Ga0495680_0002837
1234 Ga0495680_0016214
1235 Ga0495680_0264285
1236 Ga0495683_0484471
1237 Ga0495687_138806
1238 Ga0495675_0296064
1239 Ga0495684_0009748
1240 Ga0495684_0014916
1241 Ga0495684_0845089
1242 Ga0495602_0929179
1243 Ga0496100_0074729
1244 Ga0496100_0340760
1245 Ga0496100_0479709
1246 Ga0496100_1329938
1247 Ga0496100_1545140
1248 Ga0496101_0104332
1249 Ga0496101_0355964
1250 Ga0496101_0470468
1251 Ga0496101_0554154
1252 Ga0496101_1234382
1253 Ga0496102_0201073
1254 Ga0496104_0005098
1255 Ga0496104_0151334
1256 Ga0496104_0158667
1257 Ga0496104_0188293
1258 Ga0496104_0215908
1259 Ga0496104_0316236
1260 Ga0496104_0956680
1261 Ga0496105_0002794
1262 Ga0496105_0038494
1263 Ga0496105_0091710
1264 Ga0496105_0307589
1265 Ga0496105_0474474
1266 Ga0496105_0732390
1267 Ga0496105_0876647
1268 Ga0496105_1173908
1269 Ga0496106_0172803
1270 Ga0496106_0197766
1271 Ga0496106_0287226
1272 Ga0496106_1148925
1273 Ga0496107_0953777
1274 Ga0496108_0020577
1275 Ga0496108_0038707
1276 Ga0496108_0099911
1277 Ga0496108_0189382
1278 Ga0496108_0244306
1279 Ga0496108_1260722
1280 Ga0496109_0020613
1281 Ga0496109_0043729
1282 Ga0496109_0061457
1283 Ga0496109_0377775
1284 Ga0496109_0716441
1285 Ga0496109_0776217
1286 Ga0496109_2022606
1287 Ga0496110_0008791
1288 Ga0496110_0013634
1289 Ga0496110_0063612
1290 Ga0496110_0438681
1291 Ga0496110_0647550
1292 Ga0496110_0658909
1293 Ga0496111_0009841
1294 Ga0496111_0012957
1295 Ga0496111_0799660
1296 Ga0496111_1010368
1297 Ga0496112_0012288
1298 Ga0496112_0361682
1299 Ga0496112_0513699
1300 Ga0496112_1035404
1301 Ga0496112_1586333
1302 Ga0496113_0101444
1303 Ga0496113_0627853
1304 Ga0496114_0357020
1305 Ga0496114_0419537
1306 Ga0496114_1323514
1307 Ga0496115_0020286
1308 Ga0496115_0398176
1309 Ga0496115_0854939
1310 Ga0496115_0959933
1311 Ga0496115_1033174
1312 Ga0496126_0138835
1313 Ga0501292_075571
1314 Ga0501293_033660
1315 Ga0501031_0457693
1316 Ga0501033_0013479
1317 Ga0501033_1041244
1318 Ga0501036_0398146
1319 Ga0501037_0558792
1320 Ga0501038_0127182
1321 Ga0501039_0168589
1322 Ga0501039_0171289
1323 Ga0501039_1231993
1324 Ga0501040_0009322
1325 Ga0501041_0054198
1326 Ga0501041_0357219
1327 Ga0501042_0131267
1328 Ga0501048_0107480
1329 Ga0501048_0173616
1330 Ga0501067_0000314
1331 Ga0501068_0000349
1332 Ga0501068_0085790
1333 Ga0501068_1071047
1334 Ga0501069_0011099
1335 Ga0501069_0033204
1336 Ga0501069_0274073
1337 Ga0501070_0093602
1338 Ga0501070_1390042
1339 Ga0501071_0004326
1340 Ga0501071_0369168
1341 Ga0501071_0794534
1342 Ga0501071_0979609
1343 Ga0501072_0180960
1344 Ga0501072_0583689
1345 Ga0501072_0823885
1346 Ga0501074_0047242
1347 Ga0501074_0203523
1348 Ga0501075_0060033
1349 Ga0501076_0272278
1350 Ga0501076_1263065
1351 Ga0501076_1281209
1352 Ga0501077_0350241
1353 Ga0501208_144839
1354 Ga0501209_069816
1355 Ga0501238_070635
1356 Ga0501221_148890
1357 Ga0501234_079181
1358 Ga0501079_0073479
1359 Ga0501079_0349213
1360 Ga0501079_0465129
1361 Ga0501079_0530085
1362 Ga0501079_0879897
1363 Ga0501079_1347081
1364 Ga0501080_1834738
1365 Ga0501081_0015047
1366 Ga0501271_021714
1367 Ga0501275_094447
1368 Ga0501035_0630813
1369 Ga0501035_1087289
1370 Ga0501045_1304043
1371 nmdc:mga05p37_26949_c1
1372 nmdc:mga05p37_451163_c1
1373 nmdc:mga05p37_550876_c1
1374 nmdc:mga05p37_970578_c1
1375 nmdc:mga08y16_1866217_c1
1376 nmdc:mga08y16_413865_c1
1377 nmdc:mga08y16_58291_c1
1378 nmdc:mga08y16_619910_c1
1379 nmdc:mga08y16_78142_c1
1380 nmdc:mga0n895_153171_c1
1381 nmdc:mga0n895_1644697_c1
1382 nmdc:mga0rr50_751231_c1
1383 nmdc:mga0a205_173064_c1
1384 nmdc:mga0a205_400278_c1
1385 Ga0495601_0147141
1386 Ga0495601_0378310
1387 Ga0495601_0764565
1388 Ga0495601_0791411
1389 Ga0495655_0208215
1390 Ga0495595_0003079
1391 Ga0495595_0008224
1392 Ga0495619_0070819
1393 Ga0495619_0160628
1394 Ga0495619_0371901
1395 Ga0495619_0878549
1396 Ga0501084_0024306
1397 Ga0501084_0211544
1398 Ga0501084_1159531
1399 Ga0587070_133554
1400 Ga0587082_060835
1401 Ga0587089_103707
1402 Ga0587062_096861
1403 Ga0587062_126594
1404 Ga0587076_080924
1405 Ga0501082_0533166
1406 Ga0501082_0833087
1407 Ga0501082_1097232
1408 Ga0466962_0001733
1409 Ga0530510_0034859
1410 Ga0530510_0111190
1411 Ga0530510_0190060
1412 Ga0530510_0191777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00037

Fer4

4Fe-4S binding domain

41

64

0.95

PF12797

Fer4_2

4Fe-4S binding domain

39

60

0.92

Map