F476400

General Info

Members Datasets Scaffolds Average Seq Length
705 333 704 139

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10162899|Ga0105239_101628993
Length 164
Sequence VREHALHAGTVAGSFKTGRAAPAHHRGMEIEFIASFAVITPDPSASRGLYVDALGLPLEHAPGDDYLHTESVGGAKHFGVWPLTQAAAACFGRAEWPAERPVPQASVEFEVASVEAVGAAADEFAGRGVELLHGARTEPWGQTVARLLSPEGVIVGISYVPQFH

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
102 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
120 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
127 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
201 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
202 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
205 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
229 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
302 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
303 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
304 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
320 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
321 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
324 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
325 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.02
Metatranscriptomes 2.84
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 8.09
Rhizosphere 88.23
Stem 0
Stem Tuber 0
Unclassified 2.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10093896 3300002067 Bacteria 861
2 rootH1_10033476 3300003316 Bacteria 2233
3 rootL2_10189113 3300003322 Bacteria 3114
4 rootH1_10275024 3300003323 Bacteria 2164
5 Ga0070658_10027933 3300005327 Bacteria 4528
6 Ga0070676_10056059 3300005328 Bacteria 2328
7 Ga0070683_100014900 3300005329 Bacteria 6814
8 Ga0070683_100098524 3300005329 Bacteria 2751
9 Ga0070683_100237568 3300005329 Bacteria 1733
10 Ga0070683_100456016 3300005329 Bacteria 1220
11 Ga0070690_100094889 3300005330 Bacteria 1969
12 Ga0070670_100219618 3300005331 Bacteria 1653
13 Ga0068869_100039143 3300005334 Bacteria 3384
14 Ga0070666_10155703 3300005335 Bacteria 1596
15 Ga0070666_10180460 3300005335 Bacteria 1480
16 Ga0070680_100000411 3300005336 Bacteria 29241
17 Ga0070680_100044013 3300005336 Bacteria 3627
18 Ga0070680_100160764 3300005336 Bacteria 1887
19 Ga0070680_100232023 3300005336 Bacteria 1559
20 Ga0070680_100646700 3300005336 Bacteria 909
21 Ga0070682_100024397 3300005337 Bacteria 3599
22 Ga0070682_100075106 3300005337 Bacteria 2173
23 Ga0070682_100347263 3300005337 Bacteria 1105
24 Ga0068868_100022330 3300005338 Bacteria 4773
25 Ga0070660_100124326 3300005339 Bacteria 2061
26 Ga0070660_100208875 3300005339 Bacteria 1584
27 Ga0070689_100007258 3300005340 Bacteria 7729
28 Ga0070691_10048363 3300005341 Bacteria 2024
29 Ga0070691_10114805 3300005341 Bacteria 1350
30 Ga0070661_100029994 3300005344 Bacteria 3927
31 Ga0070661_100030094 3300005344 Bacteria 3921
32 Ga0070661_100090564 3300005344 Bacteria 2265
33 Ga0070661_100100371 3300005344 Bacteria 2152
34 Ga0070692_10001194 3300005345 Bacteria 9194
35 Ga0070671_100022184 3300005355 Bacteria 5187
36 Ga0070674_100884564 3300005356 Bacteria 777
37 Ga0070674_101448654 3300005356 Unclassified 616
38 Ga0070673_100042817 3300005364 Bacteria 3494
39 Ga0070659_100030811 3300005366 Bacteria 4151
40 Ga0070659_100053622 3300005366 Bacteria 3174
41 Ga0070659_100124537 3300005366 Bacteria 2090
42 Ga0070667_100853462 3300005367 Bacteria 846
43 Ga0070703_10166730 3300005406 Bacteria 840
44 Ga0070709_10002975 3300005434 Bacteria 9124
45 Ga0070709_10447888 3300005434 Unclassified 972
46 Ga0070709_10545810 3300005434 Bacteria 886
47 Ga0070714_100279211 3300005435 Bacteria 1551
48 Ga0070714_100313394 3300005435 Bacteria 1465
49 Ga0070714_100600295 3300005435 Bacteria 1057
50 Ga0070713_100004650 3300005436 Bacteria 9262
51 Ga0070713_100050341 3300005436 Bacteria 3441
52 Ga0070713_100574585 3300005436 Bacteria 1069
53 Ga0070713_100730744 3300005436 Bacteria 946
54 Ga0070710_10379480 3300005437 Bacteria 942
55 Ga0070701_11243766 3300005438 Bacteria 530
56 Ga0070711_100383181 3300005439 Bacteria 1137
57 Ga0070711_101150953 3300005439 Unclassified 670
58 Ga0070711_101391751 3300005439 Unclassified 610
59 Ga0070700_100201616 3300005441 Bacteria 1398
60 Ga0070663_100000144 3300005455 Bacteria 34633
61 Ga0070663_100023438 3300005455 Bacteria 4138
62 Ga0070663_100383474 3300005455 Unclassified 1145
63 Ga0070678_100003038 3300005456 Bacteria 9300
64 Ga0070678_100450557 3300005456 Bacteria 1127
65 Ga0070662_100295286 3300005457 Bacteria 1315
66 Ga0070681_10000583 3300005458 Bacteria 30207
67 Ga0070681_10059606 3300005458 Bacteria 3797
68 Ga0070681_10078231 3300005458 Bacteria 3264
69 Ga0070681_10133876 3300005458 Bacteria 2410
70 Ga0070681_10853983 3300005458 Bacteria 828
71 Ga0070681_11175204 3300005458 Bacteria 689
72 Ga0070706_100184362 3300005467 Unclassified 1950
73 Ga0070707_100161746 3300005468 Unclassified 2181
74 Ga0070698_100005777 3300005471 Bacteria 13531
75 Ga0070698_100560259 3300005471 Bacteria 1082
76 Ga0070699_100366404 3300005518 Bacteria 1299
77 Ga0070679_100000628 3300005530 Bacteria 30052
78 Ga0070679_100015682 3300005530 Bacteria 7285
79 Ga0070679_100128239 3300005530 Bacteria 2518
80 Ga0070679_100190945 3300005530 Bacteria 2017
81 Ga0070679_100440639 3300005530 Bacteria 1247
82 Ga0070679_100623173 3300005530 Bacteria 1022
83 Ga0070679_101166119 3300005530 Unclassified 715
84 Ga0070684_100036526 3300005535 Bacteria 4210
85 Ga0070684_100036742 3300005535 Bacteria 4197
86 Ga0070684_100071244 3300005535 Bacteria 3060
87 Ga0070684_100750595 3300005535 Bacteria 911
88 Ga0070697_102090157 3300005536 Unclassified 507
89 Ga0068853_100028168 3300005539 Bacteria 4723
90 Ga0068853_100030444 3300005539 Bacteria 4559
91 Ga0068853_100055436 3300005539 Bacteria 3417
92 Ga0070686_100042982 3300005544 Bacteria 2833
93 Ga0070696_100262156 3300005546 Unclassified 1311
94 Ga0070696_100628620 3300005546 Bacteria 868
95 Ga0070693_100002404 3300005547 Bacteria 8617
96 Ga0070693_100124146 3300005547 Bacteria 1605
97 Ga0070665_100039549 3300005548 Bacteria 4741
98 Ga0070665_100068119 3300005548 Bacteria 3568
99 Ga0070665_100192635 3300005548 Bacteria 2039
100 Ga0070704_100179008 3300005549 Bacteria 1694
101 Ga0070704_101523898 3300005549 Unclassified 615
102 Ga0068855_100074382 3300005563 Bacteria 3946
103 Ga0068855_100619163 3300005563 Bacteria 1166
104 Ga0070664_100008834 3300005564 Bacteria 8166
105 Ga0068857_100051092 3300005577 Bacteria 3666
106 Ga0068857_100112578 3300005577 Bacteria 2447
107 Ga0068857_100447286 3300005577 Unclassified 1207
108 Ga0068857_100564758 3300005577 Bacteria 1073
109 Ga0068854_100126579 3300005578 Bacteria 1946
110 Ga0068854_100529153 3300005578 Bacteria 997
111 Ga0068854_101387964 3300005578 Bacteria 635
112 Ga0068856_100044737 3300005614 Bacteria 4357
113 Ga0068856_100066434 3300005614 Bacteria 3563
114 Ga0068856_100087537 3300005614 Bacteria 3096
115 Ga0068856_101031828 3300005614 Bacteria 840
116 Ga0070702_100004197 3300005615 Bacteria 6554
117 Ga0068852_100032362 3300005616 Bacteria 4329
118 Ga0068852_100154339 3300005616 Bacteria 2137
119 Ga0068852_100182426 3300005616 Bacteria 1975
120 Ga0068852_100620467 3300005616 Bacteria 1087
121 Ga0068859_100179367 3300005617 Bacteria 2200
122 Ga0068864_100072812 3300005618 Bacteria 2995
123 Ga0068866_10076750 3300005718 Unclassified 1782
124 Ga0068866_11118809 3300005718 Bacteria 565
125 Ga0068861_100410889 3300005719 Unclassified 1204
126 Ga0068861_100739580 3300005719 Unclassified 918
127 Ga0068851_10040917 3300005834 Bacteria 2330
128 Ga0068851_10045306 3300005834 Bacteria 2223
129 Ga0068851_10074048 3300005834 Bacteria 1767
130 Ga0068870_10011849 3300005840 Bacteria 4057
131 Ga0068863_100023339 3300005841 Bacteria 5909
132 Ga0068863_100132270 3300005841 Bacteria 2382
133 Ga0068863_101003968 3300005841 Bacteria 837
134 Ga0068858_100129331 3300005842 Bacteria 2367
135 Ga0068860_100380938 3300005843 Bacteria 1392
136 Ga0081455_10000542 3300005937 Bacteria 49017
137 Ga0081540_1001501 3300005983 Bacteria 20111
138 Ga0081540_1001813 3300005983 Bacteria 17925
139 Ga0070717_10030258 3300006028 Bacteria 4349
140 Ga0070717_10126571 3300006028 Bacteria 2194
141 Ga0070717_10158193 3300006028 Bacteria 1964
142 Ga0070717_10226736 3300006028 Bacteria 1644
143 Ga0070717_10586644 3300006028 Unclassified 1011
144 Ga0070717_10814818 3300006028 Unclassified 849
145 Ga0075432_10004310 3300006058 Bacteria 4844
146 Ga0070716_100378839 3300006173 Bacteria 1011
147 Ga0070716_100801455 3300006173 Bacteria 729
148 Ga0070716_100900409 3300006173 Unclassified 693
149 Ga0070712_100000007 3300006175 Bacteria 157653
150 Ga0070712_100807387 3300006175 Unclassified 805
151 Ga0070712_101077049 3300006175 Bacteria 697
152 Ga0075362_10004816 3300006177 Bacteria 4872
153 Ga0075362_10635765 3300006177 Unclassified 553
154 Ga0097621_100015785 3300006237 Bacteria 5693
155 Ga0075370_10092772 3300006353 Bacteria 1743
156 Ga0068871_100014196 3300006358 Bacteria 5930
157 Ga0075428_100241925 3300006844 Bacteria 1947
158 Ga0075431_100008020 3300006847 Bacteria 10535
159 Ga0075433_10231808 3300006852 Bacteria 1640
160 Ga0075434_100000742 3300006871 Bacteria 25613
161 Ga0075434_100059963 3300006871 Bacteria 3784
162 Ga0075434_101134826 3300006871 Bacteria 794
163 Ga0075429_100164136 3300006880 Bacteria 1946
164 Ga0075436_100014930 3300006914 Bacteria 5323
165 Ga0097620_100179370 3300006931 Bacteria 2200
166 Ga0075435_100007053 3300007076 Bacteria 7978
167 Ga0075435_100071170 3300007076 Bacteria 2839
168 Ga0075435_100169397 3300007076 Bacteria 1842
169 Ga0075435_100361986 3300007076 Bacteria 1244
170 Ga0099795_10024989 3300007788 Bacteria 1998
171 Ga0105251_10175895 3300009011 Bacteria 964
172 Ga0105250_10186135 3300009092 Unclassified 872
173 Ga0105240_10086849 3300009093 Bacteria 3831
174 Ga0105240_10103917 3300009093 Bacteria 3450
175 Ga0105240_10262917 3300009093 Bacteria 1990
176 Ga0105240_10652148 3300009093 Bacteria 1153
177 Ga0105240_10962847 3300009093 Bacteria 915
178 Ga0105245_10075298 3300009098 Bacteria 3073
179 Ga0105247_10006206 3300009101 Bacteria 7412
180 Ga0114129_10475272 3300009147 Bacteria 1636
181 Ga0105243_10091538 3300009148 Bacteria 2505
182 Ga0105241_10013186 3300009174 Bacteria 6061
183 Ga0105241_10185343 3300009174 Bacteria 1729
184 Ga0105241_10236885 3300009174 Bacteria 1541
185 Ga0105241_10661487 3300009174 Bacteria 950
186 Ga0105241_11180351 3300009174 Bacteria 724
187 Ga0105241_12235018 3300009174 Unclassified 543
188 Ga0105242_11864342 3300009176 Unclassified 641
189 Ga0105248_10006412 3300009177 Bacteria 12909
190 Ga0105248_10263730 3300009177 Bacteria 1939
191 Ga0105237_10000431 3300009545 Bacteria 59607
192 Ga0105237_10041786 3300009545 Bacteria 4623
193 Ga0105237_10048028 3300009545 Bacteria 4291
194 Ga0105237_10059086 3300009545 Bacteria 3837
195 Ga0105237_10118873 3300009545 Bacteria 2637
196 Ga0105237_10322017 3300009545 Bacteria 1550
197 Ga0105237_11397875 3300009545 Unclassified 706
198 Ga0105238_10027104 3300009551 Bacteria 5840
199 Ga0105238_10066644 3300009551 Bacteria 3601
200 Ga0105238_10152529 3300009551 Bacteria 2286
201 Ga0105238_10165538 3300009551 Bacteria 2187
202 Ga0105238_11192913 3300009551 Bacteria 785
203 Ga0099796_10111980 3300010159 Bacteria 1040
204 Ga0105239_10020284 3300010375 Bacteria 7333
205 Ga0105239_10162899 3300010375 Bacteria 2492
206 Ga0105239_10190185 3300010375 Bacteria 2298
207 Ga0105239_10366803 3300010375 Bacteria 1627
208 Ga0105239_10388880 3300010375 Unclassified 1578
209 Ga0105239_10518771 3300010375 Bacteria 1356
210 Ga0105246_10005601 3300011119 Bacteria 7659
211 Ga0105246_10586641 3300011119 Unclassified 961
212 Ga0157335_1014925 3300012492 Bacteria 678
213 Ga0157342_1015969 3300012507 Bacteria 827
214 Ga0157373_10074337 3300013100 Bacteria 2397
215 Ga0157373_10122709 3300013100 Bacteria 1826
216 Ga0157371_10004675 3300013102 Bacteria 11841
217 Ga0157371_10158476 3300013102 Bacteria 1616
218 Ga0157371_10402460 3300013102 Unclassified 1002
219 Ga0157370_10010260 3300013104 Bacteria 9887
220 Ga0157370_10010709 3300013104 Bacteria 9647
221 Ga0157370_10024697 3300013104 Bacteria 5951
222 Ga0157369_10087088 3300013105 Bacteria 3335
223 Ga0157369_10094814 3300013105 Bacteria 3185
224 Ga0157369_10096249 3300013105 Bacteria 3159
225 Ga0157369_10107775 3300013105 Bacteria 2963
226 Ga0157369_10658539 3300013105 Unclassified 1080
227 Ga0157369_10709947 3300013105 Bacteria 1035
228 Ga0157374_10033326 3300013296 Bacteria 4699
229 Ga0157374_10318830 3300013296 Unclassified 1540
230 Ga0157374_10632020 3300013296 Bacteria 1082
231 Ga0163162_10596866 3300013306 Unclassified 1231
232 Ga0163162_10681386 3300013306 Unclassified 1150
233 Ga0157372_10074100 3300013307 Bacteria 3838
234 Ga0157372_10106760 3300013307 Bacteria 3203
235 Ga0157372_10125407 3300013307 Bacteria 2952
236 Ga0157372_11091984 3300013307 Bacteria 923
237 Ga0157375_10207305 3300013308 Bacteria 2117
238 Ga0163163_12656005 3300014325 Unclassified 558
239 Ga0182008_10103285 3300014497 Bacteria 1410
240 Ga0157377_10064923 3300014745 Bacteria 2095
241 Ga0157379_12081839 3300014968 Unclassified 562
242 Ga0157376_10201484 3300014969 Bacteria 1831
243 Ga0157376_10248943 3300014969 Bacteria 1659
244 Ga0157376_11767599 3300014969 Unclassified 654
245 Ga0182006_1172614 3300015261 Bacteria 724
246 Ga0197907_10945116 3300020069 Bacteria 2045
247 Ga0197907_11497267 3300020069 Unclassified 538
248 Ga0206356_10440670 3300020070 Bacteria 1573
249 Ga0206356_11004064 3300020070 Bacteria 2410
250 Ga0206356_11565528 3300020070 Bacteria 755
251 Ga0206356_11575385 3300020070 Bacteria 1656
252 Ga0206356_11610432 3300020070 Bacteria 593
253 Ga0206355_1043589 3300020076 Bacteria 1180
254 Ga0206352_11335040 3300020078 Bacteria 728
255 Ga0206350_10723844 3300020080 Unclassified 1209
256 Ga0206354_10158039 3300020081 Bacteria 1798
257 Ga0206354_11054448 3300020081 Unclassified 1146
258 Ga0206354_11596033 3300020081 Bacteria 796
259 Ga0206353_10598295 3300020082 Bacteria 4556
260 Ga0206353_10682216 3300020082 Bacteria 937
261 Ga0206353_12026389 3300020082 Bacteria 1700
262 Ga0154015_1020453 3300020610 Bacteria 596
263 Ga0213876_10003068 3300021384 Bacteria 9661
264 Ga0213876_10027852 3300021384 Bacteria 2980
265 Ga0213876_10123418 3300021384 Bacteria 1376
266 Ga0213875_10000372 3300021388 Bacteria 41089
267 Ga0224712_10047511 3300022467 Bacteria 1652
268 Ga0224712_10156848 3300022467 Unclassified 1013
269 Ga0224712_10183289 3300022467 Bacteria 944
270 Ga0207656_10036921 3300025321 Bacteria 2053
271 Ga0207656_10052530 3300025321 Bacteria 1765
272 Ga0207692_10364939 3300025898 Bacteria 893
273 Ga0207642_10026343 3300025899 Unclassified 2366
274 Ga0207642_10158632 3300025899 Bacteria 1212
275 Ga0207710_10066370 3300025900 Bacteria 1646
276 Ga0207688_10002541 3300025901 Bacteria 9851
277 Ga0207680_10869450 3300025903 Bacteria 646
278 Ga0207647_10046884 3300025904 Bacteria 2690
279 Ga0207647_10085489 3300025904 Bacteria 1887
280 Ga0207647_10619779 3300025904 Bacteria 595
281 Ga0207685_10037296 3300025905 Bacteria 1789
282 Ga0207685_10045161 3300025905 Unclassified 1669
283 Ga0207699_10176053 3300025906 Bacteria 1435
284 Ga0207699_10526828 3300025906 Unclassified 855
285 Ga0207645_10031262 3300025907 Bacteria 3427
286 Ga0207643_10001055 3300025908 Bacteria 16310
287 Ga0207705_10056274 3300025909 Bacteria 2835
288 Ga0207705_10643755 3300025909 Bacteria 824
289 Ga0207684_10130365 3300025910 Bacteria 2158
290 Ga0207684_10406807 3300025910 Bacteria 1170
291 Ga0207654_10076824 3300025911 Bacteria 2000
292 Ga0207707_10000798 3300025912 Bacteria 30868
293 Ga0207707_10008078 3300025912 Bacteria 9135
294 Ga0207707_10123728 3300025912 Bacteria 2262
295 Ga0207707_10504911 3300025912 Bacteria 1031
296 Ga0207707_11622124 3300025912 Unclassified 509
297 Ga0207695_10073738 3300025913 Bacteria 3477
298 Ga0207695_10543841 3300025913 Bacteria 1043
299 Ga0207695_10562238 3300025913 Bacteria 1022
300 Ga0207671_10003870 3300025914 Bacteria 14631
301 Ga0207671_10073956 3300025914 Bacteria 2546
302 Ga0207671_10096589 3300025914 Bacteria 2233
303 Ga0207693_10000001 3300025915 Bacteria 469535
304 Ga0207693_10033818 3300025915 Unclassified 4032
305 Ga0207693_10616637 3300025915 Unclassified 844
306 Ga0207663_10145357 3300025916 Bacteria 1657
307 Ga0207663_10622881 3300025916 Unclassified 850
308 Ga0207663_11187447 3300025916 Bacteria 614
309 Ga0207663_11597364 3300025916 Unclassified 525
310 Ga0207660_10001508 3300025917 Bacteria 15680
311 Ga0207660_10006117 3300025917 Bacteria 7811
312 Ga0207660_10422622 3300025917 Bacteria 1075
313 Ga0207660_10436486 3300025917 Bacteria 1058
314 Ga0207662_10092622 3300025918 Bacteria 1861
315 Ga0207657_10013235 3300025919 Bacteria 8096
316 Ga0207657_10030617 3300025919 Bacteria 4883
317 Ga0207657_10088438 3300025919 Bacteria 2589
318 Ga0207649_10011601 3300025920 Bacteria 4864
319 Ga0207649_10072721 3300025920 Bacteria 2201
320 Ga0207649_10090378 3300025920 Unclassified 2004
321 Ga0207649_10365928 3300025920 Bacteria 1071
322 Ga0207652_10000412 3300025921 Bacteria 44366
323 Ga0207652_10000802 3300025921 Bacteria 30011
324 Ga0207652_10027531 3300025921 Bacteria 4737
325 Ga0207652_10202070 3300025921 Bacteria 1788
326 Ga0207652_10629846 3300025921 Bacteria 960
327 Ga0207652_11033740 3300025921 Unclassified 721
328 Ga0207646_10666162 3300025922 Bacteria 932
329 Ga0207694_10058809 3300025924 Bacteria 2990
330 Ga0207694_10151960 3300025924 Bacteria 1866
331 Ga0207694_10232967 3300025924 Unclassified 1504
332 Ga0207650_10247525 3300025925 Bacteria 1442
333 Ga0207659_10034790 3300025926 Bacteria 3477
334 Ga0207687_10065660 3300025927 Bacteria 2577
335 Ga0207687_10834463 3300025927 Bacteria 787
336 Ga0207700_10079042 3300025928 Bacteria 2560
337 Ga0207700_10389082 3300025928 Unclassified 1220
338 Ga0207700_11043043 3300025928 Bacteria 731
339 Ga0207700_11126628 3300025928 Unclassified 701
340 Ga0207664_10000778 3300025929 Bacteria 21525
341 Ga0207664_10100894 3300025929 Bacteria 2384
342 Ga0207664_10543438 3300025929 Unclassified 1042
343 Ga0207664_11399235 3300025929 Bacteria 620
344 Ga0207644_10006498 3300025931 Bacteria 7621
345 Ga0207644_11332203 3300025931 Unclassified 603
346 Ga0207690_10016448 3300025932 Bacteria 4500
347 Ga0207690_10071975 3300025932 Bacteria 2386
348 Ga0207690_10235730 3300025932 Bacteria 1407
349 Ga0207706_10152776 3300025933 Bacteria 2030
350 Ga0207706_10614786 3300025933 Unclassified 932
351 Ga0207686_10540711 3300025934 Bacteria 909
352 Ga0207670_10006234 3300025936 Bacteria 6603
353 Ga0207669_10046155 3300025937 Bacteria 2572
354 Ga0207669_11053146 3300025937 Unclassified 685
355 Ga0207665_10093789 3300025939 Bacteria 2084
356 Ga0207665_10130305 3300025939 Bacteria 1784
357 Ga0207665_10149338 3300025939 Bacteria 1673
358 Ga0207691_10015445 3300025940 Bacteria 7261
359 Ga0207711_10030349 3300025941 Bacteria 4559
360 Ga0207711_10208103 3300025941 Bacteria 1787
361 Ga0207689_10000708 3300025942 Bacteria 31948
362 Ga0207661_10001919 3300025944 Bacteria 14271
363 Ga0207661_10061435 3300025944 Bacteria 3035
364 Ga0207661_10284928 3300025944 Bacteria 1477
365 Ga0207661_10416533 3300025944 Bacteria 1220
366 Ga0207661_10428497 3300025944 Bacteria 1202
367 Ga0207661_10437658 3300025944 Unclassified 1189
368 Ga0207661_10532482 3300025944 Bacteria 1075
369 Ga0207661_10674409 3300025944 Bacteria 950
370 Ga0207679_10014099 3300025945 Bacteria 5245
371 Ga0207667_10017863 3300025949 Bacteria 7972
372 Ga0207667_10054633 3300025949 Bacteria 4200
373 Ga0207667_10190314 3300025949 Bacteria 2105
374 Ga0207651_10333038 3300025960 Bacteria 1273
375 Ga0207668_10328406 3300025972 Bacteria 1272
376 Ga0207640_10172726 3300025981 Bacteria 1612
377 Ga0207640_10596323 3300025981 Bacteria 934
378 Ga0207640_10893290 3300025981 Bacteria 776
379 Ga0207658_10131321 3300025986 Bacteria 2012
380 Ga0207658_10939703 3300025986 Bacteria 788
381 Ga0207677_10172632 3300026023 Bacteria 1692
382 Ga0207677_10251576 3300026023 Bacteria 1435
383 Ga0207639_10076332 3300026041 Bacteria 2638
384 Ga0207639_10451424 3300026041 Bacteria 1167
385 Ga0207639_11251475 3300026041 Bacteria 696
386 Ga0207678_10000678 3300026067 Bacteria 31147
387 Ga0207678_10005062 3300026067 Bacteria 11822
388 Ga0207708_10018251 3300026075 Bacteria 5281
389 Ga0207708_10143496 3300026075 Unclassified 1875
390 Ga0207702_10001500 3300026078 Bacteria 23073
391 Ga0207702_10006613 3300026078 Bacteria 9970
392 Ga0207702_10152015 3300026078 Bacteria 2106
393 Ga0207702_12023540 3300026078 Bacteria 566
394 Ga0207641_10022836 3300026088 Bacteria 5152
395 Ga0207676_10003065 3300026095 Bacteria 11920
396 Ga0207674_10011322 3300026116 Bacteria 10024
397 Ga0207674_10179789 3300026116 Bacteria 2067
398 Ga0207674_11598979 3300026116 Bacteria 620
399 Ga0207675_100187629 3300026118 Bacteria 1982
400 Ga0207675_101839872 3300026118 Bacteria 624
401 Ga0207683_10001770 3300026121 Bacteria 19122
402 Ga0207683_10661245 3300026121 Bacteria 968
403 Ga0207698_10009446 3300026142 Bacteria 6221
404 Ga0207698_10152588 3300026142 Bacteria 2007
405 Ga0207698_10276329 3300026142 Bacteria 1551
406 Ga0207698_11257545 3300026142 Bacteria 755
407 Ga0207698_11260511 3300026142 Bacteria 754
408 Ga0209179_1027110 3300027512 Bacteria 1153
409 Ga0207428_10061392 3300027907 Bacteria 2976
410 Ga0268266_10003874 3300028379 Bacteria 14581
411 Ga0268266_10098073 3300028379 Bacteria 2578
412 Ga0268266_10421802 3300028379 Bacteria 1264
413 Ga0268266_11289339 3300028379 Unclassified 706
414 Ga0268265_10536192 3300028380 Bacteria 1109
415 Ga0268264_10808089 3300028381 Bacteria 937
416 Ga0307413_11086023 3300031824 Bacteria 690
417 Ga0307409_100347047 3300031995 Unclassified 1399
418 Ga0307415_100055564 3300032126 Bacteria 2710
419 Ga0307415_100207537 3300032126 Bacteria 1560
420 Ga0373926_0039397 3300035083 Bacteria 1684
421 Ga0373926_0106256 3300035083 Bacteria 1053
422 Ga0373944_0004991 3300035089 Bacteria 3481
423 Ga0373923_0085041 3300035111 Bacteria 1376
424 Ga0373932_0377400 3300035112 Unclassified 544
425 Ga0373936_0001416 3300035113 Bacteria 8719
426 Ga0373936_0023688 3300035113 Bacteria 2394
427 Ga0373945_0000322 3300035116 Bacteria 13649
428 Ga0373945_0526815 3300035116 Bacteria 528
429 Ga0373953_0003397 3300035117 Bacteria 4951
430 Ga0373954_0291535 3300035118 Bacteria 804
431 Ga0373956_0016029 3300035119 Bacteria 3142
432 Ga0373957_0003429 3300035120 Bacteria 4685
433 Ga0373960_0239036 3300035121 Bacteria 656
434 Ga0373943_0007226 3300035170 Bacteria 4983
435 Ga0373946_0044755 3300035171 Bacteria 1828
436 Ga0373955_0036865 3300035172 Bacteria 2597
437 Ga0373955_0111523 3300035172 Bacteria 1582
438 Ga0373955_0431693 3300035172 Unclassified 802
439 Ga0373961_0200731 3300035241 Bacteria 703
440 Ga0373962_0313172 3300035242 Bacteria 559
441 Ga0373924_0014859 3300035410 Bacteria 2947
442 Ga0373924_0181056 3300035410 Bacteria 927
443 Ga0373931_0019717 3300035691 Bacteria 3369
444 Ga0373935_0001388 3300035692 Bacteria 13386
445 Ga0373935_0052905 3300035692 Bacteria 2582
446 Ga0373927_0002855 3300035695 Bacteria 12594
447 Ga0373927_0393999 3300035695 Bacteria 913
448 Ga0373927_0980996 3300035695 Bacteria 557
449 Ga0373933_0797276 3300035724 Bacteria 622
450 Ga0373947_0001825 3300035725 Bacteria 13026
451 Ga0373947_0132535 3300035725 Bacteria 1592
452 Ga0373937_0184384 3300036401 Bacteria 1960
453 Ga0373937_0245980 3300036401 Bacteria 1685
454 Ga0373925_0031273 3300037068 Bacteria 3910
455 Ga0373925_0087327 3300037068 Bacteria 2380
456 Ga0373925_0112986 3300037068 Bacteria 2100
457 Ga0373925_0274201 3300037068 Bacteria 1357
458 Ga0395900_0153125 3300037418 Bacteria 2355
459 Ga0395898_0004157 3300037466 Bacteria 15877
460 Ga0395898_0170429 3300037466 Bacteria 2081
461 Ga0395905_0050846 3300037471 Bacteria 3882
462 Ga0436364_1205415 3300037853 Bacteria 3692
463 Ga0436364_1511050 3300037853 Bacteria 66595
464 Ga0395901_0085959 3300038443 Bacteria 3288
465 Ga0395901_0228419 3300038443 Bacteria 1944
466 Ga0395901_1456493 3300038443 Bacteria 642
467 Ga0242420_162430 3300038996 Bacteria 506
468 Ga0436365_0269075 3300039437 Bacteria 6389
469 Ga0436365_0696108 3300039437 Bacteria 18390
470 Ga0436365_1526623 3300039437 Bacteria 2670
471 Ga0436365_1760587 3300039437 Unclassified 609
472 Ga0436365_1763225 3300039437 Unclassified 2231
473 Ga0436363_1019899 3300039450 Bacteria 908
474 Ga0439448_0012929 3300042005 Bacteria 2504
475 Ga0439458_0216288 3300042157 Bacteria 527
476 Ga0439459_0002289 3300042438 Bacteria 2936
477 Ga0466969_0059763 3300044656 Bacteria 1853
478 Ga0466972_0169321 3300044658 Unclassified 1025
479 Ga0466966_0024387 3300044684 Bacteria 3956
480 Ga0466961_0017861 3300044693 Bacteria 4560
481 Ga0466961_0042573 3300044693 Bacteria 2911
482 Ga0466961_0651365 3300044693 Bacteria 632
483 Ga0466963_0032573 3300044694 Bacteria 3377
484 Ga0466963_0340886 3300044694 Bacteria 1055
485 Ga0466963_0377094 3300044694 Bacteria 1000
486 Ga0466963_0748576 3300044694 Bacteria 689
487 Ga0466964_0212003 3300044706 Unclassified 936
488 Ga0466964_0565304 3300044706 Bacteria 619
489 Ga0466971_0003213 3300044719 Bacteria 6969
490 Ga0466971_0221357 3300044719 Bacteria 897
491 Ga0466968_0559467 3300044735 Unclassified 574
492 Ga0466968_0598812 3300044735 Bacteria 556
493 Ga0466959_0219097 3300045049 Bacteria 1320
494 Ga0466959_0725461 3300045049 Archaea 666
495 Ga0466958_0020079 3300045836 Bacteria 3895
496 Ga0466958_0032123 3300045836 Bacteria 3122
497 Ga0466958_0095830 3300045836 Bacteria 1840
498 Ga0466967_0003362 3300045976 Bacteria 10406
499 Ga0466967_0003925 3300045976 Bacteria 9878
500 Ga0466967_0007930 3300045976 Bacteria 7723
501 Ga0466967_0138314 3300045976 Bacteria 2266
502 Ga0466967_0150199 3300045976 Bacteria 2177
503 Ga0466967_0187894 3300045976 Bacteria 1951
504 Ga0466967_0201528 3300045976 Bacteria 1885
505 Ga0466967_0831682 3300045976 Unclassified 917
506 Ga0466967_0843493 3300045976 Unclassified 910
507 Ga0466967_1584739 3300045976 Bacteria 652
508 Ga0495603_0195040 3300046455 Bacteria 1171
509 Ga0495629_0068008 3300046459 Bacteria 2485
510 Ga0495629_0483866 3300046459 Bacteria 836
511 Ga0495641_0016250 3300046461 Bacteria 3928
512 Ga0495641_0034906 3300046461 Bacteria 2374
513 Ga0495651_0020085 3300046462 Bacteria 5184
514 Ga0495651_0167721 3300046462 Bacteria 1567
515 Ga0495653_0055308 3300046463 Bacteria 3028
516 Ga0495653_0074089 3300046463 Bacteria 2538
517 Ga0495653_0880739 3300046463 Unclassified 534
518 Ga0495580_0397385 3300046472 Bacteria 930
519 Ga0495582_0002876 3300046473 Bacteria 9626
520 Ga0495582_0212711 3300046473 Bacteria 1105
521 Ga0495582_0568352 3300046473 Bacteria 656
522 Ga0495639_0018327 3300046475 Bacteria 3047
523 Ga0495639_0108682 3300046475 Unclassified 1314
524 Ga0495662_0019397 3300046476 Bacteria 3288
525 Ga0495662_0045733 3300046476 Bacteria 2113
526 Ga0495664_0002450 3300046477 Bacteria 9984
527 Ga0495664_0052571 3300046477 Bacteria 2421
528 Ga0495664_0079993 3300046477 Bacteria 1958
529 Ga0495606_0000072 3300046507 Bacteria 173678
530 Ga0495608_0042303 3300046511 Bacteria 3046
531 Ga0495608_0114171 3300046511 Bacteria 1734
532 Ga0495608_0848705 3300046511 Archaea 537
533 Ga0495618_0047239 3300046514 Bacteria 2717
534 Ga0495618_0706959 3300046514 Unclassified 592
535 Ga0495628_0041347 3300046516 Bacteria 3679
536 Ga0495628_0369597 3300046516 Bacteria 1052
537 Ga0495628_0725432 3300046516 Bacteria 700
538 Ga0495630_0000012 3300046517 Bacteria 223330
539 Ga0495630_0040582 3300046517 Bacteria 3479
540 Ga0495630_0100853 3300046517 Bacteria 2184
541 Ga0495666_0025471 3300046526 Bacteria 2921
542 Ga0495652_0052505 3300046529 Bacteria 3476
543 Ga0495652_0175807 3300046529 Bacteria 1648
544 Ga0495652_0291496 3300046529 Bacteria 1190
545 Ga0495665_0001745 3300046531 Bacteria 11689
546 Ga0495665_0028357 3300046531 Bacteria 3002
547 Ga0495640_0006215 3300046533 Bacteria 9454
548 Ga0495640_0176935 3300046533 Bacteria 1361
549 Ga0495586_0003691 3300046535 Bacteria 8207
550 Ga0495586_0332231 3300046535 Bacteria 872
551 Ga0495587_0026804 3300046536 Bacteria 3510
552 Ga0495645_0189180 3300046543 Bacteria 1404
553 Ga0495645_0211511 3300046543 Bacteria 1309
554 Ga0495645_0262772 3300046543 Bacteria 1142
555 Ga0495667_0059057 3300046559 Bacteria 2517
556 Ga0495634_0211704 3300046642 Bacteria 1199
557 Ga0495634_0504485 3300046642 Bacteria 709
558 Ga0495635_0024877 3300046663 Bacteria 4172
559 Ga0495635_0161383 3300046663 Bacteria 1525
560 Ga0495635_0280850 3300046663 Bacteria 1118
561 Ga0495588_0464983 3300046674 Archaea 663
562 Ga0495657_0005434 3300046675 Bacteria 10089
563 Ga0495657_0079152 3300046675 Bacteria 2129
564 Ga0495657_0384091 3300046675 Bacteria 828
565 Ga0495599_0026464 3300046678 Bacteria 3635
566 Ga0495599_0298953 3300046678 Bacteria 972
567 Ga0495599_0481386 3300046678 Unclassified 732
568 Ga0495646_0084132 3300046680 Bacteria 1847
569 Ga0495658_0222203 3300046683 Bacteria 1183
570 Ga0495613_0032515 3300046689 Bacteria 3876
571 Ga0495613_0451996 3300046689 Bacteria 870
572 Ga0495613_0583601 3300046689 Unclassified 745
573 Ga0495624_0020055 3300046690 Bacteria 4454
574 Ga0495624_0046372 3300046690 Bacteria 2763
575 Ga0495624_0782025 3300046690 Unclassified 565
576 Ga0495600_0008278 3300046809 Bacteria 6383
577 Ga0495600_0347778 3300046809 Bacteria 929
578 Ga0495581_0011873 3300047315 Bacteria 5041
579 Ga0495604_0073009 3300047317 Bacteria 2591
580 Ga0495674_0000950 3300047319 Bacteria 27650
581 Ga0495674_0100208 3300047319 Bacteria 2465
582 Ga0495674_0662663 3300047319 Bacteria 822
583 Ga0495672_0070562 3300047320 Bacteria 1979
584 Ga0495676_0315349 3300047321 Bacteria 1051
585 Ga0495676_0575681 3300047321 Bacteria 735
586 Ga0495680_0007738 3300047322 Bacteria 9814
587 Ga0495680_0057875 3300047322 Bacteria 2996
588 Ga0495680_0370716 3300047322 Bacteria 993
589 Ga0495675_0323080 3300047444 Bacteria 912
590 Ga0495675_0399069 3300047444 Unclassified 802
591 Ga0495684_0043342 3300047471 Bacteria 3445
592 Ga0495684_0135336 3300047471 Bacteria 1849
593 Ga0495684_0335123 3300047471 Bacteria 1078
594 Ga0495593_0001519 3300047673 Bacteria 13648
595 Ga0495593_0099781 3300047673 Bacteria 1490
596 Ga0495593_0167030 3300047673 Bacteria 1110
597 Ga0495602_0072788 3300048088 Bacteria 2928
598 Ga0495614_0403498 3300048089 Bacteria 642
599 Ga0496100_0138840 3300048903 Unclassified 1720
600 Ga0496100_0431138 3300048903 Bacteria 1008
601 Ga0496100_0475623 3300048903 Unclassified 960
602 Ga0496101_0007793 3300048904 Bacteria 6960
603 Ga0496101_0028460 3300048904 Bacteria 3901
604 Ga0496101_0487118 3300048904 Bacteria 974
605 Ga0496101_0573188 3300048904 Bacteria 892
606 Ga0496102_0014198 3300048905 Bacteria 6920
607 Ga0496102_0040050 3300048905 Bacteria 4237
608 Ga0496102_0059205 3300048905 Bacteria 3502
609 Ga0496102_0320742 3300048905 Bacteria 1459
610 Ga0496102_0955857 3300048905 Unclassified 778
611 Ga0496103_0193950 3300048906 Bacteria 1306
612 Ga0496104_0003652 3300048907 Bacteria 13289
613 Ga0496104_0048196 3300048907 Bacteria 4017
614 Ga0496104_0192241 3300048907 Bacteria 1953
615 Ga0496105_0003444 3300048908 Bacteria 11718
616 Ga0496105_0155634 3300048908 Bacteria 1877
617 Ga0496106_0430244 3300048909 Bacteria 1061
618 Ga0496107_0034574 3300048910 Bacteria 3620
619 Ga0496107_0125582 3300048910 Bacteria 1892
620 Ga0496107_1255991 3300048910 Bacteria 531
621 Ga0496108_0011106 3300048911 Bacteria 7314
622 Ga0496108_0124429 3300048911 Bacteria 2213
623 Ga0496108_0274898 3300048911 Unclassified 1466
624 Ga0496108_0367890 3300048911 Bacteria 1255
625 Ga0496108_1073427 3300048911 Bacteria 685
626 Ga0496109_0001465 3300048912 Bacteria 19579
627 Ga0496109_0021563 3300048912 Bacteria 5698
628 Ga0496109_0203799 3300048912 Bacteria 1860
629 Ga0496109_0229947 3300048912 Unclassified 1744
630 Ga0496109_0264757 3300048912 Bacteria 1619
631 Ga0496109_1716844 3300048912 Unclassified 561
632 Ga0496110_0012296 3300048913 Bacteria 7036
633 Ga0496110_0148886 3300048913 Unclassified 2118
634 Ga0496110_0527484 3300048913 Bacteria 1074
635 Ga0496110_0690947 3300048913 Bacteria 921
636 Ga0496111_0003865 3300048914 Bacteria 9364
637 Ga0496111_0111084 3300048914 Bacteria 2019
638 Ga0496111_0192185 3300048914 Bacteria 1517
639 Ga0496111_0768797 3300048914 Unclassified 698
640 Ga0496111_0803148 3300048914 Bacteria 681
641 Ga0496112_0000223 3300048915 Bacteria 36875
642 Ga0496112_0119499 3300048915 Bacteria 2605
643 Ga0496112_0365136 3300048915 Bacteria 1385
644 Ga0496112_0508349 3300048915 Bacteria 1140
645 Ga0496112_1785174 3300048915 Unclassified 527
646 Ga0496113_0019066 3300048916 Bacteria 4792
647 Ga0496113_0039429 3300048916 Bacteria 3476
648 Ga0496113_0185102 3300048916 Bacteria 1651
649 Ga0496114_0003593 3300048917 Bacteria 11918
650 Ga0496114_0023615 3300048917 Bacteria 5019
651 Ga0496114_0030724 3300048917 Bacteria 4420
652 Ga0496114_0043024 3300048917 Bacteria 3745
653 Ga0496115_0006669 3300048918 Bacteria 8471
654 Ga0496115_0040341 3300048918 Bacteria 3711
655 Ga0496115_0084410 3300048918 Bacteria 2589
656 Ga0496117_0428154 3300048920 Unclassified 660
657 Ga0496118_0073155 3300048921 Unclassified 2457
658 Ga0496119_0002281 3300048922 Bacteria 21246
659 Ga0496120_0260269 3300048923 Unclassified 810
660 Ga0501034_1691166 3300049571 Bacteria 505
661 Ga0501036_0599222 3300049572 Bacteria 914
662 Ga0501047_0330285 3300049581 Bacteria 1363
663 Ga0501067_0532668 3300049583 Bacteria 657
664 Ga0501069_0000282 3300049585 Bacteria 23137
665 Ga0501069_0217153 3300049585 Bacteria 1110
666 Ga0501070_0013213 3300049586 Bacteria 6960
667 Ga0501070_0077086 3300049586 Bacteria 2759
668 Ga0501070_0693901 3300049586 Bacteria 805
669 Ga0501074_0309780 3300049590 Bacteria 1121
670 Ga0501076_1510791 3300049592 Unclassified 551
671 Ga0501077_0776441 3300049593 Bacteria 616
672 Ga0501079_0513983 3300049741 Bacteria 942
673 Ga0501081_0433927 3300049743 Bacteria 975
674 Ga0501083_0317020 3300049744 Bacteria 1014
675 Ga0501035_0123223 3300049822 Bacteria 2264
676 Ga0501044_0034408 3300049823 Bacteria 5314
677 nmdc:mga03683_42793_c1 3300050489 Bacteria 1865
678 nmdc:mga0yw44_11369_c1 3300050492 Bacteria 4590
679 nmdc:mga06r32_24217_c1 3300050510 Bacteria 5630
680 nmdc:mga08y16_147269_c1 3300050511 Bacteria 2448
681 nmdc:mga08y16_52930_c1 3300050511 Bacteria 4245
682 nmdc:mga0n895_1009659_c1 3300050512 Bacteria 813
683 nmdc:mga0n895_193714_c1 3300050512 Bacteria 2064
684 nmdc:mga0n895_30643_c1 3300050512 Bacteria 5143
685 nmdc:mga0n895_5571_c1 3300050512 Bacteria 10543
686 nmdc:mga0rr50_120485_c1 3300050513 Bacteria 2088
687 nmdc:mga0rr50_1421086_c1 3300050513 Bacteria 587
688 nmdc:mga0rr50_286568_c1 3300050513 Bacteria 1375
689 nmdc:mga0rr50_434647_c1 3300050513 Bacteria 1111
690 nmdc:mga08x19_267178_c1 3300050514 Unclassified 1183
691 nmdc:mga08x19_562736_c1 3300050514 Unclassified 807
692 nmdc:mga08x19_769993_c1 3300050514 Bacteria 683
693 nmdc:mga0a205_23629_c1 3300050515 Bacteria 5830
694 Ga0495601_0019317 3300053077 Bacteria 4155
695 Ga0495601_0938365 3300053077 Unclassified 546
696 Ga0495612_0009518 3300053078 Bacteria 3938
697 Ga0495612_0212510 3300053078 Bacteria 855
698 Ga0495595_0069736 3300053084 Bacteria 1660
699 Ga0495595_0460014 3300053084 Bacteria 647
700 Ga0495619_0001433 3300053085 Bacteria 15681
701 Ga0495619_0327816 3300053085 Bacteria 1060
702 Ga0500599_005577 3300053736 Bacteria 1585
703 Ga0466962_0003291 3300061719 Bacteria 7676
704 Ga0530510_0267547 3300061734 Bacteria 1275

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10027852 Ga0213876_100278525 123
2 3300039437 Ga0436365_0269075 Ga0436365_0269075_2772_3215 123
3 3300005471 Ga0070698_100560259 Ga0070698_1005602592 125
4 3300049583 Ga0501067_0532668 Ga0501067_0532668_29_415 125
5 3300026078 Ga0207702_12023540 Ga0207702_120235401 127
6 3300035172 Ga0373955_0111523 Ga0373955_0111523_1171_1572 128
7 3300038996 Ga0242420_162430 Ga0242420_162430_10_411 128
8 3300005548 Ga0070665_100192635 Ga0070665_1001926352 129
9 3300028379 Ga0268266_10003874 Ga0268266_1000387424 129
10 3300005455 Ga0070663_100000144 Ga0070663_10000014410 131
11 3300005458 Ga0070681_10853983 Ga0070681_108539831 131
12 3300005530 Ga0070679_100015682 Ga0070679_10001568210 131
13 3300025921 Ga0207652_10000412 Ga0207652_1000041254 131
14 3300025944 Ga0207661_10674409 Ga0207661_106744092 131
15 3300026067 Ga0207678_10005062 Ga0207678_100050625 131
16 3300049572 Ga0501036_0599222 Ga0501036_0599222_164_577 131
17 3300049592 Ga0501076_1510791 Ga0501076_1510791_121_534 131
18 3300049743 Ga0501081_0433927 Ga0501081_0433927_27_440 131
19 iso_pu_bacteria 2558860112 2558910622 132
20 3300005329 Ga0070683_100014900 Ga0070683_1000149005 133
21 3300005458 Ga0070681_10133876 Ga0070681_101338762 133
22 3300005530 Ga0070679_100623173 Ga0070679_1006231732 133
23 3300005535 Ga0070684_100071244 Ga0070684_1000712445 133
24 3300013105 Ga0157369_10087088 Ga0157369_100870882 133
25 3300032126 Ga0307415_100207537 Ga0307415_1002075372 133
26 3300005327 Ga0070658_10027933 Ga0070658_100279336 134
27 3300005328 Ga0070676_10056059 Ga0070676_100560592 134
28 3300005329 Ga0070683_100237568 Ga0070683_1002375682 134
29 3300005330 Ga0070690_100094889 Ga0070690_1000948893 134
30 3300005331 Ga0070670_100219618 Ga0070670_1002196184 134
31 3300005334 Ga0068869_100039143 Ga0068869_1000391432 134
32 3300005335 Ga0070666_10155703 Ga0070666_101557033 134
33 3300005335 Ga0070666_10180460 Ga0070666_101804601 134
34 3300005337 Ga0070682_100024397 Ga0070682_1000243974 134
35 3300005338 Ga0068868_100022330 Ga0068868_1000223302 134
36 3300005339 Ga0070660_100208875 Ga0070660_1002088754 134
37 3300005340 Ga0070689_100007258 Ga0070689_1000072588 134
38 3300005341 Ga0070691_10048363 Ga0070691_100483632 134
39 3300005344 Ga0070661_100029994 Ga0070661_1000299945 134
40 3300005345 Ga0070692_10001194 Ga0070692_100011943 134
41 3300005355 Ga0070671_100022184 Ga0070671_1000221847 134
42 3300005356 Ga0070674_100884564 Ga0070674_1008845642 134
43 3300005364 Ga0070673_100042817 Ga0070673_1000428172 134
44 3300005367 Ga0070667_100853462 Ga0070667_1008534622 134
45 3300005406 Ga0070703_10166730 Ga0070703_101667302 134
46 3300005434 Ga0070709_10002975 Ga0070709_100029756 134
47 3300005434 Ga0070709_10447888 Ga0070709_104478882 134
48 3300005435 Ga0070714_100279211 Ga0070714_1002792112 134
49 3300005436 Ga0070713_100004650 Ga0070713_1000046504 134
50 3300005437 Ga0070710_10379480 Ga0070710_103794802 134
51 3300005438 Ga0070701_11243766 Ga0070701_112437661 134
52 3300005439 Ga0070711_100383181 Ga0070711_1003831812 134
53 3300005439 Ga0070711_101150953 Ga0070711_1011509531 134
54 3300005439 Ga0070711_101391751 Ga0070711_1013917511 134
55 3300005441 Ga0070700_100201616 Ga0070700_1002016161 134
56 3300005455 Ga0070663_100023438 Ga0070663_1000234382 134
57 3300005456 Ga0070678_100003038 Ga0070678_10000303810 134
58 3300005457 Ga0070662_100295286 Ga0070662_1002952863 134
59 3300005458 Ga0070681_10078231 Ga0070681_100782313 134
60 3300005467 Ga0070706_100184362 Ga0070706_1001843622 134
61 3300005468 Ga0070707_100161746 Ga0070707_1001617463 134
62 3300005471 Ga0070698_100005777 Ga0070698_1000057771 134
63 3300005518 Ga0070699_100366404 Ga0070699_1003664042 134
64 3300005530 Ga0070679_100190945 Ga0070679_1001909452 134
65 3300005530 Ga0070679_101166119 Ga0070679_1011661191 134
66 3300005535 Ga0070684_100750595 Ga0070684_1007505952 134
67 3300005536 Ga0070697_102090157 Ga0070697_1020901571 134
68 3300005539 Ga0068853_100028168 Ga0068853_1000281683 134
69 3300005544 Ga0070686_100042982 Ga0070686_1000429824 134
70 3300005546 Ga0070696_100262156 Ga0070696_1002621562 134
71 3300005546 Ga0070696_100628620 Ga0070696_1006286201 134
72 3300005547 Ga0070693_100002404 Ga0070693_1000024048 134
73 3300005548 Ga0070665_100068119 Ga0070665_1000681193 134
74 3300005549 Ga0070704_100179008 Ga0070704_1001790081 134
75 3300005563 Ga0068855_100619163 Ga0068855_1006191632 134
76 3300005577 Ga0068857_100564758 Ga0068857_1005647582 134
77 3300005578 Ga0068854_100126579 Ga0068854_1001265794 134
78 3300005614 Ga0068856_100044737 Ga0068856_1000447372 134
79 3300005615 Ga0070702_100004197 Ga0070702_1000041979 134
80 3300005616 Ga0068852_100154339 Ga0068852_1001543392 134
81 3300005617 Ga0068859_100179367 Ga0068859_1001793673 134
82 3300005618 Ga0068864_100072812 Ga0068864_1000728122 134
83 3300005718 Ga0068866_11118809 Ga0068866_111188091 134
84 3300005719 Ga0068861_100739580 Ga0068861_1007395802 134
85 3300005834 Ga0068851_10045306 Ga0068851_100453061 134
86 3300005840 Ga0068870_10011849 Ga0068870_100118493 134
87 3300005841 Ga0068863_100023339 Ga0068863_1000233393 134
88 3300005841 Ga0068863_100132270 Ga0068863_1001322701 134
89 3300005842 Ga0068858_100129331 Ga0068858_1001293313 134
90 3300005843 Ga0068860_100380938 Ga0068860_1003809382 134
91 3300005937 Ga0081455_10000542 Ga0081455_1000054234 134
92 3300006028 Ga0070717_10030258 Ga0070717_100302584 134
93 3300006028 Ga0070717_10226736 Ga0070717_102267362 134
94 3300006028 Ga0070717_10586644 Ga0070717_105866442 134
95 3300006058 Ga0075432_10004310 Ga0075432_100043105 134
96 3300006173 Ga0070716_100378839 Ga0070716_1003788392 134
97 3300006173 Ga0070716_100900409 Ga0070716_1009004092 134
98 3300006175 Ga0070712_100000007 Ga0070712_100000007139 134
99 3300006237 Ga0097621_100015785 Ga0097621_1000157856 134
100 3300006358 Ga0068871_100014196 Ga0068871_1000141966 134
101 3300006844 Ga0075428_100241925 Ga0075428_1002419252 134
102 3300006847 Ga0075431_100008020 Ga0075431_1000080209 134
103 3300006852 Ga0075433_10231808 Ga0075433_102318083 134
104 3300006871 Ga0075434_100000742 Ga0075434_1000007423 134
105 3300006871 Ga0075434_101134826 Ga0075434_1011348261 134
106 3300006880 Ga0075429_100164136 Ga0075429_1001641362 134
107 3300006914 Ga0075436_100014930 Ga0075436_1000149305 134
108 3300006931 Ga0097620_100179370 Ga0097620_1001793702 134
109 3300007076 Ga0075435_100007053 Ga0075435_1000070539 134
110 3300007076 Ga0075435_100071170 Ga0075435_1000711705 134
111 3300007076 Ga0075435_100169397 Ga0075435_1001693972 134
112 3300007076 Ga0075435_100361986 Ga0075435_1003619862 134
113 3300009011 Ga0105251_10175895 Ga0105251_101758952 134
114 3300009092 Ga0105250_10186135 Ga0105250_101861351 134
115 3300009093 Ga0105240_10086849 Ga0105240_100868492 134
116 3300009093 Ga0105240_10262917 Ga0105240_102629173 134
117 3300009098 Ga0105245_10075298 Ga0105245_100752984 134
118 3300009101 Ga0105247_10006206 Ga0105247_100062069 134
119 3300009147 Ga0114129_10475272 Ga0114129_104752722 134
120 3300009148 Ga0105243_10091538 Ga0105243_100915382 134
121 3300009174 Ga0105241_10013186 Ga0105241_100131869 134
122 3300009174 Ga0105241_10236885 Ga0105241_102368852 134
123 3300009174 Ga0105241_12235018 Ga0105241_122350181 134
124 3300009176 Ga0105242_11864342 Ga0105242_118643421 134
125 3300009177 Ga0105248_10006412 Ga0105248_1000641214 134
126 3300009545 Ga0105237_10041786 Ga0105237_100417862 134
127 3300009551 Ga0105238_10152529 Ga0105238_101525292 134
128 3300009551 Ga0105238_11192913 Ga0105238_111929132 134
129 3300010375 Ga0105239_10162899 Ga0105239_101628993 134
130 3300010375 Ga0105239_10190185 Ga0105239_101901852 134
131 3300011119 Ga0105246_10005601 Ga0105246_100056013 134
132 3300012492 Ga0157335_1014925 Ga0157335_10149251 134
133 3300012507 Ga0157342_1015969 Ga0157342_10159691 134
134 3300013100 Ga0157373_10122709 Ga0157373_101227092 134
135 3300013102 Ga0157371_10004675 Ga0157371_100046759 134
136 3300013104 Ga0157370_10010260 Ga0157370_100102605 134
137 3300013105 Ga0157369_10709947 Ga0157369_107099471 134
138 3300013307 Ga0157372_11091984 Ga0157372_110919841 134
139 3300013308 Ga0157375_10207305 Ga0157375_102073052 134
140 3300014497 Ga0182008_10103285 Ga0182008_101032852 134
141 3300014745 Ga0157377_10064923 Ga0157377_100649233 134
142 3300014969 Ga0157376_10201484 Ga0157376_102014842 134
143 3300014969 Ga0157376_10248943 Ga0157376_102489432 134
144 3300014969 Ga0157376_11767599 Ga0157376_117675992 134
145 3300020070 Ga0206356_10440670 Ga0206356_104406702 134
146 3300020081 Ga0206354_10158039 Ga0206354_101580393 134
147 3300020610 Ga0154015_1020453 Ga0154015_10204531 134
148 3300022467 Ga0224712_10047511 Ga0224712_100475112 134
149 3300025321 Ga0207656_10036921 Ga0207656_100369212 134
150 3300025898 Ga0207692_10364939 Ga0207692_103649391 134
151 3300025899 Ga0207642_10158632 Ga0207642_101586321 134
152 3300025900 Ga0207710_10066370 Ga0207710_100663701 134
153 3300025901 Ga0207688_10002541 Ga0207688_1000254111 134
154 3300025903 Ga0207680_10869450 Ga0207680_108694502 134
155 3300025904 Ga0207647_10619779 Ga0207647_106197791 134
156 3300025905 Ga0207685_10037296 Ga0207685_100372965 134
157 3300025905 Ga0207685_10045161 Ga0207685_100451611 134
158 3300025906 Ga0207699_10176053 Ga0207699_101760532 134
159 3300025906 Ga0207699_10526828 Ga0207699_105268283 134
160 3300025907 Ga0207645_10031262 Ga0207645_100312622 134
161 3300025908 Ga0207643_10001055 Ga0207643_1000105516 134
162 3300025909 Ga0207705_10643755 Ga0207705_106437552 134
163 3300025910 Ga0207684_10406807 Ga0207684_104068071 134
164 3300025911 Ga0207654_10076824 Ga0207654_100768242 134
165 3300025912 Ga0207707_10123728 Ga0207707_101237282 134
166 3300025912 Ga0207707_10504911 Ga0207707_105049111 134
167 3300025913 Ga0207695_10073738 Ga0207695_100737384 134
168 3300025914 Ga0207671_10096589 Ga0207671_100965892 134
169 3300025915 Ga0207693_10000001 Ga0207693_10000001297 134
170 3300025915 Ga0207693_10033818 Ga0207693_100338182 134
171 3300025916 Ga0207663_10145357 Ga0207663_101453572 134
172 3300025916 Ga0207663_10622881 Ga0207663_106228812 134
173 3300025916 Ga0207663_11597364 Ga0207663_115973641 134
174 3300025917 Ga0207660_10422622 Ga0207660_104226222 134
175 3300025918 Ga0207662_10092622 Ga0207662_100926221 134
176 3300025919 Ga0207657_10030617 Ga0207657_100306178 134
177 3300025920 Ga0207649_10011601 Ga0207649_100116013 134
178 3300025921 Ga0207652_10027531 Ga0207652_100275315 134
179 3300025921 Ga0207652_11033740 Ga0207652_110337402 134
180 3300025924 Ga0207694_10058809 Ga0207694_100588093 134
181 3300025925 Ga0207650_10247525 Ga0207650_102475252 134
182 3300025926 Ga0207659_10034790 Ga0207659_100347904 134
183 3300025927 Ga0207687_10065660 Ga0207687_100656602 134
184 3300025928 Ga0207700_10389082 Ga0207700_103890822 134
185 3300025928 Ga0207700_11126628 Ga0207700_111266281 134
186 3300025929 Ga0207664_10100894 Ga0207664_101008943 134
187 3300025929 Ga0207664_10543438 Ga0207664_105434382 134
188 3300025929 Ga0207664_11399235 Ga0207664_113992351 134
189 3300025931 Ga0207644_10006498 Ga0207644_100064982 134
190 3300025932 Ga0207690_10016448 Ga0207690_100164485 134
191 3300025933 Ga0207706_10152776 Ga0207706_101527762 134
192 3300025934 Ga0207686_10540711 Ga0207686_105407111 134
193 3300025936 Ga0207670_10006234 Ga0207670_100062348 134
194 3300025937 Ga0207669_10046155 Ga0207669_100461553 134
195 3300025937 Ga0207669_11053146 Ga0207669_110531462 134
196 3300025939 Ga0207665_10093789 Ga0207665_100937892 134
197 3300025939 Ga0207665_10130305 Ga0207665_101303052 134
198 3300025939 Ga0207665_10149338 Ga0207665_101493383 134
199 3300025940 Ga0207691_10015445 Ga0207691_100154454 134
200 3300025941 Ga0207711_10030349 Ga0207711_100303492 134
201 3300025942 Ga0207689_10000708 Ga0207689_1000070827 134
202 3300025944 Ga0207661_10001919 Ga0207661_1000191910 134
203 3300025944 Ga0207661_10532482 Ga0207661_105324822 134
204 3300025945 Ga0207679_10014099 Ga0207679_100140991 134
205 3300025949 Ga0207667_10190314 Ga0207667_101903142 134
206 3300025960 Ga0207651_10333038 Ga0207651_103330382 134
207 3300025981 Ga0207640_10172726 Ga0207640_101727262 134
208 3300025986 Ga0207658_10131321 Ga0207658_101313215 134
209 3300025986 Ga0207658_10939703 Ga0207658_109397032 134
210 3300026023 Ga0207677_10172632 Ga0207677_101726322 134
211 3300026023 Ga0207677_10251576 Ga0207677_102515762 134
212 3300026041 Ga0207639_10451424 Ga0207639_104514242 134
213 3300026067 Ga0207678_10000678 Ga0207678_1000067824 134
214 3300026075 Ga0207708_10018251 Ga0207708_100182516 134
215 3300026075 Ga0207708_10143496 Ga0207708_101434964 134
216 3300026078 Ga0207702_10001500 Ga0207702_100015006 134
217 3300026078 Ga0207702_10006613 Ga0207702_100066132 134
218 3300026088 Ga0207641_10022836 Ga0207641_100228367 134
219 3300026095 Ga0207676_10003065 Ga0207676_100030659 134
220 3300026116 Ga0207674_11598979 Ga0207674_115989791 134
221 3300026121 Ga0207683_10001770 Ga0207683_1000177011 134
222 3300026142 Ga0207698_10009446 Ga0207698_100094463 134
223 3300026142 Ga0207698_10276329 Ga0207698_102763292 134
224 3300026142 Ga0207698_11257545 Ga0207698_112575452 134
225 3300027907 Ga0207428_10061392 Ga0207428_100613923 134
226 3300028379 Ga0268266_10098073 Ga0268266_100980733 134
227 3300028379 Ga0268266_10421802 Ga0268266_104218021 134
228 3300028381 Ga0268264_10808089 Ga0268264_108080892 134
229 3300035112 Ga0373932_0377400 Ga0373932_0377400_102_533 134
230 3300035121 Ga0373960_0239036 Ga0373960_0239036_156_587 134
231 3300035242 Ga0373962_0313172 Ga0373962_0313172_23_454 134
232 3300035691 Ga0373931_0019717 Ga0373931_0019717_1434_1865 134
233 3300037418 Ga0395900_0153125 Ga0395900_0153125_1022_1435 134
234 3300037466 Ga0395898_0004157 Ga0395898_0004157_15078_15491 134
235 3300037466 Ga0395898_0170429 Ga0395898_0170429_1612_2025 134
236 3300037471 Ga0395905_0050846 Ga0395905_0050846_1327_1740 134
237 3300038443 Ga0395901_0085959 Ga0395901_0085959_921_1334 134
238 3300038443 Ga0395901_1456493 Ga0395901_1456493_197_610 134
239 3300042005 Ga0439448_0012929 Ga0439448_0012929_363_776 134
240 3300042157 Ga0439458_0216288 Ga0439458_0216288_75_488 134
241 3300042438 Ga0439459_0002289 Ga0439459_0002289_417_830 134
242 3300044658 Ga0466972_0169321 Ga0466972_0169321_11_424 134
243 3300044693 Ga0466961_0042573 Ga0466961_0042573_1670_2083 134
244 3300044735 Ga0466968_0559467 Ga0466968_0559467_32_445 134
245 3300045049 Ga0466959_0725461 Ga0466959_0725461_209_622 134
246 3300045976 Ga0466967_0003925 Ga0466967_0003925_858_1271 134
247 3300045976 Ga0466967_0201528 Ga0466967_0201528_1440_1853 134
248 3300045976 Ga0466967_0831682 Ga0466967_0831682_62_475 134
249 3300047320 Ga0495672_0070562 Ga0495672_0070562_788_1198 134
250 3300048904 Ga0496101_0487118 Ga0496101_0487118_461_874 134
251 3300048904 Ga0496101_0573188 Ga0496101_0573188_140_601 134
252 3300048905 Ga0496102_0059205 Ga0496102_0059205_979_1392 134
253 3300048906 Ga0496103_0193950 Ga0496103_0193950_18_431 134
254 3300048907 Ga0496104_0003652 Ga0496104_0003652_8003_8416 134
255 3300048908 Ga0496105_0003444 Ga0496105_0003444_3455_3868 134
256 3300048910 Ga0496107_1255991 Ga0496107_1255991_15_428 134
257 3300048911 Ga0496108_0011106 Ga0496108_0011106_786_1199 134
258 3300048911 Ga0496108_0124429 Ga0496108_0124429_559_972 134
259 3300048911 Ga0496108_0367890 Ga0496108_0367890_687_1097 134
260 3300048912 Ga0496109_0229947 Ga0496109_0229947_99_509 134
261 3300048912 Ga0496109_0264757 Ga0496109_0264757_623_1036 134
262 3300048913 Ga0496110_0012296 Ga0496110_0012296_6391_6804 134
263 3300048913 Ga0496110_0690947 Ga0496110_0690947_291_704 134
264 3300048914 Ga0496111_0111084 Ga0496111_0111084_362_778 134
265 3300048914 Ga0496111_0192185 Ga0496111_0192185_594_1007 134
266 3300048915 Ga0496112_0000223 Ga0496112_0000223_30517_30930 134
267 3300048915 Ga0496112_0119499 Ga0496112_0119499_1684_2097 134
268 3300048915 Ga0496112_0508349 Ga0496112_0508349_269_682 134
269 3300048916 Ga0496113_0039429 Ga0496113_0039429_2711_3124 134
270 3300048917 Ga0496114_0043024 Ga0496114_0043024_1102_1533 134
271 3300048920 Ga0496117_0428154 Ga0496117_0428154_172_585 134
272 3300048921 Ga0496118_0073155 Ga0496118_0073155_834_1247 134
273 3300048922 Ga0496119_0002281 Ga0496119_0002281_220_633 134
274 3300048923 Ga0496120_0260269 Ga0496120_0260269_230_643 134
275 3300049571 Ga0501034_1691166 Ga0501034_1691166_37_450 134
276 3300049581 Ga0501047_0330285 Ga0501047_0330285_737_1150 134
277 3300049585 Ga0501069_0000282 Ga0501069_0000282_2326_2739 134
278 3300049586 Ga0501070_0013213 Ga0501070_0013213_981_1394 134
279 3300049586 Ga0501070_0077086 Ga0501070_0077086_1707_2120 134
280 3300049590 Ga0501074_0309780 Ga0501074_0309780_663_1076 134
281 3300049741 Ga0501079_0513983 Ga0501079_0513983_495_908 134
282 3300049744 Ga0501083_0317020 Ga0501083_0317020_83_496 134
283 3300049823 Ga0501044_0034408 Ga0501044_0034408_1526_1939 134
284 3300050510 nmdc:mga06r32_24217_c1 nmdc:mga06r32_24217_c1_3461_3874 134
285 3300050511 nmdc:mga08y16_147269_c1 nmdc:mga08y16_147269_c1_1211_1624 134
286 3300050511 nmdc:mga08y16_52930_c1 nmdc:mga08y16_52930_c1_3627_4040 134
287 3300050512 nmdc:mga0n895_193714_c1 nmdc:mga0n895_193714_c1_1631_2044 134
288 3300050512 nmdc:mga0n895_30643_c1 nmdc:mga0n895_30643_c1_2764_3177 134
289 3300050513 nmdc:mga0rr50_120485_c1 nmdc:mga0rr50_120485_c1_817_1230 134
290 3300050513 nmdc:mga0rr50_286568_c1 nmdc:mga0rr50_286568_c1_775_1188 134
291 3300050513 nmdc:mga0rr50_434647_c1 nmdc:mga0rr50_434647_c1_178_585 134
292 3300050514 nmdc:mga08x19_769993_c1 nmdc:mga08x19_769993_c1_248_661 134
293 3300050515 nmdc:mga0a205_23629_c1 nmdc:mga0a205_23629_c1_870_1283 134
294 3300005336 Ga0070680_100000411 Ga0070680_10000041117 135
295 3300005336 Ga0070680_100160764 Ga0070680_1001607641 135
296 3300005336 Ga0070680_100646700 Ga0070680_1006467003 135
297 3300005356 Ga0070674_101448654 Ga0070674_1014486541 135
298 3300005435 Ga0070714_100600295 Ga0070714_1006002952 135
299 3300005456 Ga0070678_100450557 Ga0070678_1004505572 135
300 3300005458 Ga0070681_10000583 Ga0070681_1000058323 135
301 3300005458 Ga0070681_11175204 Ga0070681_111752042 135
302 3300005530 Ga0070679_100000628 Ga0070679_10000062822 135
303 3300005530 Ga0070679_100440639 Ga0070679_1004406392 135
304 3300005549 Ga0070704_101523898 Ga0070704_1015238981 135
305 3300005614 Ga0068856_101031828 Ga0068856_1010318282 135
306 3300005616 Ga0068852_100620467 Ga0068852_1006204672 135
307 3300005718 Ga0068866_10076750 Ga0068866_100767502 135
308 3300005719 Ga0068861_100410889 Ga0068861_1004108893 135
309 3300005841 Ga0068863_101003968 Ga0068863_1010039681 135
310 3300005983 Ga0081540_1001501 Ga0081540_10015016 135
311 3300006175 Ga0070712_100807387 Ga0070712_1008073872 135
312 3300006353 Ga0075370_10092772 Ga0075370_100927723 135
313 3300006871 Ga0075434_100059963 Ga0075434_1000599632 135
314 3300009177 Ga0105248_10263730 Ga0105248_102637302 135
315 3300009545 Ga0105237_10000431 Ga0105237_1000043151 135
316 3300009545 Ga0105237_10048028 Ga0105237_100480284 135
317 3300009545 Ga0105237_11397875 Ga0105237_113978751 135
318 3300010375 Ga0105239_10366803 Ga0105239_103668033 135
319 3300013306 Ga0163162_10596866 Ga0163162_105968661 135
320 3300013306 Ga0163162_10681386 Ga0163162_106813862 135
321 3300014325 Ga0163163_12656005 Ga0163163_126560051 135
322 3300014968 Ga0157379_12081839 Ga0157379_120818391 135
323 3300020081 Ga0206354_11596033 Ga0206354_115960331 135
324 3300025899 Ga0207642_10026343 Ga0207642_100263432 135
325 3300025904 Ga0207647_10046884 Ga0207647_100468842 135
326 3300025904 Ga0207647_10085489 Ga0207647_100854892 135
327 3300025912 Ga0207707_10000798 Ga0207707_1000079818 135
328 3300025912 Ga0207707_11622124 Ga0207707_116221241 135
329 3300025914 Ga0207671_10003870 Ga0207671_1000387010 135
330 3300025914 Ga0207671_10073956 Ga0207671_100739562 135
331 3300025917 Ga0207660_10001508 Ga0207660_100015087 135
332 3300025917 Ga0207660_10436486 Ga0207660_104364861 135
333 3300025921 Ga0207652_10000802 Ga0207652_1000080220 135
334 3300025941 Ga0207711_10208103 Ga0207711_102081032 135
335 3300025944 Ga0207661_10284928 Ga0207661_102849282 135
336 3300025949 Ga0207667_10017863 Ga0207667_100178634 135
337 3300025972 Ga0207668_10328406 Ga0207668_103284062 135
338 3300026118 Ga0207675_100187629 Ga0207675_1001876293 135
339 3300026118 Ga0207675_101839872 Ga0207675_1018398721 135
340 3300026121 Ga0207683_10661245 Ga0207683_106612452 135
341 3300026142 Ga0207698_11260511 Ga0207698_112605112 135
342 3300028379 Ga0268266_11289339 Ga0268266_112893391 135
343 3300031824 Ga0307413_11086023 Ga0307413_110860231 135
344 3300031995 Ga0307409_100347047 Ga0307409_1003470471 135
345 3300032126 Ga0307415_100055564 Ga0307415_1000555643 135
346 3300035083 Ga0373926_0039397 Ga0373926_0039397_1189_1605 135
347 3300035089 Ga0373944_0004991 Ga0373944_0004991_475_891 135
348 3300035113 Ga0373936_0023688 Ga0373936_0023688_1137_1553 135
349 3300035116 Ga0373945_0000322 Ga0373945_0000322_12403_12819 135
350 3300035170 Ga0373943_0007226 Ga0373943_0007226_3363_3779 135
351 3300035171 Ga0373946_0044755 Ga0373946_0044755_1190_1606 135
352 3300035172 Ga0373955_0431693 Ga0373955_0431693_244_660 135
353 3300035241 Ga0373961_0200731 Ga0373961_0200731_216_641 135
354 3300035410 Ga0373924_0181056 Ga0373924_0181056_127_543 135
355 3300035692 Ga0373935_0001388 Ga0373935_0001388_11790_12206 135
356 3300035695 Ga0373927_0002855 Ga0373927_0002855_11393_11809 135
357 3300035725 Ga0373947_0001825 Ga0373947_0001825_1209_1625 135
358 3300036401 Ga0373937_0184384 Ga0373937_0184384_557_973 135
359 3300037068 Ga0373925_0087327 Ga0373925_0087327_977_1393 135
360 3300044694 Ga0466963_0377094 Ga0466963_0377094_383_799 135
361 3300045836 Ga0466958_0020079 Ga0466958_0020079_367_789 135
362 3300045976 Ga0466967_0150199 Ga0466967_0150199_131_547 135
363 3300046455 Ga0495603_0195040 Ga0495603_0195040_221_637 135
364 3300046459 Ga0495629_0483866 Ga0495629_0483866_47_463 135
365 3300046461 Ga0495641_0034906 Ga0495641_0034906_1791_2207 135
366 3300046462 Ga0495651_0167721 Ga0495651_0167721_836_1252 135
367 3300046463 Ga0495653_0074089 Ga0495653_0074089_1276_1692 135
368 3300046463 Ga0495653_0880739 Ga0495653_0880739_68_484 135
369 3300046473 Ga0495582_0212711 Ga0495582_0212711_607_1023 135
370 3300046473 Ga0495582_0568352 Ga0495582_0568352_202_618 135
371 3300046475 Ga0495639_0108682 Ga0495639_0108682_683_1099 135
372 3300046477 Ga0495664_0052571 Ga0495664_0052571_1175_1591 135
373 3300046507 Ga0495606_0000072 Ga0495606_0000072_45567_45983 135
374 3300046511 Ga0495608_0114171 Ga0495608_0114171_497_913 135
375 3300046511 Ga0495608_0848705 Ga0495608_0848705_20_436 135
376 3300046514 Ga0495618_0706959 Ga0495618_0706959_118_534 135
377 3300046517 Ga0495630_0000012 Ga0495630_0000012_182348_182764 135
378 3300046517 Ga0495630_0100853 Ga0495630_0100853_850_1266 135
379 3300046529 Ga0495652_0291496 Ga0495652_0291496_591_1007 135
380 3300046531 Ga0495665_0028357 Ga0495665_0028357_1713_2129 135
381 3300046543 Ga0495645_0189180 Ga0495645_0189180_108_524 135
382 3300046559 Ga0495667_0059057 Ga0495667_0059057_825_1241 135
383 3300046642 Ga0495634_0211704 Ga0495634_0211704_139_555 135
384 3300046663 Ga0495635_0024877 Ga0495635_0024877_2769_3185 135
385 3300046674 Ga0495588_0464983 Ga0495588_0464983_139_555 135
386 3300046675 Ga0495657_0079152 Ga0495657_0079152_785_1201 135
387 3300046675 Ga0495657_0384091 Ga0495657_0384091_71_487 135
388 3300046678 Ga0495599_0481386 Ga0495599_0481386_153_569 135
389 3300046683 Ga0495658_0222203 Ga0495658_0222203_301_717 135
390 3300046689 Ga0495613_0583601 Ga0495613_0583601_93_509 135
391 3300046690 Ga0495624_0020055 Ga0495624_0020055_838_1254 135
392 3300046809 Ga0495600_0347778 Ga0495600_0347778_289_705 135
393 3300047319 Ga0495674_0100208 Ga0495674_0100208_774_1190 135
394 3300047319 Ga0495674_0662663 Ga0495674_0662663_41_457 135
395 3300047321 Ga0495676_0315349 Ga0495676_0315349_70_486 135
396 3300047322 Ga0495680_0057875 Ga0495680_0057875_1159_1575 135
397 3300047322 Ga0495680_0370716 Ga0495680_0370716_214_630 135
398 3300047444 Ga0495675_0399069 Ga0495675_0399069_205_621 135
399 3300047471 Ga0495684_0043342 Ga0495684_0043342_853_1269 135
400 3300047673 Ga0495593_0099781 Ga0495593_0099781_470_886 135
401 3300047673 Ga0495593_0167030 Ga0495593_0167030_170_586 135
402 3300048903 Ga0496100_0431138 Ga0496100_0431138_386_802 135
403 3300048903 Ga0496100_0475623 Ga0496100_0475623_52_525 135
404 3300048904 Ga0496101_0007793 Ga0496101_0007793_1528_1944 135
405 3300048905 Ga0496102_0014198 Ga0496102_0014198_3415_3831 135
406 3300048905 Ga0496102_0040050 Ga0496102_0040050_3257_3673 135
407 3300048905 Ga0496102_0320742 Ga0496102_0320742_906_1322 135
408 3300048905 Ga0496102_0955857 Ga0496102_0955857_107_523 135
409 3300048907 Ga0496104_0048196 Ga0496104_0048196_1706_2122 135
410 3300048907 Ga0496104_0192241 Ga0496104_0192241_13_429 135
411 3300048909 Ga0496106_0430244 Ga0496106_0430244_445_861 135
412 3300048910 Ga0496107_0125582 Ga0496107_0125582_306_773 135
413 3300048911 Ga0496108_0274898 Ga0496108_0274898_1017_1433 135
414 3300048912 Ga0496109_0001465 Ga0496109_0001465_1852_2268 135
415 3300048912 Ga0496109_1716844 Ga0496109_1716844_88_504 135
416 3300048913 Ga0496110_0148886 Ga0496110_0148886_188_604 135
417 3300048914 Ga0496111_0003865 Ga0496111_0003865_8580_8996 135
418 3300048915 Ga0496112_0365136 Ga0496112_0365136_115_531 135
419 3300048915 Ga0496112_1785174 Ga0496112_1785174_78_497 135
420 3300048916 Ga0496113_0019066 Ga0496113_0019066_3757_4173 135
421 3300048916 Ga0496113_0185102 Ga0496113_0185102_565_981 135
422 3300048917 Ga0496114_0023615 Ga0496114_0023615_4459_4875 135
423 3300048917 Ga0496114_0030724 Ga0496114_0030724_3722_4138 135
424 3300048918 Ga0496115_0040341 Ga0496115_0040341_1350_1769 135
425 3300050492 nmdc:mga0yw44_11369_c1 nmdc:mga0yw44_11369_c1_483_899 135
426 3300050512 nmdc:mga0n895_5571_c1 nmdc:mga0n895_5571_c1_9570_9986 135
427 3300053084 Ga0495595_0460014 Ga0495595_0460014_89_505 135
428 3300002067 JGI24735J21928_10093896 JGI24735J21928_100938962 136
429 3300003316 rootH1_10033476 rootH1_100334762 136
430 3300003322 rootL2_10189113 rootL2_101891133 136
431 3300003323 rootH1_10275024 rootH1_102750242 136
432 3300005329 Ga0070683_100098524 Ga0070683_1000985241 136
433 3300005329 Ga0070683_100456016 Ga0070683_1004560162 136
434 3300005336 Ga0070680_100044013 Ga0070680_1000440134 136
435 3300005336 Ga0070680_100232023 Ga0070680_1002320232 136
436 3300005337 Ga0070682_100075106 Ga0070682_1000751062 136
437 3300005337 Ga0070682_100347263 Ga0070682_1003472633 136
438 3300005339 Ga0070660_100124326 Ga0070660_1001243262 136
439 3300005341 Ga0070691_10114805 Ga0070691_101148052 136
440 3300005344 Ga0070661_100030094 Ga0070661_1000300943 136
441 3300005344 Ga0070661_100090564 Ga0070661_1000905643 136
442 3300005344 Ga0070661_100100371 Ga0070661_1001003712 136
443 3300005366 Ga0070659_100030811 Ga0070659_1000308113 136
444 3300005366 Ga0070659_100053622 Ga0070659_1000536225 136
445 3300005366 Ga0070659_100124537 Ga0070659_1001245373 136
446 3300005434 Ga0070709_10545810 Ga0070709_105458102 136
447 3300005435 Ga0070714_100313394 Ga0070714_1003133942 136
448 3300005436 Ga0070713_100050341 Ga0070713_1000503413 136
449 3300005436 Ga0070713_100574585 Ga0070713_1005745851 136
450 3300005436 Ga0070713_100730744 Ga0070713_1007307441 136
451 3300005455 Ga0070663_100383474 Ga0070663_1003834741 136
452 3300005458 Ga0070681_10059606 Ga0070681_100596062 136
453 3300005530 Ga0070679_100128239 Ga0070679_1001282393 136
454 3300005535 Ga0070684_100036526 Ga0070684_1000365265 136
455 3300005535 Ga0070684_100036742 Ga0070684_1000367423 136
456 3300005539 Ga0068853_100030444 Ga0068853_1000304442 136
457 3300005539 Ga0068853_100055436 Ga0068853_1000554365 136
458 3300005547 Ga0070693_100124146 Ga0070693_1001241462 136
459 3300005548 Ga0070665_100039549 Ga0070665_1000395492 136
460 3300005563 Ga0068855_100074382 Ga0068855_1000743825 136
461 3300005564 Ga0070664_100008834 Ga0070664_1000088346 136
462 3300005577 Ga0068857_100051092 Ga0068857_1000510924 136
463 3300005577 Ga0068857_100112578 Ga0068857_1001125783 136
464 3300005577 Ga0068857_100447286 Ga0068857_1004472862 136
465 3300005578 Ga0068854_100529153 Ga0068854_1005291531 136
466 3300005578 Ga0068854_101387964 Ga0068854_1013879641 136
467 3300005614 Ga0068856_100066434 Ga0068856_1000664344 136
468 3300005614 Ga0068856_100087537 Ga0068856_1000875373 136
469 3300005616 Ga0068852_100032362 Ga0068852_1000323624 136
470 3300005616 Ga0068852_100182426 Ga0068852_1001824264 136
471 3300005834 Ga0068851_10040917 Ga0068851_100409172 136
472 3300005834 Ga0068851_10074048 Ga0068851_100740483 136
473 3300005983 Ga0081540_1001813 Ga0081540_10018137 136
474 3300006028 Ga0070717_10126571 Ga0070717_101265711 136
475 3300006028 Ga0070717_10158193 Ga0070717_101581933 136
476 3300006028 Ga0070717_10814818 Ga0070717_108148182 136
477 3300006173 Ga0070716_100801455 Ga0070716_1008014551 136
478 3300006175 Ga0070712_101077049 Ga0070712_1010770491 136
479 3300006177 Ga0075362_10004816 Ga0075362_100048163 136
480 3300006177 Ga0075362_10635765 Ga0075362_106357652 136
481 3300007788 Ga0099795_10024989 Ga0099795_100249891 136
482 3300009093 Ga0105240_10103917 Ga0105240_101039173 136
483 3300009093 Ga0105240_10652148 Ga0105240_106521482 136
484 3300009093 Ga0105240_10962847 Ga0105240_109628472 136
485 3300009174 Ga0105241_10185343 Ga0105241_101853433 136
486 3300009174 Ga0105241_10661487 Ga0105241_106614872 136
487 3300009174 Ga0105241_11180351 Ga0105241_111803512 136
488 3300009545 Ga0105237_10059086 Ga0105237_100590865 136
489 3300009545 Ga0105237_10118873 Ga0105237_101188733 136
490 3300009545 Ga0105237_10322017 Ga0105237_103220173 136
491 3300009551 Ga0105238_10027104 Ga0105238_100271047 136
492 3300009551 Ga0105238_10066644 Ga0105238_100666443 136
493 3300009551 Ga0105238_10165538 Ga0105238_101655382 136
494 3300010159 Ga0099796_10111980 Ga0099796_101119802 136
495 3300010375 Ga0105239_10020284 Ga0105239_1002028410 136
496 3300010375 Ga0105239_10388880 Ga0105239_103888802 136
497 3300010375 Ga0105239_10518771 Ga0105239_105187712 136
498 3300011119 Ga0105246_10586641 Ga0105246_105866412 136
499 3300013100 Ga0157373_10074337 Ga0157373_100743375 136
500 3300013102 Ga0157371_10158476 Ga0157371_101584762 136
501 3300013102 Ga0157371_10402460 Ga0157371_104024601 136
502 3300013104 Ga0157370_10010709 Ga0157370_100107094 136
503 3300013104 Ga0157370_10024697 Ga0157370_100246974 136
504 3300013105 Ga0157369_10094814 Ga0157369_100948142 136
505 3300013105 Ga0157369_10096249 Ga0157369_100962493 136
506 3300013105 Ga0157369_10107775 Ga0157369_101077753 136
507 3300013105 Ga0157369_10658539 Ga0157369_106585392 136
508 3300013296 Ga0157374_10033326 Ga0157374_100333262 136
509 3300013296 Ga0157374_10318830 Ga0157374_103188301 136
510 3300013296 Ga0157374_10632020 Ga0157374_106320202 136
511 3300013307 Ga0157372_10074100 Ga0157372_100741005 136
512 3300013307 Ga0157372_10106760 Ga0157372_101067602 136
513 3300013307 Ga0157372_10125407 Ga0157372_101254073 136
514 3300015261 Ga0182006_1172614 Ga0182006_11726141 136
515 3300020069 Ga0197907_10945116 Ga0197907_109451162 136
516 3300020069 Ga0197907_11497267 Ga0197907_114972671 136
517 3300020070 Ga0206356_11004064 Ga0206356_110040643 136
518 3300020070 Ga0206356_11565528 Ga0206356_115655281 136
519 3300020070 Ga0206356_11575385 Ga0206356_115753853 136
520 3300020070 Ga0206356_11610432 Ga0206356_116104322 136
521 3300020076 Ga0206355_1043589 Ga0206355_10435892 136
522 3300020078 Ga0206352_11335040 Ga0206352_113350401 136
523 3300020080 Ga0206350_10723844 Ga0206350_107238442 136
524 3300020081 Ga0206354_11054448 Ga0206354_110544482 136
525 3300020082 Ga0206353_10598295 Ga0206353_105982955 136
526 3300020082 Ga0206353_10682216 Ga0206353_106822162 136
527 3300020082 Ga0206353_12026389 Ga0206353_120263892 136
528 3300021384 Ga0213876_10003068 Ga0213876_100030686 136
529 3300021384 Ga0213876_10123418 Ga0213876_101234182 136
530 3300021388 Ga0213875_10000372 Ga0213875_100003724 136
531 3300022467 Ga0224712_10156848 Ga0224712_101568482 136
532 3300022467 Ga0224712_10183289 Ga0224712_101832891 136
533 3300025321 Ga0207656_10052530 Ga0207656_100525301 136
534 3300025909 Ga0207705_10056274 Ga0207705_100562745 136
535 3300025910 Ga0207684_10130365 Ga0207684_101303652 136
536 3300025912 Ga0207707_10008078 Ga0207707_100080782 136
537 3300025913 Ga0207695_10543841 Ga0207695_105438413 136
538 3300025913 Ga0207695_10562238 Ga0207695_105622382 136
539 3300025915 Ga0207693_10616637 Ga0207693_106166372 136
540 3300025916 Ga0207663_11187447 Ga0207663_111874471 136
541 3300025917 Ga0207660_10006117 Ga0207660_100061177 136
542 3300025919 Ga0207657_10013235 Ga0207657_100132358 136
543 3300025919 Ga0207657_10088438 Ga0207657_100884384 136
544 3300025920 Ga0207649_10072721 Ga0207649_100727213 136
545 3300025920 Ga0207649_10090378 Ga0207649_100903782 136
546 3300025920 Ga0207649_10365928 Ga0207649_103659282 136
547 3300025921 Ga0207652_10202070 Ga0207652_102020702 136
548 3300025921 Ga0207652_10629846 Ga0207652_106298462 136
549 3300025922 Ga0207646_10666162 Ga0207646_106661622 136
550 3300025924 Ga0207694_10151960 Ga0207694_101519601 136
551 3300025924 Ga0207694_10232967 Ga0207694_102329672 136
552 3300025927 Ga0207687_10834463 Ga0207687_108344631 136
553 3300025928 Ga0207700_10079042 Ga0207700_100790424 136
554 3300025928 Ga0207700_11043043 Ga0207700_110430432 136
555 3300025929 Ga0207664_10000778 Ga0207664_1000077818 136
556 3300025931 Ga0207644_11332203 Ga0207644_113322031 136
557 3300025932 Ga0207690_10071975 Ga0207690_100719755 136
558 3300025932 Ga0207690_10235730 Ga0207690_102357303 136
559 3300025933 Ga0207706_10614786 Ga0207706_106147861 136
560 3300025944 Ga0207661_10061435 Ga0207661_100614353 136
561 3300025944 Ga0207661_10416533 Ga0207661_104165332 136
562 3300025944 Ga0207661_10428497 Ga0207661_104284971 136
563 3300025944 Ga0207661_10437658 Ga0207661_104376581 136
564 3300025949 Ga0207667_10054633 Ga0207667_100546334 136
565 3300025981 Ga0207640_10596323 Ga0207640_105963232 136
566 3300025981 Ga0207640_10893290 Ga0207640_108932902 136
567 3300026041 Ga0207639_10076332 Ga0207639_100763322 136
568 3300026041 Ga0207639_11251475 Ga0207639_112514751 136
569 3300026078 Ga0207702_10152015 Ga0207702_101520153 136
570 3300026116 Ga0207674_10011322 Ga0207674_100113225 136
571 3300026116 Ga0207674_10179789 Ga0207674_101797893 136
572 3300026142 Ga0207698_10152588 Ga0207698_101525884 136
573 3300027512 Ga0209179_1027110 Ga0209179_10271103 136
574 3300028380 Ga0268265_10536192 Ga0268265_105361922 136
575 3300035083 Ga0373926_0106256 Ga0373926_0106256_16_441 136
576 3300035111 Ga0373923_0085041 Ga0373923_0085041_862_1287 136
577 3300035113 Ga0373936_0001416 Ga0373936_0001416_7997_8422 136
578 3300035116 Ga0373945_0526815 Ga0373945_0526815_50_475 136
579 3300035117 Ga0373953_0003397 Ga0373953_0003397_1167_1592 136
580 3300035118 Ga0373954_0291535 Ga0373954_0291535_189_614 136
581 3300035119 Ga0373956_0016029 Ga0373956_0016029_189_614 136
582 3300035120 Ga0373957_0003429 Ga0373957_0003429_1297_1722 136
583 3300035172 Ga0373955_0036865 Ga0373955_0036865_1311_1736 136
584 3300035410 Ga0373924_0014859 Ga0373924_0014859_1909_2334 136
585 3300035692 Ga0373935_0052905 Ga0373935_0052905_298_723 136
586 3300035695 Ga0373927_0393999 Ga0373927_0393999_82_510 136
587 3300035695 Ga0373927_0980996 Ga0373927_0980996_86_511 136
588 3300035724 Ga0373933_0797276 Ga0373933_0797276_85_510 136
589 3300035725 Ga0373947_0132535 Ga0373947_0132535_781_1209 136
590 3300036401 Ga0373937_0245980 Ga0373937_0245980_1127_1552 136
591 3300037068 Ga0373925_0031273 Ga0373925_0031273_1022_1450 136
592 3300037068 Ga0373925_0112986 Ga0373925_0112986_1523_1951 136
593 3300037068 Ga0373925_0274201 Ga0373925_0274201_672_1097 136
594 3300037853 Ga0436364_1205415 Ga0436364_1205415_2865_3296 136
595 3300037853 Ga0436364_1511050 Ga0436364_1511050_17544_17978 136
596 3300038443 Ga0395901_0228419 Ga0395901_0228419_318_740 136
597 3300039437 Ga0436365_0696108 Ga0436365_0696108_11032_11475 136
598 3300039437 Ga0436365_1526623 Ga0436365_1526623_1791_2234 136
599 3300039437 Ga0436365_1760587 Ga0436365_1760587_98_520 136
600 3300039437 Ga0436365_1763225 Ga0436365_1763225_909_1331 136
601 3300039450 Ga0436363_1019899 Ga0436363_1019899_176_598 136
602 3300044656 Ga0466969_0059763 Ga0466969_0059763_1051_1467 136
603 3300044684 Ga0466966_0024387 Ga0466966_0024387_2438_2854 136
604 3300044693 Ga0466961_0017861 Ga0466961_0017861_4125_4541 136
605 3300044693 Ga0466961_0651365 Ga0466961_0651365_32_457 136
606 3300044694 Ga0466963_0032573 Ga0466963_0032573_2906_3328 136
607 3300044694 Ga0466963_0340886 Ga0466963_0340886_592_1029 136
608 3300044694 Ga0466963_0748576 Ga0466963_0748576_53_478 136
609 3300044706 Ga0466964_0212003 Ga0466964_0212003_52_480 136
610 3300044706 Ga0466964_0565304 Ga0466964_0565304_47_469 136
611 3300044719 Ga0466971_0003213 Ga0466971_0003213_5657_6073 136
612 3300044719 Ga0466971_0221357 Ga0466971_0221357_129_557 136
613 3300044735 Ga0466968_0598812 Ga0466968_0598812_120_545 136
614 3300045049 Ga0466959_0219097 Ga0466959_0219097_576_992 136
615 3300045836 Ga0466958_0032123 Ga0466958_0032123_1892_2320 136
616 3300045836 Ga0466958_0095830 Ga0466958_0095830_421_858 136
617 3300045976 Ga0466967_0003362 Ga0466967_0003362_467_889 136
618 3300045976 Ga0466967_0007930 Ga0466967_0007930_7009_7437 136
619 3300045976 Ga0466967_0138314 Ga0466967_0138314_1444_1866 136
620 3300045976 Ga0466967_0187894 Ga0466967_0187894_1091_1528 136
621 3300045976 Ga0466967_0843493 Ga0466967_0843493_386_814 136
622 3300045976 Ga0466967_1584739 Ga0466967_1584739_88_510 136
623 3300046459 Ga0495629_0068008 Ga0495629_0068008_1860_2285 136
624 3300046461 Ga0495641_0016250 Ga0495641_0016250_1629_2054 136
625 3300046462 Ga0495651_0020085 Ga0495651_0020085_2066_2491 136
626 3300046463 Ga0495653_0055308 Ga0495653_0055308_1509_1934 136
627 3300046472 Ga0495580_0397385 Ga0495580_0397385_111_536 136
628 3300046473 Ga0495582_0002876 Ga0495582_0002876_3541_3966 136
629 3300046475 Ga0495639_0018327 Ga0495639_0018327_309_734 136
630 3300046476 Ga0495662_0019397 Ga0495662_0019397_2574_2999 136
631 3300046476 Ga0495662_0045733 Ga0495662_0045733_13_441 136
632 3300046477 Ga0495664_0002450 Ga0495664_0002450_9512_9937 136
633 3300046477 Ga0495664_0079993 Ga0495664_0079993_943_1368 136
634 3300046511 Ga0495608_0042303 Ga0495608_0042303_1113_1538 136
635 3300046514 Ga0495618_0047239 Ga0495618_0047239_1732_2157 136
636 3300046516 Ga0495628_0041347 Ga0495628_0041347_2694_3119 136
637 3300046516 Ga0495628_0369597 Ga0495628_0369597_42_470 136
638 3300046516 Ga0495628_0725432 Ga0495628_0725432_10_435 136
639 3300046517 Ga0495630_0040582 Ga0495630_0040582_3022_3450 136
640 3300046526 Ga0495666_0025471 Ga0495666_0025471_214_639 136
641 3300046529 Ga0495652_0052505 Ga0495652_0052505_189_614 136
642 3300046529 Ga0495652_0175807 Ga0495652_0175807_65_493 136
643 3300046531 Ga0495665_0001745 Ga0495665_0001745_8329_8754 136
644 3300046533 Ga0495640_0006215 Ga0495640_0006215_7004_7432 136
645 3300046533 Ga0495640_0176935 Ga0495640_0176935_323_748 136
646 3300046535 Ga0495586_0003691 Ga0495586_0003691_2251_2676 136
647 3300046535 Ga0495586_0332231 Ga0495586_0332231_393_821 136
648 3300046536 Ga0495587_0026804 Ga0495587_0026804_2426_2851 136
649 3300046543 Ga0495645_0211511 Ga0495645_0211511_610_1038 136
650 3300046543 Ga0495645_0262772 Ga0495645_0262772_624_1049 136
651 3300046642 Ga0495634_0504485 Ga0495634_0504485_233_661 136
652 3300046663 Ga0495635_0161383 Ga0495635_0161383_967_1392 136
653 3300046663 Ga0495635_0280850 Ga0495635_0280850_158_586 136
654 3300046675 Ga0495657_0005434 Ga0495657_0005434_8633_9058 136
655 3300046678 Ga0495599_0026464 Ga0495599_0026464_2518_2943 136
656 3300046678 Ga0495599_0298953 Ga0495599_0298953_309_737 136
657 3300046680 Ga0495646_0084132 Ga0495646_0084132_862_1287 136
658 3300046689 Ga0495613_0032515 Ga0495613_0032515_2450_2875 136
659 3300046689 Ga0495613_0451996 Ga0495613_0451996_388_816 136
660 3300046690 Ga0495624_0046372 Ga0495624_0046372_189_614 136
661 3300046690 Ga0495624_0782025 Ga0495624_0782025_41_463 136
662 3300046809 Ga0495600_0008278 Ga0495600_0008278_3978_4403 136
663 3300047315 Ga0495581_0011873 Ga0495581_0011873_4319_4744 136
664 3300047317 Ga0495604_0073009 Ga0495604_0073009_1832_2257 136
665 3300047319 Ga0495674_0000950 Ga0495674_0000950_20383_20811 136
666 3300047321 Ga0495676_0575681 Ga0495676_0575681_250_675 136
667 3300047322 Ga0495680_0007738 Ga0495680_0007738_1509_1934 136
668 3300047444 Ga0495675_0323080 Ga0495675_0323080_189_614 136
669 3300047471 Ga0495684_0135336 Ga0495684_0135336_302_727 136
670 3300047471 Ga0495684_0335123 Ga0495684_0335123_437_865 136
671 3300047673 Ga0495593_0001519 Ga0495593_0001519_11940_12365 136
672 3300048088 Ga0495602_0072788 Ga0495602_0072788_995_1420 136
673 3300048089 Ga0495614_0403498 Ga0495614_0403498_137_562 136
674 3300048903 Ga0496100_0138840 Ga0496100_0138840_207_629 136
675 3300048904 Ga0496101_0028460 Ga0496101_0028460_37_459 136
676 3300048908 Ga0496105_0155634 Ga0496105_0155634_927_1349 136
677 3300048910 Ga0496107_0034574 Ga0496107_0034574_3104_3526 136
678 3300048911 Ga0496108_1073427 Ga0496108_1073427_251_673 136
679 3300048912 Ga0496109_0021563 Ga0496109_0021563_1159_1581 136
680 3300048912 Ga0496109_0203799 Ga0496109_0203799_36_455 136
681 3300048913 Ga0496110_0527484 Ga0496110_0527484_654_1064 136
682 3300048914 Ga0496111_0768797 Ga0496111_0768797_22_444 136
683 3300048914 Ga0496111_0803148 Ga0496111_0803148_41_451 136
684 3300048917 Ga0496114_0003593 Ga0496114_0003593_10666_11088 136
685 3300048918 Ga0496115_0006669 Ga0496115_0006669_2422_2844 136
686 3300048918 Ga0496115_0084410 Ga0496115_0084410_826_1251 136
687 3300049585 Ga0501069_0217153 Ga0501069_0217153_84_503 136
688 3300049586 Ga0501070_0693901 Ga0501070_0693901_123_542 136
689 3300049593 Ga0501077_0776441 Ga0501077_0776441_129_548 136
690 3300049822 Ga0501035_0123223 Ga0501035_0123223_1438_1863 136
691 3300050489 nmdc:mga03683_42793_c1 nmdc:mga03683_42793_c1_995_1441 136
692 3300050512 nmdc:mga0n895_1009659_c1 nmdc:mga0n895_1009659_c1_290_715 136
693 3300050513 nmdc:mga0rr50_1421086_c1 nmdc:mga0rr50_1421086_c1_142_561 136
694 3300050514 nmdc:mga08x19_267178_c1 nmdc:mga08x19_267178_c1_306_776 136
695 3300050514 nmdc:mga08x19_562736_c1 nmdc:mga08x19_562736_c1_343_765 136
696 3300053077 Ga0495601_0019317 Ga0495601_0019317_614_1039 136
697 3300053077 Ga0495601_0938365 Ga0495601_0938365_108_533 136
698 3300053078 Ga0495612_0009518 Ga0495612_0009518_3352_3777 136
699 3300053078 Ga0495612_0212510 Ga0495612_0212510_219_647 136
700 3300053084 Ga0495595_0069736 Ga0495595_0069736_567_992 136
701 3300053085 Ga0495619_0001433 Ga0495619_0001433_11710_12135 136
702 3300053085 Ga0495619_0327816 Ga0495619_0327816_93_521 136
703 3300053736 Ga0500599_005577 Ga0500599_005577_826_1254 136
704 3300061719 Ga0466962_0003291 Ga0466962_0003291_7196_7612 136
705 3300061734 Ga0530510_0267547 Ga0530510_0267547_123_542 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

32

157

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.8124 4 129
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.7896 4 129
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.7455 6 130
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7195 3 130
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7166 2 130
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8972 76 127 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8597 76 129 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8175 76 127 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8083 78 130 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8005 76 130 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A1A2XNA7-F1-model_v4 Glyoxalase 0.9934 1 135
AF-A0A2P9ADF3-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9862 1 134 GO:0051213
AF-A0A1X2A2B1-F1-model_v4 Glyoxalase 0.9846 2 136
AF-A0A4Y3KJS4-F1-model_v4 Glyoxalase 0.9816 2 136
AF-A0A1X6WY33-F1-model_v4 ASCH domain-containing protein 0.9808 1 134

Feature Viewer

pLDDT pTM Quality
95.99 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map