F476400
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 705 | 333 | 704 | 139 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10162899|Ga0105239_101628993 |
| Length | 164 |
| Sequence | VREHALHAGTVAGSFKTGRAAPAHHRGMEIEFIASFAVITPDPSASRGLYVDALGLPLEHAPGDDYLHTESVGGAKHFGVWPLTQAAAACFGRAEWPAERPVPQASVEFEVASVEAVGAAADEFAGRGVELLHGARTEPWGQTVARLLSPEGVIVGISYVPQFH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 69 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 102 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 120 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 127 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 219 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 220 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 221 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 222 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 225 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 228 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 229 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 238 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 239 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 288 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 289 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 290 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 291 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 292 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 302 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 303 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 304 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 320 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 321 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.02 |
| Metatranscriptomes | 2.84 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 8.09 |
| Rhizosphere | 88.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10093896 | 3300002067 | Bacteria | 861 |
| 2 | rootH1_10033476 | 3300003316 | Bacteria | 2233 |
| 3 | rootL2_10189113 | 3300003322 | Bacteria | 3114 |
| 4 | rootH1_10275024 | 3300003323 | Bacteria | 2164 |
| 5 | Ga0070658_10027933 | 3300005327 | Bacteria | 4528 |
| 6 | Ga0070676_10056059 | 3300005328 | Bacteria | 2328 |
| 7 | Ga0070683_100014900 | 3300005329 | Bacteria | 6814 |
| 8 | Ga0070683_100098524 | 3300005329 | Bacteria | 2751 |
| 9 | Ga0070683_100237568 | 3300005329 | Bacteria | 1733 |
| 10 | Ga0070683_100456016 | 3300005329 | Bacteria | 1220 |
| 11 | Ga0070690_100094889 | 3300005330 | Bacteria | 1969 |
| 12 | Ga0070670_100219618 | 3300005331 | Bacteria | 1653 |
| 13 | Ga0068869_100039143 | 3300005334 | Bacteria | 3384 |
| 14 | Ga0070666_10155703 | 3300005335 | Bacteria | 1596 |
| 15 | Ga0070666_10180460 | 3300005335 | Bacteria | 1480 |
| 16 | Ga0070680_100000411 | 3300005336 | Bacteria | 29241 |
| 17 | Ga0070680_100044013 | 3300005336 | Bacteria | 3627 |
| 18 | Ga0070680_100160764 | 3300005336 | Bacteria | 1887 |
| 19 | Ga0070680_100232023 | 3300005336 | Bacteria | 1559 |
| 20 | Ga0070680_100646700 | 3300005336 | Bacteria | 909 |
| 21 | Ga0070682_100024397 | 3300005337 | Bacteria | 3599 |
| 22 | Ga0070682_100075106 | 3300005337 | Bacteria | 2173 |
| 23 | Ga0070682_100347263 | 3300005337 | Bacteria | 1105 |
| 24 | Ga0068868_100022330 | 3300005338 | Bacteria | 4773 |
| 25 | Ga0070660_100124326 | 3300005339 | Bacteria | 2061 |
| 26 | Ga0070660_100208875 | 3300005339 | Bacteria | 1584 |
| 27 | Ga0070689_100007258 | 3300005340 | Bacteria | 7729 |
| 28 | Ga0070691_10048363 | 3300005341 | Bacteria | 2024 |
| 29 | Ga0070691_10114805 | 3300005341 | Bacteria | 1350 |
| 30 | Ga0070661_100029994 | 3300005344 | Bacteria | 3927 |
| 31 | Ga0070661_100030094 | 3300005344 | Bacteria | 3921 |
| 32 | Ga0070661_100090564 | 3300005344 | Bacteria | 2265 |
| 33 | Ga0070661_100100371 | 3300005344 | Bacteria | 2152 |
| 34 | Ga0070692_10001194 | 3300005345 | Bacteria | 9194 |
| 35 | Ga0070671_100022184 | 3300005355 | Bacteria | 5187 |
| 36 | Ga0070674_100884564 | 3300005356 | Bacteria | 777 |
| 37 | Ga0070674_101448654 | 3300005356 | Unclassified | 616 |
| 38 | Ga0070673_100042817 | 3300005364 | Bacteria | 3494 |
| 39 | Ga0070659_100030811 | 3300005366 | Bacteria | 4151 |
| 40 | Ga0070659_100053622 | 3300005366 | Bacteria | 3174 |
| 41 | Ga0070659_100124537 | 3300005366 | Bacteria | 2090 |
| 42 | Ga0070667_100853462 | 3300005367 | Bacteria | 846 |
| 43 | Ga0070703_10166730 | 3300005406 | Bacteria | 840 |
| 44 | Ga0070709_10002975 | 3300005434 | Bacteria | 9124 |
| 45 | Ga0070709_10447888 | 3300005434 | Unclassified | 972 |
| 46 | Ga0070709_10545810 | 3300005434 | Bacteria | 886 |
| 47 | Ga0070714_100279211 | 3300005435 | Bacteria | 1551 |
| 48 | Ga0070714_100313394 | 3300005435 | Bacteria | 1465 |
| 49 | Ga0070714_100600295 | 3300005435 | Bacteria | 1057 |
| 50 | Ga0070713_100004650 | 3300005436 | Bacteria | 9262 |
| 51 | Ga0070713_100050341 | 3300005436 | Bacteria | 3441 |
| 52 | Ga0070713_100574585 | 3300005436 | Bacteria | 1069 |
| 53 | Ga0070713_100730744 | 3300005436 | Bacteria | 946 |
| 54 | Ga0070710_10379480 | 3300005437 | Bacteria | 942 |
| 55 | Ga0070701_11243766 | 3300005438 | Bacteria | 530 |
| 56 | Ga0070711_100383181 | 3300005439 | Bacteria | 1137 |
| 57 | Ga0070711_101150953 | 3300005439 | Unclassified | 670 |
| 58 | Ga0070711_101391751 | 3300005439 | Unclassified | 610 |
| 59 | Ga0070700_100201616 | 3300005441 | Bacteria | 1398 |
| 60 | Ga0070663_100000144 | 3300005455 | Bacteria | 34633 |
| 61 | Ga0070663_100023438 | 3300005455 | Bacteria | 4138 |
| 62 | Ga0070663_100383474 | 3300005455 | Unclassified | 1145 |
| 63 | Ga0070678_100003038 | 3300005456 | Bacteria | 9300 |
| 64 | Ga0070678_100450557 | 3300005456 | Bacteria | 1127 |
| 65 | Ga0070662_100295286 | 3300005457 | Bacteria | 1315 |
| 66 | Ga0070681_10000583 | 3300005458 | Bacteria | 30207 |
| 67 | Ga0070681_10059606 | 3300005458 | Bacteria | 3797 |
| 68 | Ga0070681_10078231 | 3300005458 | Bacteria | 3264 |
| 69 | Ga0070681_10133876 | 3300005458 | Bacteria | 2410 |
| 70 | Ga0070681_10853983 | 3300005458 | Bacteria | 828 |
| 71 | Ga0070681_11175204 | 3300005458 | Bacteria | 689 |
| 72 | Ga0070706_100184362 | 3300005467 | Unclassified | 1950 |
| 73 | Ga0070707_100161746 | 3300005468 | Unclassified | 2181 |
| 74 | Ga0070698_100005777 | 3300005471 | Bacteria | 13531 |
| 75 | Ga0070698_100560259 | 3300005471 | Bacteria | 1082 |
| 76 | Ga0070699_100366404 | 3300005518 | Bacteria | 1299 |
| 77 | Ga0070679_100000628 | 3300005530 | Bacteria | 30052 |
| 78 | Ga0070679_100015682 | 3300005530 | Bacteria | 7285 |
| 79 | Ga0070679_100128239 | 3300005530 | Bacteria | 2518 |
| 80 | Ga0070679_100190945 | 3300005530 | Bacteria | 2017 |
| 81 | Ga0070679_100440639 | 3300005530 | Bacteria | 1247 |
| 82 | Ga0070679_100623173 | 3300005530 | Bacteria | 1022 |
| 83 | Ga0070679_101166119 | 3300005530 | Unclassified | 715 |
| 84 | Ga0070684_100036526 | 3300005535 | Bacteria | 4210 |
| 85 | Ga0070684_100036742 | 3300005535 | Bacteria | 4197 |
| 86 | Ga0070684_100071244 | 3300005535 | Bacteria | 3060 |
| 87 | Ga0070684_100750595 | 3300005535 | Bacteria | 911 |
| 88 | Ga0070697_102090157 | 3300005536 | Unclassified | 507 |
| 89 | Ga0068853_100028168 | 3300005539 | Bacteria | 4723 |
| 90 | Ga0068853_100030444 | 3300005539 | Bacteria | 4559 |
| 91 | Ga0068853_100055436 | 3300005539 | Bacteria | 3417 |
| 92 | Ga0070686_100042982 | 3300005544 | Bacteria | 2833 |
| 93 | Ga0070696_100262156 | 3300005546 | Unclassified | 1311 |
| 94 | Ga0070696_100628620 | 3300005546 | Bacteria | 868 |
| 95 | Ga0070693_100002404 | 3300005547 | Bacteria | 8617 |
| 96 | Ga0070693_100124146 | 3300005547 | Bacteria | 1605 |
| 97 | Ga0070665_100039549 | 3300005548 | Bacteria | 4741 |
| 98 | Ga0070665_100068119 | 3300005548 | Bacteria | 3568 |
| 99 | Ga0070665_100192635 | 3300005548 | Bacteria | 2039 |
| 100 | Ga0070704_100179008 | 3300005549 | Bacteria | 1694 |
| 101 | Ga0070704_101523898 | 3300005549 | Unclassified | 615 |
| 102 | Ga0068855_100074382 | 3300005563 | Bacteria | 3946 |
| 103 | Ga0068855_100619163 | 3300005563 | Bacteria | 1166 |
| 104 | Ga0070664_100008834 | 3300005564 | Bacteria | 8166 |
| 105 | Ga0068857_100051092 | 3300005577 | Bacteria | 3666 |
| 106 | Ga0068857_100112578 | 3300005577 | Bacteria | 2447 |
| 107 | Ga0068857_100447286 | 3300005577 | Unclassified | 1207 |
| 108 | Ga0068857_100564758 | 3300005577 | Bacteria | 1073 |
| 109 | Ga0068854_100126579 | 3300005578 | Bacteria | 1946 |
| 110 | Ga0068854_100529153 | 3300005578 | Bacteria | 997 |
| 111 | Ga0068854_101387964 | 3300005578 | Bacteria | 635 |
| 112 | Ga0068856_100044737 | 3300005614 | Bacteria | 4357 |
| 113 | Ga0068856_100066434 | 3300005614 | Bacteria | 3563 |
| 114 | Ga0068856_100087537 | 3300005614 | Bacteria | 3096 |
| 115 | Ga0068856_101031828 | 3300005614 | Bacteria | 840 |
| 116 | Ga0070702_100004197 | 3300005615 | Bacteria | 6554 |
| 117 | Ga0068852_100032362 | 3300005616 | Bacteria | 4329 |
| 118 | Ga0068852_100154339 | 3300005616 | Bacteria | 2137 |
| 119 | Ga0068852_100182426 | 3300005616 | Bacteria | 1975 |
| 120 | Ga0068852_100620467 | 3300005616 | Bacteria | 1087 |
| 121 | Ga0068859_100179367 | 3300005617 | Bacteria | 2200 |
| 122 | Ga0068864_100072812 | 3300005618 | Bacteria | 2995 |
| 123 | Ga0068866_10076750 | 3300005718 | Unclassified | 1782 |
| 124 | Ga0068866_11118809 | 3300005718 | Bacteria | 565 |
| 125 | Ga0068861_100410889 | 3300005719 | Unclassified | 1204 |
| 126 | Ga0068861_100739580 | 3300005719 | Unclassified | 918 |
| 127 | Ga0068851_10040917 | 3300005834 | Bacteria | 2330 |
| 128 | Ga0068851_10045306 | 3300005834 | Bacteria | 2223 |
| 129 | Ga0068851_10074048 | 3300005834 | Bacteria | 1767 |
| 130 | Ga0068870_10011849 | 3300005840 | Bacteria | 4057 |
| 131 | Ga0068863_100023339 | 3300005841 | Bacteria | 5909 |
| 132 | Ga0068863_100132270 | 3300005841 | Bacteria | 2382 |
| 133 | Ga0068863_101003968 | 3300005841 | Bacteria | 837 |
| 134 | Ga0068858_100129331 | 3300005842 | Bacteria | 2367 |
| 135 | Ga0068860_100380938 | 3300005843 | Bacteria | 1392 |
| 136 | Ga0081455_10000542 | 3300005937 | Bacteria | 49017 |
| 137 | Ga0081540_1001501 | 3300005983 | Bacteria | 20111 |
| 138 | Ga0081540_1001813 | 3300005983 | Bacteria | 17925 |
| 139 | Ga0070717_10030258 | 3300006028 | Bacteria | 4349 |
| 140 | Ga0070717_10126571 | 3300006028 | Bacteria | 2194 |
| 141 | Ga0070717_10158193 | 3300006028 | Bacteria | 1964 |
| 142 | Ga0070717_10226736 | 3300006028 | Bacteria | 1644 |
| 143 | Ga0070717_10586644 | 3300006028 | Unclassified | 1011 |
| 144 | Ga0070717_10814818 | 3300006028 | Unclassified | 849 |
| 145 | Ga0075432_10004310 | 3300006058 | Bacteria | 4844 |
| 146 | Ga0070716_100378839 | 3300006173 | Bacteria | 1011 |
| 147 | Ga0070716_100801455 | 3300006173 | Bacteria | 729 |
| 148 | Ga0070716_100900409 | 3300006173 | Unclassified | 693 |
| 149 | Ga0070712_100000007 | 3300006175 | Bacteria | 157653 |
| 150 | Ga0070712_100807387 | 3300006175 | Unclassified | 805 |
| 151 | Ga0070712_101077049 | 3300006175 | Bacteria | 697 |
| 152 | Ga0075362_10004816 | 3300006177 | Bacteria | 4872 |
| 153 | Ga0075362_10635765 | 3300006177 | Unclassified | 553 |
| 154 | Ga0097621_100015785 | 3300006237 | Bacteria | 5693 |
| 155 | Ga0075370_10092772 | 3300006353 | Bacteria | 1743 |
| 156 | Ga0068871_100014196 | 3300006358 | Bacteria | 5930 |
| 157 | Ga0075428_100241925 | 3300006844 | Bacteria | 1947 |
| 158 | Ga0075431_100008020 | 3300006847 | Bacteria | 10535 |
| 159 | Ga0075433_10231808 | 3300006852 | Bacteria | 1640 |
| 160 | Ga0075434_100000742 | 3300006871 | Bacteria | 25613 |
| 161 | Ga0075434_100059963 | 3300006871 | Bacteria | 3784 |
| 162 | Ga0075434_101134826 | 3300006871 | Bacteria | 794 |
| 163 | Ga0075429_100164136 | 3300006880 | Bacteria | 1946 |
| 164 | Ga0075436_100014930 | 3300006914 | Bacteria | 5323 |
| 165 | Ga0097620_100179370 | 3300006931 | Bacteria | 2200 |
| 166 | Ga0075435_100007053 | 3300007076 | Bacteria | 7978 |
| 167 | Ga0075435_100071170 | 3300007076 | Bacteria | 2839 |
| 168 | Ga0075435_100169397 | 3300007076 | Bacteria | 1842 |
| 169 | Ga0075435_100361986 | 3300007076 | Bacteria | 1244 |
| 170 | Ga0099795_10024989 | 3300007788 | Bacteria | 1998 |
| 171 | Ga0105251_10175895 | 3300009011 | Bacteria | 964 |
| 172 | Ga0105250_10186135 | 3300009092 | Unclassified | 872 |
| 173 | Ga0105240_10086849 | 3300009093 | Bacteria | 3831 |
| 174 | Ga0105240_10103917 | 3300009093 | Bacteria | 3450 |
| 175 | Ga0105240_10262917 | 3300009093 | Bacteria | 1990 |
| 176 | Ga0105240_10652148 | 3300009093 | Bacteria | 1153 |
| 177 | Ga0105240_10962847 | 3300009093 | Bacteria | 915 |
| 178 | Ga0105245_10075298 | 3300009098 | Bacteria | 3073 |
| 179 | Ga0105247_10006206 | 3300009101 | Bacteria | 7412 |
| 180 | Ga0114129_10475272 | 3300009147 | Bacteria | 1636 |
| 181 | Ga0105243_10091538 | 3300009148 | Bacteria | 2505 |
| 182 | Ga0105241_10013186 | 3300009174 | Bacteria | 6061 |
| 183 | Ga0105241_10185343 | 3300009174 | Bacteria | 1729 |
| 184 | Ga0105241_10236885 | 3300009174 | Bacteria | 1541 |
| 185 | Ga0105241_10661487 | 3300009174 | Bacteria | 950 |
| 186 | Ga0105241_11180351 | 3300009174 | Bacteria | 724 |
| 187 | Ga0105241_12235018 | 3300009174 | Unclassified | 543 |
| 188 | Ga0105242_11864342 | 3300009176 | Unclassified | 641 |
| 189 | Ga0105248_10006412 | 3300009177 | Bacteria | 12909 |
| 190 | Ga0105248_10263730 | 3300009177 | Bacteria | 1939 |
| 191 | Ga0105237_10000431 | 3300009545 | Bacteria | 59607 |
| 192 | Ga0105237_10041786 | 3300009545 | Bacteria | 4623 |
| 193 | Ga0105237_10048028 | 3300009545 | Bacteria | 4291 |
| 194 | Ga0105237_10059086 | 3300009545 | Bacteria | 3837 |
| 195 | Ga0105237_10118873 | 3300009545 | Bacteria | 2637 |
| 196 | Ga0105237_10322017 | 3300009545 | Bacteria | 1550 |
| 197 | Ga0105237_11397875 | 3300009545 | Unclassified | 706 |
| 198 | Ga0105238_10027104 | 3300009551 | Bacteria | 5840 |
| 199 | Ga0105238_10066644 | 3300009551 | Bacteria | 3601 |
| 200 | Ga0105238_10152529 | 3300009551 | Bacteria | 2286 |
| 201 | Ga0105238_10165538 | 3300009551 | Bacteria | 2187 |
| 202 | Ga0105238_11192913 | 3300009551 | Bacteria | 785 |
| 203 | Ga0099796_10111980 | 3300010159 | Bacteria | 1040 |
| 204 | Ga0105239_10020284 | 3300010375 | Bacteria | 7333 |
| 205 | Ga0105239_10162899 | 3300010375 | Bacteria | 2492 |
| 206 | Ga0105239_10190185 | 3300010375 | Bacteria | 2298 |
| 207 | Ga0105239_10366803 | 3300010375 | Bacteria | 1627 |
| 208 | Ga0105239_10388880 | 3300010375 | Unclassified | 1578 |
| 209 | Ga0105239_10518771 | 3300010375 | Bacteria | 1356 |
| 210 | Ga0105246_10005601 | 3300011119 | Bacteria | 7659 |
| 211 | Ga0105246_10586641 | 3300011119 | Unclassified | 961 |
| 212 | Ga0157335_1014925 | 3300012492 | Bacteria | 678 |
| 213 | Ga0157342_1015969 | 3300012507 | Bacteria | 827 |
| 214 | Ga0157373_10074337 | 3300013100 | Bacteria | 2397 |
| 215 | Ga0157373_10122709 | 3300013100 | Bacteria | 1826 |
| 216 | Ga0157371_10004675 | 3300013102 | Bacteria | 11841 |
| 217 | Ga0157371_10158476 | 3300013102 | Bacteria | 1616 |
| 218 | Ga0157371_10402460 | 3300013102 | Unclassified | 1002 |
| 219 | Ga0157370_10010260 | 3300013104 | Bacteria | 9887 |
| 220 | Ga0157370_10010709 | 3300013104 | Bacteria | 9647 |
| 221 | Ga0157370_10024697 | 3300013104 | Bacteria | 5951 |
| 222 | Ga0157369_10087088 | 3300013105 | Bacteria | 3335 |
| 223 | Ga0157369_10094814 | 3300013105 | Bacteria | 3185 |
| 224 | Ga0157369_10096249 | 3300013105 | Bacteria | 3159 |
| 225 | Ga0157369_10107775 | 3300013105 | Bacteria | 2963 |
| 226 | Ga0157369_10658539 | 3300013105 | Unclassified | 1080 |
| 227 | Ga0157369_10709947 | 3300013105 | Bacteria | 1035 |
| 228 | Ga0157374_10033326 | 3300013296 | Bacteria | 4699 |
| 229 | Ga0157374_10318830 | 3300013296 | Unclassified | 1540 |
| 230 | Ga0157374_10632020 | 3300013296 | Bacteria | 1082 |
| 231 | Ga0163162_10596866 | 3300013306 | Unclassified | 1231 |
| 232 | Ga0163162_10681386 | 3300013306 | Unclassified | 1150 |
| 233 | Ga0157372_10074100 | 3300013307 | Bacteria | 3838 |
| 234 | Ga0157372_10106760 | 3300013307 | Bacteria | 3203 |
| 235 | Ga0157372_10125407 | 3300013307 | Bacteria | 2952 |
| 236 | Ga0157372_11091984 | 3300013307 | Bacteria | 923 |
| 237 | Ga0157375_10207305 | 3300013308 | Bacteria | 2117 |
| 238 | Ga0163163_12656005 | 3300014325 | Unclassified | 558 |
| 239 | Ga0182008_10103285 | 3300014497 | Bacteria | 1410 |
| 240 | Ga0157377_10064923 | 3300014745 | Bacteria | 2095 |
| 241 | Ga0157379_12081839 | 3300014968 | Unclassified | 562 |
| 242 | Ga0157376_10201484 | 3300014969 | Bacteria | 1831 |
| 243 | Ga0157376_10248943 | 3300014969 | Bacteria | 1659 |
| 244 | Ga0157376_11767599 | 3300014969 | Unclassified | 654 |
| 245 | Ga0182006_1172614 | 3300015261 | Bacteria | 724 |
| 246 | Ga0197907_10945116 | 3300020069 | Bacteria | 2045 |
| 247 | Ga0197907_11497267 | 3300020069 | Unclassified | 538 |
| 248 | Ga0206356_10440670 | 3300020070 | Bacteria | 1573 |
| 249 | Ga0206356_11004064 | 3300020070 | Bacteria | 2410 |
| 250 | Ga0206356_11565528 | 3300020070 | Bacteria | 755 |
| 251 | Ga0206356_11575385 | 3300020070 | Bacteria | 1656 |
| 252 | Ga0206356_11610432 | 3300020070 | Bacteria | 593 |
| 253 | Ga0206355_1043589 | 3300020076 | Bacteria | 1180 |
| 254 | Ga0206352_11335040 | 3300020078 | Bacteria | 728 |
| 255 | Ga0206350_10723844 | 3300020080 | Unclassified | 1209 |
| 256 | Ga0206354_10158039 | 3300020081 | Bacteria | 1798 |
| 257 | Ga0206354_11054448 | 3300020081 | Unclassified | 1146 |
| 258 | Ga0206354_11596033 | 3300020081 | Bacteria | 796 |
| 259 | Ga0206353_10598295 | 3300020082 | Bacteria | 4556 |
| 260 | Ga0206353_10682216 | 3300020082 | Bacteria | 937 |
| 261 | Ga0206353_12026389 | 3300020082 | Bacteria | 1700 |
| 262 | Ga0154015_1020453 | 3300020610 | Bacteria | 596 |
| 263 | Ga0213876_10003068 | 3300021384 | Bacteria | 9661 |
| 264 | Ga0213876_10027852 | 3300021384 | Bacteria | 2980 |
| 265 | Ga0213876_10123418 | 3300021384 | Bacteria | 1376 |
| 266 | Ga0213875_10000372 | 3300021388 | Bacteria | 41089 |
| 267 | Ga0224712_10047511 | 3300022467 | Bacteria | 1652 |
| 268 | Ga0224712_10156848 | 3300022467 | Unclassified | 1013 |
| 269 | Ga0224712_10183289 | 3300022467 | Bacteria | 944 |
| 270 | Ga0207656_10036921 | 3300025321 | Bacteria | 2053 |
| 271 | Ga0207656_10052530 | 3300025321 | Bacteria | 1765 |
| 272 | Ga0207692_10364939 | 3300025898 | Bacteria | 893 |
| 273 | Ga0207642_10026343 | 3300025899 | Unclassified | 2366 |
| 274 | Ga0207642_10158632 | 3300025899 | Bacteria | 1212 |
| 275 | Ga0207710_10066370 | 3300025900 | Bacteria | 1646 |
| 276 | Ga0207688_10002541 | 3300025901 | Bacteria | 9851 |
| 277 | Ga0207680_10869450 | 3300025903 | Bacteria | 646 |
| 278 | Ga0207647_10046884 | 3300025904 | Bacteria | 2690 |
| 279 | Ga0207647_10085489 | 3300025904 | Bacteria | 1887 |
| 280 | Ga0207647_10619779 | 3300025904 | Bacteria | 595 |
| 281 | Ga0207685_10037296 | 3300025905 | Bacteria | 1789 |
| 282 | Ga0207685_10045161 | 3300025905 | Unclassified | 1669 |
| 283 | Ga0207699_10176053 | 3300025906 | Bacteria | 1435 |
| 284 | Ga0207699_10526828 | 3300025906 | Unclassified | 855 |
| 285 | Ga0207645_10031262 | 3300025907 | Bacteria | 3427 |
| 286 | Ga0207643_10001055 | 3300025908 | Bacteria | 16310 |
| 287 | Ga0207705_10056274 | 3300025909 | Bacteria | 2835 |
| 288 | Ga0207705_10643755 | 3300025909 | Bacteria | 824 |
| 289 | Ga0207684_10130365 | 3300025910 | Bacteria | 2158 |
| 290 | Ga0207684_10406807 | 3300025910 | Bacteria | 1170 |
| 291 | Ga0207654_10076824 | 3300025911 | Bacteria | 2000 |
| 292 | Ga0207707_10000798 | 3300025912 | Bacteria | 30868 |
| 293 | Ga0207707_10008078 | 3300025912 | Bacteria | 9135 |
| 294 | Ga0207707_10123728 | 3300025912 | Bacteria | 2262 |
| 295 | Ga0207707_10504911 | 3300025912 | Bacteria | 1031 |
| 296 | Ga0207707_11622124 | 3300025912 | Unclassified | 509 |
| 297 | Ga0207695_10073738 | 3300025913 | Bacteria | 3477 |
| 298 | Ga0207695_10543841 | 3300025913 | Bacteria | 1043 |
| 299 | Ga0207695_10562238 | 3300025913 | Bacteria | 1022 |
| 300 | Ga0207671_10003870 | 3300025914 | Bacteria | 14631 |
| 301 | Ga0207671_10073956 | 3300025914 | Bacteria | 2546 |
| 302 | Ga0207671_10096589 | 3300025914 | Bacteria | 2233 |
| 303 | Ga0207693_10000001 | 3300025915 | Bacteria | 469535 |
| 304 | Ga0207693_10033818 | 3300025915 | Unclassified | 4032 |
| 305 | Ga0207693_10616637 | 3300025915 | Unclassified | 844 |
| 306 | Ga0207663_10145357 | 3300025916 | Bacteria | 1657 |
| 307 | Ga0207663_10622881 | 3300025916 | Unclassified | 850 |
| 308 | Ga0207663_11187447 | 3300025916 | Bacteria | 614 |
| 309 | Ga0207663_11597364 | 3300025916 | Unclassified | 525 |
| 310 | Ga0207660_10001508 | 3300025917 | Bacteria | 15680 |
| 311 | Ga0207660_10006117 | 3300025917 | Bacteria | 7811 |
| 312 | Ga0207660_10422622 | 3300025917 | Bacteria | 1075 |
| 313 | Ga0207660_10436486 | 3300025917 | Bacteria | 1058 |
| 314 | Ga0207662_10092622 | 3300025918 | Bacteria | 1861 |
| 315 | Ga0207657_10013235 | 3300025919 | Bacteria | 8096 |
| 316 | Ga0207657_10030617 | 3300025919 | Bacteria | 4883 |
| 317 | Ga0207657_10088438 | 3300025919 | Bacteria | 2589 |
| 318 | Ga0207649_10011601 | 3300025920 | Bacteria | 4864 |
| 319 | Ga0207649_10072721 | 3300025920 | Bacteria | 2201 |
| 320 | Ga0207649_10090378 | 3300025920 | Unclassified | 2004 |
| 321 | Ga0207649_10365928 | 3300025920 | Bacteria | 1071 |
| 322 | Ga0207652_10000412 | 3300025921 | Bacteria | 44366 |
| 323 | Ga0207652_10000802 | 3300025921 | Bacteria | 30011 |
| 324 | Ga0207652_10027531 | 3300025921 | Bacteria | 4737 |
| 325 | Ga0207652_10202070 | 3300025921 | Bacteria | 1788 |
| 326 | Ga0207652_10629846 | 3300025921 | Bacteria | 960 |
| 327 | Ga0207652_11033740 | 3300025921 | Unclassified | 721 |
| 328 | Ga0207646_10666162 | 3300025922 | Bacteria | 932 |
| 329 | Ga0207694_10058809 | 3300025924 | Bacteria | 2990 |
| 330 | Ga0207694_10151960 | 3300025924 | Bacteria | 1866 |
| 331 | Ga0207694_10232967 | 3300025924 | Unclassified | 1504 |
| 332 | Ga0207650_10247525 | 3300025925 | Bacteria | 1442 |
| 333 | Ga0207659_10034790 | 3300025926 | Bacteria | 3477 |
| 334 | Ga0207687_10065660 | 3300025927 | Bacteria | 2577 |
| 335 | Ga0207687_10834463 | 3300025927 | Bacteria | 787 |
| 336 | Ga0207700_10079042 | 3300025928 | Bacteria | 2560 |
| 337 | Ga0207700_10389082 | 3300025928 | Unclassified | 1220 |
| 338 | Ga0207700_11043043 | 3300025928 | Bacteria | 731 |
| 339 | Ga0207700_11126628 | 3300025928 | Unclassified | 701 |
| 340 | Ga0207664_10000778 | 3300025929 | Bacteria | 21525 |
| 341 | Ga0207664_10100894 | 3300025929 | Bacteria | 2384 |
| 342 | Ga0207664_10543438 | 3300025929 | Unclassified | 1042 |
| 343 | Ga0207664_11399235 | 3300025929 | Bacteria | 620 |
| 344 | Ga0207644_10006498 | 3300025931 | Bacteria | 7621 |
| 345 | Ga0207644_11332203 | 3300025931 | Unclassified | 603 |
| 346 | Ga0207690_10016448 | 3300025932 | Bacteria | 4500 |
| 347 | Ga0207690_10071975 | 3300025932 | Bacteria | 2386 |
| 348 | Ga0207690_10235730 | 3300025932 | Bacteria | 1407 |
| 349 | Ga0207706_10152776 | 3300025933 | Bacteria | 2030 |
| 350 | Ga0207706_10614786 | 3300025933 | Unclassified | 932 |
| 351 | Ga0207686_10540711 | 3300025934 | Bacteria | 909 |
| 352 | Ga0207670_10006234 | 3300025936 | Bacteria | 6603 |
| 353 | Ga0207669_10046155 | 3300025937 | Bacteria | 2572 |
| 354 | Ga0207669_11053146 | 3300025937 | Unclassified | 685 |
| 355 | Ga0207665_10093789 | 3300025939 | Bacteria | 2084 |
| 356 | Ga0207665_10130305 | 3300025939 | Bacteria | 1784 |
| 357 | Ga0207665_10149338 | 3300025939 | Bacteria | 1673 |
| 358 | Ga0207691_10015445 | 3300025940 | Bacteria | 7261 |
| 359 | Ga0207711_10030349 | 3300025941 | Bacteria | 4559 |
| 360 | Ga0207711_10208103 | 3300025941 | Bacteria | 1787 |
| 361 | Ga0207689_10000708 | 3300025942 | Bacteria | 31948 |
| 362 | Ga0207661_10001919 | 3300025944 | Bacteria | 14271 |
| 363 | Ga0207661_10061435 | 3300025944 | Bacteria | 3035 |
| 364 | Ga0207661_10284928 | 3300025944 | Bacteria | 1477 |
| 365 | Ga0207661_10416533 | 3300025944 | Bacteria | 1220 |
| 366 | Ga0207661_10428497 | 3300025944 | Bacteria | 1202 |
| 367 | Ga0207661_10437658 | 3300025944 | Unclassified | 1189 |
| 368 | Ga0207661_10532482 | 3300025944 | Bacteria | 1075 |
| 369 | Ga0207661_10674409 | 3300025944 | Bacteria | 950 |
| 370 | Ga0207679_10014099 | 3300025945 | Bacteria | 5245 |
| 371 | Ga0207667_10017863 | 3300025949 | Bacteria | 7972 |
| 372 | Ga0207667_10054633 | 3300025949 | Bacteria | 4200 |
| 373 | Ga0207667_10190314 | 3300025949 | Bacteria | 2105 |
| 374 | Ga0207651_10333038 | 3300025960 | Bacteria | 1273 |
| 375 | Ga0207668_10328406 | 3300025972 | Bacteria | 1272 |
| 376 | Ga0207640_10172726 | 3300025981 | Bacteria | 1612 |
| 377 | Ga0207640_10596323 | 3300025981 | Bacteria | 934 |
| 378 | Ga0207640_10893290 | 3300025981 | Bacteria | 776 |
| 379 | Ga0207658_10131321 | 3300025986 | Bacteria | 2012 |
| 380 | Ga0207658_10939703 | 3300025986 | Bacteria | 788 |
| 381 | Ga0207677_10172632 | 3300026023 | Bacteria | 1692 |
| 382 | Ga0207677_10251576 | 3300026023 | Bacteria | 1435 |
| 383 | Ga0207639_10076332 | 3300026041 | Bacteria | 2638 |
| 384 | Ga0207639_10451424 | 3300026041 | Bacteria | 1167 |
| 385 | Ga0207639_11251475 | 3300026041 | Bacteria | 696 |
| 386 | Ga0207678_10000678 | 3300026067 | Bacteria | 31147 |
| 387 | Ga0207678_10005062 | 3300026067 | Bacteria | 11822 |
| 388 | Ga0207708_10018251 | 3300026075 | Bacteria | 5281 |
| 389 | Ga0207708_10143496 | 3300026075 | Unclassified | 1875 |
| 390 | Ga0207702_10001500 | 3300026078 | Bacteria | 23073 |
| 391 | Ga0207702_10006613 | 3300026078 | Bacteria | 9970 |
| 392 | Ga0207702_10152015 | 3300026078 | Bacteria | 2106 |
| 393 | Ga0207702_12023540 | 3300026078 | Bacteria | 566 |
| 394 | Ga0207641_10022836 | 3300026088 | Bacteria | 5152 |
| 395 | Ga0207676_10003065 | 3300026095 | Bacteria | 11920 |
| 396 | Ga0207674_10011322 | 3300026116 | Bacteria | 10024 |
| 397 | Ga0207674_10179789 | 3300026116 | Bacteria | 2067 |
| 398 | Ga0207674_11598979 | 3300026116 | Bacteria | 620 |
| 399 | Ga0207675_100187629 | 3300026118 | Bacteria | 1982 |
| 400 | Ga0207675_101839872 | 3300026118 | Bacteria | 624 |
| 401 | Ga0207683_10001770 | 3300026121 | Bacteria | 19122 |
| 402 | Ga0207683_10661245 | 3300026121 | Bacteria | 968 |
| 403 | Ga0207698_10009446 | 3300026142 | Bacteria | 6221 |
| 404 | Ga0207698_10152588 | 3300026142 | Bacteria | 2007 |
| 405 | Ga0207698_10276329 | 3300026142 | Bacteria | 1551 |
| 406 | Ga0207698_11257545 | 3300026142 | Bacteria | 755 |
| 407 | Ga0207698_11260511 | 3300026142 | Bacteria | 754 |
| 408 | Ga0209179_1027110 | 3300027512 | Bacteria | 1153 |
| 409 | Ga0207428_10061392 | 3300027907 | Bacteria | 2976 |
| 410 | Ga0268266_10003874 | 3300028379 | Bacteria | 14581 |
| 411 | Ga0268266_10098073 | 3300028379 | Bacteria | 2578 |
| 412 | Ga0268266_10421802 | 3300028379 | Bacteria | 1264 |
| 413 | Ga0268266_11289339 | 3300028379 | Unclassified | 706 |
| 414 | Ga0268265_10536192 | 3300028380 | Bacteria | 1109 |
| 415 | Ga0268264_10808089 | 3300028381 | Bacteria | 937 |
| 416 | Ga0307413_11086023 | 3300031824 | Bacteria | 690 |
| 417 | Ga0307409_100347047 | 3300031995 | Unclassified | 1399 |
| 418 | Ga0307415_100055564 | 3300032126 | Bacteria | 2710 |
| 419 | Ga0307415_100207537 | 3300032126 | Bacteria | 1560 |
| 420 | Ga0373926_0039397 | 3300035083 | Bacteria | 1684 |
| 421 | Ga0373926_0106256 | 3300035083 | Bacteria | 1053 |
| 422 | Ga0373944_0004991 | 3300035089 | Bacteria | 3481 |
| 423 | Ga0373923_0085041 | 3300035111 | Bacteria | 1376 |
| 424 | Ga0373932_0377400 | 3300035112 | Unclassified | 544 |
| 425 | Ga0373936_0001416 | 3300035113 | Bacteria | 8719 |
| 426 | Ga0373936_0023688 | 3300035113 | Bacteria | 2394 |
| 427 | Ga0373945_0000322 | 3300035116 | Bacteria | 13649 |
| 428 | Ga0373945_0526815 | 3300035116 | Bacteria | 528 |
| 429 | Ga0373953_0003397 | 3300035117 | Bacteria | 4951 |
| 430 | Ga0373954_0291535 | 3300035118 | Bacteria | 804 |
| 431 | Ga0373956_0016029 | 3300035119 | Bacteria | 3142 |
| 432 | Ga0373957_0003429 | 3300035120 | Bacteria | 4685 |
| 433 | Ga0373960_0239036 | 3300035121 | Bacteria | 656 |
| 434 | Ga0373943_0007226 | 3300035170 | Bacteria | 4983 |
| 435 | Ga0373946_0044755 | 3300035171 | Bacteria | 1828 |
| 436 | Ga0373955_0036865 | 3300035172 | Bacteria | 2597 |
| 437 | Ga0373955_0111523 | 3300035172 | Bacteria | 1582 |
| 438 | Ga0373955_0431693 | 3300035172 | Unclassified | 802 |
| 439 | Ga0373961_0200731 | 3300035241 | Bacteria | 703 |
| 440 | Ga0373962_0313172 | 3300035242 | Bacteria | 559 |
| 441 | Ga0373924_0014859 | 3300035410 | Bacteria | 2947 |
| 442 | Ga0373924_0181056 | 3300035410 | Bacteria | 927 |
| 443 | Ga0373931_0019717 | 3300035691 | Bacteria | 3369 |
| 444 | Ga0373935_0001388 | 3300035692 | Bacteria | 13386 |
| 445 | Ga0373935_0052905 | 3300035692 | Bacteria | 2582 |
| 446 | Ga0373927_0002855 | 3300035695 | Bacteria | 12594 |
| 447 | Ga0373927_0393999 | 3300035695 | Bacteria | 913 |
| 448 | Ga0373927_0980996 | 3300035695 | Bacteria | 557 |
| 449 | Ga0373933_0797276 | 3300035724 | Bacteria | 622 |
| 450 | Ga0373947_0001825 | 3300035725 | Bacteria | 13026 |
| 451 | Ga0373947_0132535 | 3300035725 | Bacteria | 1592 |
| 452 | Ga0373937_0184384 | 3300036401 | Bacteria | 1960 |
| 453 | Ga0373937_0245980 | 3300036401 | Bacteria | 1685 |
| 454 | Ga0373925_0031273 | 3300037068 | Bacteria | 3910 |
| 455 | Ga0373925_0087327 | 3300037068 | Bacteria | 2380 |
| 456 | Ga0373925_0112986 | 3300037068 | Bacteria | 2100 |
| 457 | Ga0373925_0274201 | 3300037068 | Bacteria | 1357 |
| 458 | Ga0395900_0153125 | 3300037418 | Bacteria | 2355 |
| 459 | Ga0395898_0004157 | 3300037466 | Bacteria | 15877 |
| 460 | Ga0395898_0170429 | 3300037466 | Bacteria | 2081 |
| 461 | Ga0395905_0050846 | 3300037471 | Bacteria | 3882 |
| 462 | Ga0436364_1205415 | 3300037853 | Bacteria | 3692 |
| 463 | Ga0436364_1511050 | 3300037853 | Bacteria | 66595 |
| 464 | Ga0395901_0085959 | 3300038443 | Bacteria | 3288 |
| 465 | Ga0395901_0228419 | 3300038443 | Bacteria | 1944 |
| 466 | Ga0395901_1456493 | 3300038443 | Bacteria | 642 |
| 467 | Ga0242420_162430 | 3300038996 | Bacteria | 506 |
| 468 | Ga0436365_0269075 | 3300039437 | Bacteria | 6389 |
| 469 | Ga0436365_0696108 | 3300039437 | Bacteria | 18390 |
| 470 | Ga0436365_1526623 | 3300039437 | Bacteria | 2670 |
| 471 | Ga0436365_1760587 | 3300039437 | Unclassified | 609 |
| 472 | Ga0436365_1763225 | 3300039437 | Unclassified | 2231 |
| 473 | Ga0436363_1019899 | 3300039450 | Bacteria | 908 |
| 474 | Ga0439448_0012929 | 3300042005 | Bacteria | 2504 |
| 475 | Ga0439458_0216288 | 3300042157 | Bacteria | 527 |
| 476 | Ga0439459_0002289 | 3300042438 | Bacteria | 2936 |
| 477 | Ga0466969_0059763 | 3300044656 | Bacteria | 1853 |
| 478 | Ga0466972_0169321 | 3300044658 | Unclassified | 1025 |
| 479 | Ga0466966_0024387 | 3300044684 | Bacteria | 3956 |
| 480 | Ga0466961_0017861 | 3300044693 | Bacteria | 4560 |
| 481 | Ga0466961_0042573 | 3300044693 | Bacteria | 2911 |
| 482 | Ga0466961_0651365 | 3300044693 | Bacteria | 632 |
| 483 | Ga0466963_0032573 | 3300044694 | Bacteria | 3377 |
| 484 | Ga0466963_0340886 | 3300044694 | Bacteria | 1055 |
| 485 | Ga0466963_0377094 | 3300044694 | Bacteria | 1000 |
| 486 | Ga0466963_0748576 | 3300044694 | Bacteria | 689 |
| 487 | Ga0466964_0212003 | 3300044706 | Unclassified | 936 |
| 488 | Ga0466964_0565304 | 3300044706 | Bacteria | 619 |
| 489 | Ga0466971_0003213 | 3300044719 | Bacteria | 6969 |
| 490 | Ga0466971_0221357 | 3300044719 | Bacteria | 897 |
| 491 | Ga0466968_0559467 | 3300044735 | Unclassified | 574 |
| 492 | Ga0466968_0598812 | 3300044735 | Bacteria | 556 |
| 493 | Ga0466959_0219097 | 3300045049 | Bacteria | 1320 |
| 494 | Ga0466959_0725461 | 3300045049 | Archaea | 666 |
| 495 | Ga0466958_0020079 | 3300045836 | Bacteria | 3895 |
| 496 | Ga0466958_0032123 | 3300045836 | Bacteria | 3122 |
| 497 | Ga0466958_0095830 | 3300045836 | Bacteria | 1840 |
| 498 | Ga0466967_0003362 | 3300045976 | Bacteria | 10406 |
| 499 | Ga0466967_0003925 | 3300045976 | Bacteria | 9878 |
| 500 | Ga0466967_0007930 | 3300045976 | Bacteria | 7723 |
| 501 | Ga0466967_0138314 | 3300045976 | Bacteria | 2266 |
| 502 | Ga0466967_0150199 | 3300045976 | Bacteria | 2177 |
| 503 | Ga0466967_0187894 | 3300045976 | Bacteria | 1951 |
| 504 | Ga0466967_0201528 | 3300045976 | Bacteria | 1885 |
| 505 | Ga0466967_0831682 | 3300045976 | Unclassified | 917 |
| 506 | Ga0466967_0843493 | 3300045976 | Unclassified | 910 |
| 507 | Ga0466967_1584739 | 3300045976 | Bacteria | 652 |
| 508 | Ga0495603_0195040 | 3300046455 | Bacteria | 1171 |
| 509 | Ga0495629_0068008 | 3300046459 | Bacteria | 2485 |
| 510 | Ga0495629_0483866 | 3300046459 | Bacteria | 836 |
| 511 | Ga0495641_0016250 | 3300046461 | Bacteria | 3928 |
| 512 | Ga0495641_0034906 | 3300046461 | Bacteria | 2374 |
| 513 | Ga0495651_0020085 | 3300046462 | Bacteria | 5184 |
| 514 | Ga0495651_0167721 | 3300046462 | Bacteria | 1567 |
| 515 | Ga0495653_0055308 | 3300046463 | Bacteria | 3028 |
| 516 | Ga0495653_0074089 | 3300046463 | Bacteria | 2538 |
| 517 | Ga0495653_0880739 | 3300046463 | Unclassified | 534 |
| 518 | Ga0495580_0397385 | 3300046472 | Bacteria | 930 |
| 519 | Ga0495582_0002876 | 3300046473 | Bacteria | 9626 |
| 520 | Ga0495582_0212711 | 3300046473 | Bacteria | 1105 |
| 521 | Ga0495582_0568352 | 3300046473 | Bacteria | 656 |
| 522 | Ga0495639_0018327 | 3300046475 | Bacteria | 3047 |
| 523 | Ga0495639_0108682 | 3300046475 | Unclassified | 1314 |
| 524 | Ga0495662_0019397 | 3300046476 | Bacteria | 3288 |
| 525 | Ga0495662_0045733 | 3300046476 | Bacteria | 2113 |
| 526 | Ga0495664_0002450 | 3300046477 | Bacteria | 9984 |
| 527 | Ga0495664_0052571 | 3300046477 | Bacteria | 2421 |
| 528 | Ga0495664_0079993 | 3300046477 | Bacteria | 1958 |
| 529 | Ga0495606_0000072 | 3300046507 | Bacteria | 173678 |
| 530 | Ga0495608_0042303 | 3300046511 | Bacteria | 3046 |
| 531 | Ga0495608_0114171 | 3300046511 | Bacteria | 1734 |
| 532 | Ga0495608_0848705 | 3300046511 | Archaea | 537 |
| 533 | Ga0495618_0047239 | 3300046514 | Bacteria | 2717 |
| 534 | Ga0495618_0706959 | 3300046514 | Unclassified | 592 |
| 535 | Ga0495628_0041347 | 3300046516 | Bacteria | 3679 |
| 536 | Ga0495628_0369597 | 3300046516 | Bacteria | 1052 |
| 537 | Ga0495628_0725432 | 3300046516 | Bacteria | 700 |
| 538 | Ga0495630_0000012 | 3300046517 | Bacteria | 223330 |
| 539 | Ga0495630_0040582 | 3300046517 | Bacteria | 3479 |
| 540 | Ga0495630_0100853 | 3300046517 | Bacteria | 2184 |
| 541 | Ga0495666_0025471 | 3300046526 | Bacteria | 2921 |
| 542 | Ga0495652_0052505 | 3300046529 | Bacteria | 3476 |
| 543 | Ga0495652_0175807 | 3300046529 | Bacteria | 1648 |
| 544 | Ga0495652_0291496 | 3300046529 | Bacteria | 1190 |
| 545 | Ga0495665_0001745 | 3300046531 | Bacteria | 11689 |
| 546 | Ga0495665_0028357 | 3300046531 | Bacteria | 3002 |
| 547 | Ga0495640_0006215 | 3300046533 | Bacteria | 9454 |
| 548 | Ga0495640_0176935 | 3300046533 | Bacteria | 1361 |
| 549 | Ga0495586_0003691 | 3300046535 | Bacteria | 8207 |
| 550 | Ga0495586_0332231 | 3300046535 | Bacteria | 872 |
| 551 | Ga0495587_0026804 | 3300046536 | Bacteria | 3510 |
| 552 | Ga0495645_0189180 | 3300046543 | Bacteria | 1404 |
| 553 | Ga0495645_0211511 | 3300046543 | Bacteria | 1309 |
| 554 | Ga0495645_0262772 | 3300046543 | Bacteria | 1142 |
| 555 | Ga0495667_0059057 | 3300046559 | Bacteria | 2517 |
| 556 | Ga0495634_0211704 | 3300046642 | Bacteria | 1199 |
| 557 | Ga0495634_0504485 | 3300046642 | Bacteria | 709 |
| 558 | Ga0495635_0024877 | 3300046663 | Bacteria | 4172 |
| 559 | Ga0495635_0161383 | 3300046663 | Bacteria | 1525 |
| 560 | Ga0495635_0280850 | 3300046663 | Bacteria | 1118 |
| 561 | Ga0495588_0464983 | 3300046674 | Archaea | 663 |
| 562 | Ga0495657_0005434 | 3300046675 | Bacteria | 10089 |
| 563 | Ga0495657_0079152 | 3300046675 | Bacteria | 2129 |
| 564 | Ga0495657_0384091 | 3300046675 | Bacteria | 828 |
| 565 | Ga0495599_0026464 | 3300046678 | Bacteria | 3635 |
| 566 | Ga0495599_0298953 | 3300046678 | Bacteria | 972 |
| 567 | Ga0495599_0481386 | 3300046678 | Unclassified | 732 |
| 568 | Ga0495646_0084132 | 3300046680 | Bacteria | 1847 |
| 569 | Ga0495658_0222203 | 3300046683 | Bacteria | 1183 |
| 570 | Ga0495613_0032515 | 3300046689 | Bacteria | 3876 |
| 571 | Ga0495613_0451996 | 3300046689 | Bacteria | 870 |
| 572 | Ga0495613_0583601 | 3300046689 | Unclassified | 745 |
| 573 | Ga0495624_0020055 | 3300046690 | Bacteria | 4454 |
| 574 | Ga0495624_0046372 | 3300046690 | Bacteria | 2763 |
| 575 | Ga0495624_0782025 | 3300046690 | Unclassified | 565 |
| 576 | Ga0495600_0008278 | 3300046809 | Bacteria | 6383 |
| 577 | Ga0495600_0347778 | 3300046809 | Bacteria | 929 |
| 578 | Ga0495581_0011873 | 3300047315 | Bacteria | 5041 |
| 579 | Ga0495604_0073009 | 3300047317 | Bacteria | 2591 |
| 580 | Ga0495674_0000950 | 3300047319 | Bacteria | 27650 |
| 581 | Ga0495674_0100208 | 3300047319 | Bacteria | 2465 |
| 582 | Ga0495674_0662663 | 3300047319 | Bacteria | 822 |
| 583 | Ga0495672_0070562 | 3300047320 | Bacteria | 1979 |
| 584 | Ga0495676_0315349 | 3300047321 | Bacteria | 1051 |
| 585 | Ga0495676_0575681 | 3300047321 | Bacteria | 735 |
| 586 | Ga0495680_0007738 | 3300047322 | Bacteria | 9814 |
| 587 | Ga0495680_0057875 | 3300047322 | Bacteria | 2996 |
| 588 | Ga0495680_0370716 | 3300047322 | Bacteria | 993 |
| 589 | Ga0495675_0323080 | 3300047444 | Bacteria | 912 |
| 590 | Ga0495675_0399069 | 3300047444 | Unclassified | 802 |
| 591 | Ga0495684_0043342 | 3300047471 | Bacteria | 3445 |
| 592 | Ga0495684_0135336 | 3300047471 | Bacteria | 1849 |
| 593 | Ga0495684_0335123 | 3300047471 | Bacteria | 1078 |
| 594 | Ga0495593_0001519 | 3300047673 | Bacteria | 13648 |
| 595 | Ga0495593_0099781 | 3300047673 | Bacteria | 1490 |
| 596 | Ga0495593_0167030 | 3300047673 | Bacteria | 1110 |
| 597 | Ga0495602_0072788 | 3300048088 | Bacteria | 2928 |
| 598 | Ga0495614_0403498 | 3300048089 | Bacteria | 642 |
| 599 | Ga0496100_0138840 | 3300048903 | Unclassified | 1720 |
| 600 | Ga0496100_0431138 | 3300048903 | Bacteria | 1008 |
| 601 | Ga0496100_0475623 | 3300048903 | Unclassified | 960 |
| 602 | Ga0496101_0007793 | 3300048904 | Bacteria | 6960 |
| 603 | Ga0496101_0028460 | 3300048904 | Bacteria | 3901 |
| 604 | Ga0496101_0487118 | 3300048904 | Bacteria | 974 |
| 605 | Ga0496101_0573188 | 3300048904 | Bacteria | 892 |
| 606 | Ga0496102_0014198 | 3300048905 | Bacteria | 6920 |
| 607 | Ga0496102_0040050 | 3300048905 | Bacteria | 4237 |
| 608 | Ga0496102_0059205 | 3300048905 | Bacteria | 3502 |
| 609 | Ga0496102_0320742 | 3300048905 | Bacteria | 1459 |
| 610 | Ga0496102_0955857 | 3300048905 | Unclassified | 778 |
| 611 | Ga0496103_0193950 | 3300048906 | Bacteria | 1306 |
| 612 | Ga0496104_0003652 | 3300048907 | Bacteria | 13289 |
| 613 | Ga0496104_0048196 | 3300048907 | Bacteria | 4017 |
| 614 | Ga0496104_0192241 | 3300048907 | Bacteria | 1953 |
| 615 | Ga0496105_0003444 | 3300048908 | Bacteria | 11718 |
| 616 | Ga0496105_0155634 | 3300048908 | Bacteria | 1877 |
| 617 | Ga0496106_0430244 | 3300048909 | Bacteria | 1061 |
| 618 | Ga0496107_0034574 | 3300048910 | Bacteria | 3620 |
| 619 | Ga0496107_0125582 | 3300048910 | Bacteria | 1892 |
| 620 | Ga0496107_1255991 | 3300048910 | Bacteria | 531 |
| 621 | Ga0496108_0011106 | 3300048911 | Bacteria | 7314 |
| 622 | Ga0496108_0124429 | 3300048911 | Bacteria | 2213 |
| 623 | Ga0496108_0274898 | 3300048911 | Unclassified | 1466 |
| 624 | Ga0496108_0367890 | 3300048911 | Bacteria | 1255 |
| 625 | Ga0496108_1073427 | 3300048911 | Bacteria | 685 |
| 626 | Ga0496109_0001465 | 3300048912 | Bacteria | 19579 |
| 627 | Ga0496109_0021563 | 3300048912 | Bacteria | 5698 |
| 628 | Ga0496109_0203799 | 3300048912 | Bacteria | 1860 |
| 629 | Ga0496109_0229947 | 3300048912 | Unclassified | 1744 |
| 630 | Ga0496109_0264757 | 3300048912 | Bacteria | 1619 |
| 631 | Ga0496109_1716844 | 3300048912 | Unclassified | 561 |
| 632 | Ga0496110_0012296 | 3300048913 | Bacteria | 7036 |
| 633 | Ga0496110_0148886 | 3300048913 | Unclassified | 2118 |
| 634 | Ga0496110_0527484 | 3300048913 | Bacteria | 1074 |
| 635 | Ga0496110_0690947 | 3300048913 | Bacteria | 921 |
| 636 | Ga0496111_0003865 | 3300048914 | Bacteria | 9364 |
| 637 | Ga0496111_0111084 | 3300048914 | Bacteria | 2019 |
| 638 | Ga0496111_0192185 | 3300048914 | Bacteria | 1517 |
| 639 | Ga0496111_0768797 | 3300048914 | Unclassified | 698 |
| 640 | Ga0496111_0803148 | 3300048914 | Bacteria | 681 |
| 641 | Ga0496112_0000223 | 3300048915 | Bacteria | 36875 |
| 642 | Ga0496112_0119499 | 3300048915 | Bacteria | 2605 |
| 643 | Ga0496112_0365136 | 3300048915 | Bacteria | 1385 |
| 644 | Ga0496112_0508349 | 3300048915 | Bacteria | 1140 |
| 645 | Ga0496112_1785174 | 3300048915 | Unclassified | 527 |
| 646 | Ga0496113_0019066 | 3300048916 | Bacteria | 4792 |
| 647 | Ga0496113_0039429 | 3300048916 | Bacteria | 3476 |
| 648 | Ga0496113_0185102 | 3300048916 | Bacteria | 1651 |
| 649 | Ga0496114_0003593 | 3300048917 | Bacteria | 11918 |
| 650 | Ga0496114_0023615 | 3300048917 | Bacteria | 5019 |
| 651 | Ga0496114_0030724 | 3300048917 | Bacteria | 4420 |
| 652 | Ga0496114_0043024 | 3300048917 | Bacteria | 3745 |
| 653 | Ga0496115_0006669 | 3300048918 | Bacteria | 8471 |
| 654 | Ga0496115_0040341 | 3300048918 | Bacteria | 3711 |
| 655 | Ga0496115_0084410 | 3300048918 | Bacteria | 2589 |
| 656 | Ga0496117_0428154 | 3300048920 | Unclassified | 660 |
| 657 | Ga0496118_0073155 | 3300048921 | Unclassified | 2457 |
| 658 | Ga0496119_0002281 | 3300048922 | Bacteria | 21246 |
| 659 | Ga0496120_0260269 | 3300048923 | Unclassified | 810 |
| 660 | Ga0501034_1691166 | 3300049571 | Bacteria | 505 |
| 661 | Ga0501036_0599222 | 3300049572 | Bacteria | 914 |
| 662 | Ga0501047_0330285 | 3300049581 | Bacteria | 1363 |
| 663 | Ga0501067_0532668 | 3300049583 | Bacteria | 657 |
| 664 | Ga0501069_0000282 | 3300049585 | Bacteria | 23137 |
| 665 | Ga0501069_0217153 | 3300049585 | Bacteria | 1110 |
| 666 | Ga0501070_0013213 | 3300049586 | Bacteria | 6960 |
| 667 | Ga0501070_0077086 | 3300049586 | Bacteria | 2759 |
| 668 | Ga0501070_0693901 | 3300049586 | Bacteria | 805 |
| 669 | Ga0501074_0309780 | 3300049590 | Bacteria | 1121 |
| 670 | Ga0501076_1510791 | 3300049592 | Unclassified | 551 |
| 671 | Ga0501077_0776441 | 3300049593 | Bacteria | 616 |
| 672 | Ga0501079_0513983 | 3300049741 | Bacteria | 942 |
| 673 | Ga0501081_0433927 | 3300049743 | Bacteria | 975 |
| 674 | Ga0501083_0317020 | 3300049744 | Bacteria | 1014 |
| 675 | Ga0501035_0123223 | 3300049822 | Bacteria | 2264 |
| 676 | Ga0501044_0034408 | 3300049823 | Bacteria | 5314 |
| 677 | nmdc:mga03683_42793_c1 | 3300050489 | Bacteria | 1865 |
| 678 | nmdc:mga0yw44_11369_c1 | 3300050492 | Bacteria | 4590 |
| 679 | nmdc:mga06r32_24217_c1 | 3300050510 | Bacteria | 5630 |
| 680 | nmdc:mga08y16_147269_c1 | 3300050511 | Bacteria | 2448 |
| 681 | nmdc:mga08y16_52930_c1 | 3300050511 | Bacteria | 4245 |
| 682 | nmdc:mga0n895_1009659_c1 | 3300050512 | Bacteria | 813 |
| 683 | nmdc:mga0n895_193714_c1 | 3300050512 | Bacteria | 2064 |
| 684 | nmdc:mga0n895_30643_c1 | 3300050512 | Bacteria | 5143 |
| 685 | nmdc:mga0n895_5571_c1 | 3300050512 | Bacteria | 10543 |
| 686 | nmdc:mga0rr50_120485_c1 | 3300050513 | Bacteria | 2088 |
| 687 | nmdc:mga0rr50_1421086_c1 | 3300050513 | Bacteria | 587 |
| 688 | nmdc:mga0rr50_286568_c1 | 3300050513 | Bacteria | 1375 |
| 689 | nmdc:mga0rr50_434647_c1 | 3300050513 | Bacteria | 1111 |
| 690 | nmdc:mga08x19_267178_c1 | 3300050514 | Unclassified | 1183 |
| 691 | nmdc:mga08x19_562736_c1 | 3300050514 | Unclassified | 807 |
| 692 | nmdc:mga08x19_769993_c1 | 3300050514 | Bacteria | 683 |
| 693 | nmdc:mga0a205_23629_c1 | 3300050515 | Bacteria | 5830 |
| 694 | Ga0495601_0019317 | 3300053077 | Bacteria | 4155 |
| 695 | Ga0495601_0938365 | 3300053077 | Unclassified | 546 |
| 696 | Ga0495612_0009518 | 3300053078 | Bacteria | 3938 |
| 697 | Ga0495612_0212510 | 3300053078 | Bacteria | 855 |
| 698 | Ga0495595_0069736 | 3300053084 | Bacteria | 1660 |
| 699 | Ga0495595_0460014 | 3300053084 | Bacteria | 647 |
| 700 | Ga0495619_0001433 | 3300053085 | Bacteria | 15681 |
| 701 | Ga0495619_0327816 | 3300053085 | Bacteria | 1060 |
| 702 | Ga0500599_005577 | 3300053736 | Bacteria | 1585 |
| 703 | Ga0466962_0003291 | 3300061719 | Bacteria | 7676 |
| 704 | Ga0530510_0267547 | 3300061734 | Bacteria | 1275 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021384 | Ga0213876_10027852 | Ga0213876_100278525 | 123 |
| 2 | 3300039437 | Ga0436365_0269075 | Ga0436365_0269075_2772_3215 | 123 |
| 3 | 3300005471 | Ga0070698_100560259 | Ga0070698_1005602592 | 125 |
| 4 | 3300049583 | Ga0501067_0532668 | Ga0501067_0532668_29_415 | 125 |
| 5 | 3300026078 | Ga0207702_12023540 | Ga0207702_120235401 | 127 |
| 6 | 3300035172 | Ga0373955_0111523 | Ga0373955_0111523_1171_1572 | 128 |
| 7 | 3300038996 | Ga0242420_162430 | Ga0242420_162430_10_411 | 128 |
| 8 | 3300005548 | Ga0070665_100192635 | Ga0070665_1001926352 | 129 |
| 9 | 3300028379 | Ga0268266_10003874 | Ga0268266_1000387424 | 129 |
| 10 | 3300005455 | Ga0070663_100000144 | Ga0070663_10000014410 | 131 |
| 11 | 3300005458 | Ga0070681_10853983 | Ga0070681_108539831 | 131 |
| 12 | 3300005530 | Ga0070679_100015682 | Ga0070679_10001568210 | 131 |
| 13 | 3300025921 | Ga0207652_10000412 | Ga0207652_1000041254 | 131 |
| 14 | 3300025944 | Ga0207661_10674409 | Ga0207661_106744092 | 131 |
| 15 | 3300026067 | Ga0207678_10005062 | Ga0207678_100050625 | 131 |
| 16 | 3300049572 | Ga0501036_0599222 | Ga0501036_0599222_164_577 | 131 |
| 17 | 3300049592 | Ga0501076_1510791 | Ga0501076_1510791_121_534 | 131 |
| 18 | 3300049743 | Ga0501081_0433927 | Ga0501081_0433927_27_440 | 131 |
| 19 | iso_pu_bacteria | 2558860112 | 2558910622 | 132 |
| 20 | 3300005329 | Ga0070683_100014900 | Ga0070683_1000149005 | 133 |
| 21 | 3300005458 | Ga0070681_10133876 | Ga0070681_101338762 | 133 |
| 22 | 3300005530 | Ga0070679_100623173 | Ga0070679_1006231732 | 133 |
| 23 | 3300005535 | Ga0070684_100071244 | Ga0070684_1000712445 | 133 |
| 24 | 3300013105 | Ga0157369_10087088 | Ga0157369_100870882 | 133 |
| 25 | 3300032126 | Ga0307415_100207537 | Ga0307415_1002075372 | 133 |
| 26 | 3300005327 | Ga0070658_10027933 | Ga0070658_100279336 | 134 |
| 27 | 3300005328 | Ga0070676_10056059 | Ga0070676_100560592 | 134 |
| 28 | 3300005329 | Ga0070683_100237568 | Ga0070683_1002375682 | 134 |
| 29 | 3300005330 | Ga0070690_100094889 | Ga0070690_1000948893 | 134 |
| 30 | 3300005331 | Ga0070670_100219618 | Ga0070670_1002196184 | 134 |
| 31 | 3300005334 | Ga0068869_100039143 | Ga0068869_1000391432 | 134 |
| 32 | 3300005335 | Ga0070666_10155703 | Ga0070666_101557033 | 134 |
| 33 | 3300005335 | Ga0070666_10180460 | Ga0070666_101804601 | 134 |
| 34 | 3300005337 | Ga0070682_100024397 | Ga0070682_1000243974 | 134 |
| 35 | 3300005338 | Ga0068868_100022330 | Ga0068868_1000223302 | 134 |
| 36 | 3300005339 | Ga0070660_100208875 | Ga0070660_1002088754 | 134 |
| 37 | 3300005340 | Ga0070689_100007258 | Ga0070689_1000072588 | 134 |
| 38 | 3300005341 | Ga0070691_10048363 | Ga0070691_100483632 | 134 |
| 39 | 3300005344 | Ga0070661_100029994 | Ga0070661_1000299945 | 134 |
| 40 | 3300005345 | Ga0070692_10001194 | Ga0070692_100011943 | 134 |
| 41 | 3300005355 | Ga0070671_100022184 | Ga0070671_1000221847 | 134 |
| 42 | 3300005356 | Ga0070674_100884564 | Ga0070674_1008845642 | 134 |
| 43 | 3300005364 | Ga0070673_100042817 | Ga0070673_1000428172 | 134 |
| 44 | 3300005367 | Ga0070667_100853462 | Ga0070667_1008534622 | 134 |
| 45 | 3300005406 | Ga0070703_10166730 | Ga0070703_101667302 | 134 |
| 46 | 3300005434 | Ga0070709_10002975 | Ga0070709_100029756 | 134 |
| 47 | 3300005434 | Ga0070709_10447888 | Ga0070709_104478882 | 134 |
| 48 | 3300005435 | Ga0070714_100279211 | Ga0070714_1002792112 | 134 |
| 49 | 3300005436 | Ga0070713_100004650 | Ga0070713_1000046504 | 134 |
| 50 | 3300005437 | Ga0070710_10379480 | Ga0070710_103794802 | 134 |
| 51 | 3300005438 | Ga0070701_11243766 | Ga0070701_112437661 | 134 |
| 52 | 3300005439 | Ga0070711_100383181 | Ga0070711_1003831812 | 134 |
| 53 | 3300005439 | Ga0070711_101150953 | Ga0070711_1011509531 | 134 |
| 54 | 3300005439 | Ga0070711_101391751 | Ga0070711_1013917511 | 134 |
| 55 | 3300005441 | Ga0070700_100201616 | Ga0070700_1002016161 | 134 |
| 56 | 3300005455 | Ga0070663_100023438 | Ga0070663_1000234382 | 134 |
| 57 | 3300005456 | Ga0070678_100003038 | Ga0070678_10000303810 | 134 |
| 58 | 3300005457 | Ga0070662_100295286 | Ga0070662_1002952863 | 134 |
| 59 | 3300005458 | Ga0070681_10078231 | Ga0070681_100782313 | 134 |
| 60 | 3300005467 | Ga0070706_100184362 | Ga0070706_1001843622 | 134 |
| 61 | 3300005468 | Ga0070707_100161746 | Ga0070707_1001617463 | 134 |
| 62 | 3300005471 | Ga0070698_100005777 | Ga0070698_1000057771 | 134 |
| 63 | 3300005518 | Ga0070699_100366404 | Ga0070699_1003664042 | 134 |
| 64 | 3300005530 | Ga0070679_100190945 | Ga0070679_1001909452 | 134 |
| 65 | 3300005530 | Ga0070679_101166119 | Ga0070679_1011661191 | 134 |
| 66 | 3300005535 | Ga0070684_100750595 | Ga0070684_1007505952 | 134 |
| 67 | 3300005536 | Ga0070697_102090157 | Ga0070697_1020901571 | 134 |
| 68 | 3300005539 | Ga0068853_100028168 | Ga0068853_1000281683 | 134 |
| 69 | 3300005544 | Ga0070686_100042982 | Ga0070686_1000429824 | 134 |
| 70 | 3300005546 | Ga0070696_100262156 | Ga0070696_1002621562 | 134 |
| 71 | 3300005546 | Ga0070696_100628620 | Ga0070696_1006286201 | 134 |
| 72 | 3300005547 | Ga0070693_100002404 | Ga0070693_1000024048 | 134 |
| 73 | 3300005548 | Ga0070665_100068119 | Ga0070665_1000681193 | 134 |
| 74 | 3300005549 | Ga0070704_100179008 | Ga0070704_1001790081 | 134 |
| 75 | 3300005563 | Ga0068855_100619163 | Ga0068855_1006191632 | 134 |
| 76 | 3300005577 | Ga0068857_100564758 | Ga0068857_1005647582 | 134 |
| 77 | 3300005578 | Ga0068854_100126579 | Ga0068854_1001265794 | 134 |
| 78 | 3300005614 | Ga0068856_100044737 | Ga0068856_1000447372 | 134 |
| 79 | 3300005615 | Ga0070702_100004197 | Ga0070702_1000041979 | 134 |
| 80 | 3300005616 | Ga0068852_100154339 | Ga0068852_1001543392 | 134 |
| 81 | 3300005617 | Ga0068859_100179367 | Ga0068859_1001793673 | 134 |
| 82 | 3300005618 | Ga0068864_100072812 | Ga0068864_1000728122 | 134 |
| 83 | 3300005718 | Ga0068866_11118809 | Ga0068866_111188091 | 134 |
| 84 | 3300005719 | Ga0068861_100739580 | Ga0068861_1007395802 | 134 |
| 85 | 3300005834 | Ga0068851_10045306 | Ga0068851_100453061 | 134 |
| 86 | 3300005840 | Ga0068870_10011849 | Ga0068870_100118493 | 134 |
| 87 | 3300005841 | Ga0068863_100023339 | Ga0068863_1000233393 | 134 |
| 88 | 3300005841 | Ga0068863_100132270 | Ga0068863_1001322701 | 134 |
| 89 | 3300005842 | Ga0068858_100129331 | Ga0068858_1001293313 | 134 |
| 90 | 3300005843 | Ga0068860_100380938 | Ga0068860_1003809382 | 134 |
| 91 | 3300005937 | Ga0081455_10000542 | Ga0081455_1000054234 | 134 |
| 92 | 3300006028 | Ga0070717_10030258 | Ga0070717_100302584 | 134 |
| 93 | 3300006028 | Ga0070717_10226736 | Ga0070717_102267362 | 134 |
| 94 | 3300006028 | Ga0070717_10586644 | Ga0070717_105866442 | 134 |
| 95 | 3300006058 | Ga0075432_10004310 | Ga0075432_100043105 | 134 |
| 96 | 3300006173 | Ga0070716_100378839 | Ga0070716_1003788392 | 134 |
| 97 | 3300006173 | Ga0070716_100900409 | Ga0070716_1009004092 | 134 |
| 98 | 3300006175 | Ga0070712_100000007 | Ga0070712_100000007139 | 134 |
| 99 | 3300006237 | Ga0097621_100015785 | Ga0097621_1000157856 | 134 |
| 100 | 3300006358 | Ga0068871_100014196 | Ga0068871_1000141966 | 134 |
| 101 | 3300006844 | Ga0075428_100241925 | Ga0075428_1002419252 | 134 |
| 102 | 3300006847 | Ga0075431_100008020 | Ga0075431_1000080209 | 134 |
| 103 | 3300006852 | Ga0075433_10231808 | Ga0075433_102318083 | 134 |
| 104 | 3300006871 | Ga0075434_100000742 | Ga0075434_1000007423 | 134 |
| 105 | 3300006871 | Ga0075434_101134826 | Ga0075434_1011348261 | 134 |
| 106 | 3300006880 | Ga0075429_100164136 | Ga0075429_1001641362 | 134 |
| 107 | 3300006914 | Ga0075436_100014930 | Ga0075436_1000149305 | 134 |
| 108 | 3300006931 | Ga0097620_100179370 | Ga0097620_1001793702 | 134 |
| 109 | 3300007076 | Ga0075435_100007053 | Ga0075435_1000070539 | 134 |
| 110 | 3300007076 | Ga0075435_100071170 | Ga0075435_1000711705 | 134 |
| 111 | 3300007076 | Ga0075435_100169397 | Ga0075435_1001693972 | 134 |
| 112 | 3300007076 | Ga0075435_100361986 | Ga0075435_1003619862 | 134 |
| 113 | 3300009011 | Ga0105251_10175895 | Ga0105251_101758952 | 134 |
| 114 | 3300009092 | Ga0105250_10186135 | Ga0105250_101861351 | 134 |
| 115 | 3300009093 | Ga0105240_10086849 | Ga0105240_100868492 | 134 |
| 116 | 3300009093 | Ga0105240_10262917 | Ga0105240_102629173 | 134 |
| 117 | 3300009098 | Ga0105245_10075298 | Ga0105245_100752984 | 134 |
| 118 | 3300009101 | Ga0105247_10006206 | Ga0105247_100062069 | 134 |
| 119 | 3300009147 | Ga0114129_10475272 | Ga0114129_104752722 | 134 |
| 120 | 3300009148 | Ga0105243_10091538 | Ga0105243_100915382 | 134 |
| 121 | 3300009174 | Ga0105241_10013186 | Ga0105241_100131869 | 134 |
| 122 | 3300009174 | Ga0105241_10236885 | Ga0105241_102368852 | 134 |
| 123 | 3300009174 | Ga0105241_12235018 | Ga0105241_122350181 | 134 |
| 124 | 3300009176 | Ga0105242_11864342 | Ga0105242_118643421 | 134 |
| 125 | 3300009177 | Ga0105248_10006412 | Ga0105248_1000641214 | 134 |
| 126 | 3300009545 | Ga0105237_10041786 | Ga0105237_100417862 | 134 |
| 127 | 3300009551 | Ga0105238_10152529 | Ga0105238_101525292 | 134 |
| 128 | 3300009551 | Ga0105238_11192913 | Ga0105238_111929132 | 134 |
| 129 | 3300010375 | Ga0105239_10162899 | Ga0105239_101628993 | 134 |
| 130 | 3300010375 | Ga0105239_10190185 | Ga0105239_101901852 | 134 |
| 131 | 3300011119 | Ga0105246_10005601 | Ga0105246_100056013 | 134 |
| 132 | 3300012492 | Ga0157335_1014925 | Ga0157335_10149251 | 134 |
| 133 | 3300012507 | Ga0157342_1015969 | Ga0157342_10159691 | 134 |
| 134 | 3300013100 | Ga0157373_10122709 | Ga0157373_101227092 | 134 |
| 135 | 3300013102 | Ga0157371_10004675 | Ga0157371_100046759 | 134 |
| 136 | 3300013104 | Ga0157370_10010260 | Ga0157370_100102605 | 134 |
| 137 | 3300013105 | Ga0157369_10709947 | Ga0157369_107099471 | 134 |
| 138 | 3300013307 | Ga0157372_11091984 | Ga0157372_110919841 | 134 |
| 139 | 3300013308 | Ga0157375_10207305 | Ga0157375_102073052 | 134 |
| 140 | 3300014497 | Ga0182008_10103285 | Ga0182008_101032852 | 134 |
| 141 | 3300014745 | Ga0157377_10064923 | Ga0157377_100649233 | 134 |
| 142 | 3300014969 | Ga0157376_10201484 | Ga0157376_102014842 | 134 |
| 143 | 3300014969 | Ga0157376_10248943 | Ga0157376_102489432 | 134 |
| 144 | 3300014969 | Ga0157376_11767599 | Ga0157376_117675992 | 134 |
| 145 | 3300020070 | Ga0206356_10440670 | Ga0206356_104406702 | 134 |
| 146 | 3300020081 | Ga0206354_10158039 | Ga0206354_101580393 | 134 |
| 147 | 3300020610 | Ga0154015_1020453 | Ga0154015_10204531 | 134 |
| 148 | 3300022467 | Ga0224712_10047511 | Ga0224712_100475112 | 134 |
| 149 | 3300025321 | Ga0207656_10036921 | Ga0207656_100369212 | 134 |
| 150 | 3300025898 | Ga0207692_10364939 | Ga0207692_103649391 | 134 |
| 151 | 3300025899 | Ga0207642_10158632 | Ga0207642_101586321 | 134 |
| 152 | 3300025900 | Ga0207710_10066370 | Ga0207710_100663701 | 134 |
| 153 | 3300025901 | Ga0207688_10002541 | Ga0207688_1000254111 | 134 |
| 154 | 3300025903 | Ga0207680_10869450 | Ga0207680_108694502 | 134 |
| 155 | 3300025904 | Ga0207647_10619779 | Ga0207647_106197791 | 134 |
| 156 | 3300025905 | Ga0207685_10037296 | Ga0207685_100372965 | 134 |
| 157 | 3300025905 | Ga0207685_10045161 | Ga0207685_100451611 | 134 |
| 158 | 3300025906 | Ga0207699_10176053 | Ga0207699_101760532 | 134 |
| 159 | 3300025906 | Ga0207699_10526828 | Ga0207699_105268283 | 134 |
| 160 | 3300025907 | Ga0207645_10031262 | Ga0207645_100312622 | 134 |
| 161 | 3300025908 | Ga0207643_10001055 | Ga0207643_1000105516 | 134 |
| 162 | 3300025909 | Ga0207705_10643755 | Ga0207705_106437552 | 134 |
| 163 | 3300025910 | Ga0207684_10406807 | Ga0207684_104068071 | 134 |
| 164 | 3300025911 | Ga0207654_10076824 | Ga0207654_100768242 | 134 |
| 165 | 3300025912 | Ga0207707_10123728 | Ga0207707_101237282 | 134 |
| 166 | 3300025912 | Ga0207707_10504911 | Ga0207707_105049111 | 134 |
| 167 | 3300025913 | Ga0207695_10073738 | Ga0207695_100737384 | 134 |
| 168 | 3300025914 | Ga0207671_10096589 | Ga0207671_100965892 | 134 |
| 169 | 3300025915 | Ga0207693_10000001 | Ga0207693_10000001297 | 134 |
| 170 | 3300025915 | Ga0207693_10033818 | Ga0207693_100338182 | 134 |
| 171 | 3300025916 | Ga0207663_10145357 | Ga0207663_101453572 | 134 |
| 172 | 3300025916 | Ga0207663_10622881 | Ga0207663_106228812 | 134 |
| 173 | 3300025916 | Ga0207663_11597364 | Ga0207663_115973641 | 134 |
| 174 | 3300025917 | Ga0207660_10422622 | Ga0207660_104226222 | 134 |
| 175 | 3300025918 | Ga0207662_10092622 | Ga0207662_100926221 | 134 |
| 176 | 3300025919 | Ga0207657_10030617 | Ga0207657_100306178 | 134 |
| 177 | 3300025920 | Ga0207649_10011601 | Ga0207649_100116013 | 134 |
| 178 | 3300025921 | Ga0207652_10027531 | Ga0207652_100275315 | 134 |
| 179 | 3300025921 | Ga0207652_11033740 | Ga0207652_110337402 | 134 |
| 180 | 3300025924 | Ga0207694_10058809 | Ga0207694_100588093 | 134 |
| 181 | 3300025925 | Ga0207650_10247525 | Ga0207650_102475252 | 134 |
| 182 | 3300025926 | Ga0207659_10034790 | Ga0207659_100347904 | 134 |
| 183 | 3300025927 | Ga0207687_10065660 | Ga0207687_100656602 | 134 |
| 184 | 3300025928 | Ga0207700_10389082 | Ga0207700_103890822 | 134 |
| 185 | 3300025928 | Ga0207700_11126628 | Ga0207700_111266281 | 134 |
| 186 | 3300025929 | Ga0207664_10100894 | Ga0207664_101008943 | 134 |
| 187 | 3300025929 | Ga0207664_10543438 | Ga0207664_105434382 | 134 |
| 188 | 3300025929 | Ga0207664_11399235 | Ga0207664_113992351 | 134 |
| 189 | 3300025931 | Ga0207644_10006498 | Ga0207644_100064982 | 134 |
| 190 | 3300025932 | Ga0207690_10016448 | Ga0207690_100164485 | 134 |
| 191 | 3300025933 | Ga0207706_10152776 | Ga0207706_101527762 | 134 |
| 192 | 3300025934 | Ga0207686_10540711 | Ga0207686_105407111 | 134 |
| 193 | 3300025936 | Ga0207670_10006234 | Ga0207670_100062348 | 134 |
| 194 | 3300025937 | Ga0207669_10046155 | Ga0207669_100461553 | 134 |
| 195 | 3300025937 | Ga0207669_11053146 | Ga0207669_110531462 | 134 |
| 196 | 3300025939 | Ga0207665_10093789 | Ga0207665_100937892 | 134 |
| 197 | 3300025939 | Ga0207665_10130305 | Ga0207665_101303052 | 134 |
| 198 | 3300025939 | Ga0207665_10149338 | Ga0207665_101493383 | 134 |
| 199 | 3300025940 | Ga0207691_10015445 | Ga0207691_100154454 | 134 |
| 200 | 3300025941 | Ga0207711_10030349 | Ga0207711_100303492 | 134 |
| 201 | 3300025942 | Ga0207689_10000708 | Ga0207689_1000070827 | 134 |
| 202 | 3300025944 | Ga0207661_10001919 | Ga0207661_1000191910 | 134 |
| 203 | 3300025944 | Ga0207661_10532482 | Ga0207661_105324822 | 134 |
| 204 | 3300025945 | Ga0207679_10014099 | Ga0207679_100140991 | 134 |
| 205 | 3300025949 | Ga0207667_10190314 | Ga0207667_101903142 | 134 |
| 206 | 3300025960 | Ga0207651_10333038 | Ga0207651_103330382 | 134 |
| 207 | 3300025981 | Ga0207640_10172726 | Ga0207640_101727262 | 134 |
| 208 | 3300025986 | Ga0207658_10131321 | Ga0207658_101313215 | 134 |
| 209 | 3300025986 | Ga0207658_10939703 | Ga0207658_109397032 | 134 |
| 210 | 3300026023 | Ga0207677_10172632 | Ga0207677_101726322 | 134 |
| 211 | 3300026023 | Ga0207677_10251576 | Ga0207677_102515762 | 134 |
| 212 | 3300026041 | Ga0207639_10451424 | Ga0207639_104514242 | 134 |
| 213 | 3300026067 | Ga0207678_10000678 | Ga0207678_1000067824 | 134 |
| 214 | 3300026075 | Ga0207708_10018251 | Ga0207708_100182516 | 134 |
| 215 | 3300026075 | Ga0207708_10143496 | Ga0207708_101434964 | 134 |
| 216 | 3300026078 | Ga0207702_10001500 | Ga0207702_100015006 | 134 |
| 217 | 3300026078 | Ga0207702_10006613 | Ga0207702_100066132 | 134 |
| 218 | 3300026088 | Ga0207641_10022836 | Ga0207641_100228367 | 134 |
| 219 | 3300026095 | Ga0207676_10003065 | Ga0207676_100030659 | 134 |
| 220 | 3300026116 | Ga0207674_11598979 | Ga0207674_115989791 | 134 |
| 221 | 3300026121 | Ga0207683_10001770 | Ga0207683_1000177011 | 134 |
| 222 | 3300026142 | Ga0207698_10009446 | Ga0207698_100094463 | 134 |
| 223 | 3300026142 | Ga0207698_10276329 | Ga0207698_102763292 | 134 |
| 224 | 3300026142 | Ga0207698_11257545 | Ga0207698_112575452 | 134 |
| 225 | 3300027907 | Ga0207428_10061392 | Ga0207428_100613923 | 134 |
| 226 | 3300028379 | Ga0268266_10098073 | Ga0268266_100980733 | 134 |
| 227 | 3300028379 | Ga0268266_10421802 | Ga0268266_104218021 | 134 |
| 228 | 3300028381 | Ga0268264_10808089 | Ga0268264_108080892 | 134 |
| 229 | 3300035112 | Ga0373932_0377400 | Ga0373932_0377400_102_533 | 134 |
| 230 | 3300035121 | Ga0373960_0239036 | Ga0373960_0239036_156_587 | 134 |
| 231 | 3300035242 | Ga0373962_0313172 | Ga0373962_0313172_23_454 | 134 |
| 232 | 3300035691 | Ga0373931_0019717 | Ga0373931_0019717_1434_1865 | 134 |
| 233 | 3300037418 | Ga0395900_0153125 | Ga0395900_0153125_1022_1435 | 134 |
| 234 | 3300037466 | Ga0395898_0004157 | Ga0395898_0004157_15078_15491 | 134 |
| 235 | 3300037466 | Ga0395898_0170429 | Ga0395898_0170429_1612_2025 | 134 |
| 236 | 3300037471 | Ga0395905_0050846 | Ga0395905_0050846_1327_1740 | 134 |
| 237 | 3300038443 | Ga0395901_0085959 | Ga0395901_0085959_921_1334 | 134 |
| 238 | 3300038443 | Ga0395901_1456493 | Ga0395901_1456493_197_610 | 134 |
| 239 | 3300042005 | Ga0439448_0012929 | Ga0439448_0012929_363_776 | 134 |
| 240 | 3300042157 | Ga0439458_0216288 | Ga0439458_0216288_75_488 | 134 |
| 241 | 3300042438 | Ga0439459_0002289 | Ga0439459_0002289_417_830 | 134 |
| 242 | 3300044658 | Ga0466972_0169321 | Ga0466972_0169321_11_424 | 134 |
| 243 | 3300044693 | Ga0466961_0042573 | Ga0466961_0042573_1670_2083 | 134 |
| 244 | 3300044735 | Ga0466968_0559467 | Ga0466968_0559467_32_445 | 134 |
| 245 | 3300045049 | Ga0466959_0725461 | Ga0466959_0725461_209_622 | 134 |
| 246 | 3300045976 | Ga0466967_0003925 | Ga0466967_0003925_858_1271 | 134 |
| 247 | 3300045976 | Ga0466967_0201528 | Ga0466967_0201528_1440_1853 | 134 |
| 248 | 3300045976 | Ga0466967_0831682 | Ga0466967_0831682_62_475 | 134 |
| 249 | 3300047320 | Ga0495672_0070562 | Ga0495672_0070562_788_1198 | 134 |
| 250 | 3300048904 | Ga0496101_0487118 | Ga0496101_0487118_461_874 | 134 |
| 251 | 3300048904 | Ga0496101_0573188 | Ga0496101_0573188_140_601 | 134 |
| 252 | 3300048905 | Ga0496102_0059205 | Ga0496102_0059205_979_1392 | 134 |
| 253 | 3300048906 | Ga0496103_0193950 | Ga0496103_0193950_18_431 | 134 |
| 254 | 3300048907 | Ga0496104_0003652 | Ga0496104_0003652_8003_8416 | 134 |
| 255 | 3300048908 | Ga0496105_0003444 | Ga0496105_0003444_3455_3868 | 134 |
| 256 | 3300048910 | Ga0496107_1255991 | Ga0496107_1255991_15_428 | 134 |
| 257 | 3300048911 | Ga0496108_0011106 | Ga0496108_0011106_786_1199 | 134 |
| 258 | 3300048911 | Ga0496108_0124429 | Ga0496108_0124429_559_972 | 134 |
| 259 | 3300048911 | Ga0496108_0367890 | Ga0496108_0367890_687_1097 | 134 |
| 260 | 3300048912 | Ga0496109_0229947 | Ga0496109_0229947_99_509 | 134 |
| 261 | 3300048912 | Ga0496109_0264757 | Ga0496109_0264757_623_1036 | 134 |
| 262 | 3300048913 | Ga0496110_0012296 | Ga0496110_0012296_6391_6804 | 134 |
| 263 | 3300048913 | Ga0496110_0690947 | Ga0496110_0690947_291_704 | 134 |
| 264 | 3300048914 | Ga0496111_0111084 | Ga0496111_0111084_362_778 | 134 |
| 265 | 3300048914 | Ga0496111_0192185 | Ga0496111_0192185_594_1007 | 134 |
| 266 | 3300048915 | Ga0496112_0000223 | Ga0496112_0000223_30517_30930 | 134 |
| 267 | 3300048915 | Ga0496112_0119499 | Ga0496112_0119499_1684_2097 | 134 |
| 268 | 3300048915 | Ga0496112_0508349 | Ga0496112_0508349_269_682 | 134 |
| 269 | 3300048916 | Ga0496113_0039429 | Ga0496113_0039429_2711_3124 | 134 |
| 270 | 3300048917 | Ga0496114_0043024 | Ga0496114_0043024_1102_1533 | 134 |
| 271 | 3300048920 | Ga0496117_0428154 | Ga0496117_0428154_172_585 | 134 |
| 272 | 3300048921 | Ga0496118_0073155 | Ga0496118_0073155_834_1247 | 134 |
| 273 | 3300048922 | Ga0496119_0002281 | Ga0496119_0002281_220_633 | 134 |
| 274 | 3300048923 | Ga0496120_0260269 | Ga0496120_0260269_230_643 | 134 |
| 275 | 3300049571 | Ga0501034_1691166 | Ga0501034_1691166_37_450 | 134 |
| 276 | 3300049581 | Ga0501047_0330285 | Ga0501047_0330285_737_1150 | 134 |
| 277 | 3300049585 | Ga0501069_0000282 | Ga0501069_0000282_2326_2739 | 134 |
| 278 | 3300049586 | Ga0501070_0013213 | Ga0501070_0013213_981_1394 | 134 |
| 279 | 3300049586 | Ga0501070_0077086 | Ga0501070_0077086_1707_2120 | 134 |
| 280 | 3300049590 | Ga0501074_0309780 | Ga0501074_0309780_663_1076 | 134 |
| 281 | 3300049741 | Ga0501079_0513983 | Ga0501079_0513983_495_908 | 134 |
| 282 | 3300049744 | Ga0501083_0317020 | Ga0501083_0317020_83_496 | 134 |
| 283 | 3300049823 | Ga0501044_0034408 | Ga0501044_0034408_1526_1939 | 134 |
| 284 | 3300050510 | nmdc:mga06r32_24217_c1 | nmdc:mga06r32_24217_c1_3461_3874 | 134 |
| 285 | 3300050511 | nmdc:mga08y16_147269_c1 | nmdc:mga08y16_147269_c1_1211_1624 | 134 |
| 286 | 3300050511 | nmdc:mga08y16_52930_c1 | nmdc:mga08y16_52930_c1_3627_4040 | 134 |
| 287 | 3300050512 | nmdc:mga0n895_193714_c1 | nmdc:mga0n895_193714_c1_1631_2044 | 134 |
| 288 | 3300050512 | nmdc:mga0n895_30643_c1 | nmdc:mga0n895_30643_c1_2764_3177 | 134 |
| 289 | 3300050513 | nmdc:mga0rr50_120485_c1 | nmdc:mga0rr50_120485_c1_817_1230 | 134 |
| 290 | 3300050513 | nmdc:mga0rr50_286568_c1 | nmdc:mga0rr50_286568_c1_775_1188 | 134 |
| 291 | 3300050513 | nmdc:mga0rr50_434647_c1 | nmdc:mga0rr50_434647_c1_178_585 | 134 |
| 292 | 3300050514 | nmdc:mga08x19_769993_c1 | nmdc:mga08x19_769993_c1_248_661 | 134 |
| 293 | 3300050515 | nmdc:mga0a205_23629_c1 | nmdc:mga0a205_23629_c1_870_1283 | 134 |
| 294 | 3300005336 | Ga0070680_100000411 | Ga0070680_10000041117 | 135 |
| 295 | 3300005336 | Ga0070680_100160764 | Ga0070680_1001607641 | 135 |
| 296 | 3300005336 | Ga0070680_100646700 | Ga0070680_1006467003 | 135 |
| 297 | 3300005356 | Ga0070674_101448654 | Ga0070674_1014486541 | 135 |
| 298 | 3300005435 | Ga0070714_100600295 | Ga0070714_1006002952 | 135 |
| 299 | 3300005456 | Ga0070678_100450557 | Ga0070678_1004505572 | 135 |
| 300 | 3300005458 | Ga0070681_10000583 | Ga0070681_1000058323 | 135 |
| 301 | 3300005458 | Ga0070681_11175204 | Ga0070681_111752042 | 135 |
| 302 | 3300005530 | Ga0070679_100000628 | Ga0070679_10000062822 | 135 |
| 303 | 3300005530 | Ga0070679_100440639 | Ga0070679_1004406392 | 135 |
| 304 | 3300005549 | Ga0070704_101523898 | Ga0070704_1015238981 | 135 |
| 305 | 3300005614 | Ga0068856_101031828 | Ga0068856_1010318282 | 135 |
| 306 | 3300005616 | Ga0068852_100620467 | Ga0068852_1006204672 | 135 |
| 307 | 3300005718 | Ga0068866_10076750 | Ga0068866_100767502 | 135 |
| 308 | 3300005719 | Ga0068861_100410889 | Ga0068861_1004108893 | 135 |
| 309 | 3300005841 | Ga0068863_101003968 | Ga0068863_1010039681 | 135 |
| 310 | 3300005983 | Ga0081540_1001501 | Ga0081540_10015016 | 135 |
| 311 | 3300006175 | Ga0070712_100807387 | Ga0070712_1008073872 | 135 |
| 312 | 3300006353 | Ga0075370_10092772 | Ga0075370_100927723 | 135 |
| 313 | 3300006871 | Ga0075434_100059963 | Ga0075434_1000599632 | 135 |
| 314 | 3300009177 | Ga0105248_10263730 | Ga0105248_102637302 | 135 |
| 315 | 3300009545 | Ga0105237_10000431 | Ga0105237_1000043151 | 135 |
| 316 | 3300009545 | Ga0105237_10048028 | Ga0105237_100480284 | 135 |
| 317 | 3300009545 | Ga0105237_11397875 | Ga0105237_113978751 | 135 |
| 318 | 3300010375 | Ga0105239_10366803 | Ga0105239_103668033 | 135 |
| 319 | 3300013306 | Ga0163162_10596866 | Ga0163162_105968661 | 135 |
| 320 | 3300013306 | Ga0163162_10681386 | Ga0163162_106813862 | 135 |
| 321 | 3300014325 | Ga0163163_12656005 | Ga0163163_126560051 | 135 |
| 322 | 3300014968 | Ga0157379_12081839 | Ga0157379_120818391 | 135 |
| 323 | 3300020081 | Ga0206354_11596033 | Ga0206354_115960331 | 135 |
| 324 | 3300025899 | Ga0207642_10026343 | Ga0207642_100263432 | 135 |
| 325 | 3300025904 | Ga0207647_10046884 | Ga0207647_100468842 | 135 |
| 326 | 3300025904 | Ga0207647_10085489 | Ga0207647_100854892 | 135 |
| 327 | 3300025912 | Ga0207707_10000798 | Ga0207707_1000079818 | 135 |
| 328 | 3300025912 | Ga0207707_11622124 | Ga0207707_116221241 | 135 |
| 329 | 3300025914 | Ga0207671_10003870 | Ga0207671_1000387010 | 135 |
| 330 | 3300025914 | Ga0207671_10073956 | Ga0207671_100739562 | 135 |
| 331 | 3300025917 | Ga0207660_10001508 | Ga0207660_100015087 | 135 |
| 332 | 3300025917 | Ga0207660_10436486 | Ga0207660_104364861 | 135 |
| 333 | 3300025921 | Ga0207652_10000802 | Ga0207652_1000080220 | 135 |
| 334 | 3300025941 | Ga0207711_10208103 | Ga0207711_102081032 | 135 |
| 335 | 3300025944 | Ga0207661_10284928 | Ga0207661_102849282 | 135 |
| 336 | 3300025949 | Ga0207667_10017863 | Ga0207667_100178634 | 135 |
| 337 | 3300025972 | Ga0207668_10328406 | Ga0207668_103284062 | 135 |
| 338 | 3300026118 | Ga0207675_100187629 | Ga0207675_1001876293 | 135 |
| 339 | 3300026118 | Ga0207675_101839872 | Ga0207675_1018398721 | 135 |
| 340 | 3300026121 | Ga0207683_10661245 | Ga0207683_106612452 | 135 |
| 341 | 3300026142 | Ga0207698_11260511 | Ga0207698_112605112 | 135 |
| 342 | 3300028379 | Ga0268266_11289339 | Ga0268266_112893391 | 135 |
| 343 | 3300031824 | Ga0307413_11086023 | Ga0307413_110860231 | 135 |
| 344 | 3300031995 | Ga0307409_100347047 | Ga0307409_1003470471 | 135 |
| 345 | 3300032126 | Ga0307415_100055564 | Ga0307415_1000555643 | 135 |
| 346 | 3300035083 | Ga0373926_0039397 | Ga0373926_0039397_1189_1605 | 135 |
| 347 | 3300035089 | Ga0373944_0004991 | Ga0373944_0004991_475_891 | 135 |
| 348 | 3300035113 | Ga0373936_0023688 | Ga0373936_0023688_1137_1553 | 135 |
| 349 | 3300035116 | Ga0373945_0000322 | Ga0373945_0000322_12403_12819 | 135 |
| 350 | 3300035170 | Ga0373943_0007226 | Ga0373943_0007226_3363_3779 | 135 |
| 351 | 3300035171 | Ga0373946_0044755 | Ga0373946_0044755_1190_1606 | 135 |
| 352 | 3300035172 | Ga0373955_0431693 | Ga0373955_0431693_244_660 | 135 |
| 353 | 3300035241 | Ga0373961_0200731 | Ga0373961_0200731_216_641 | 135 |
| 354 | 3300035410 | Ga0373924_0181056 | Ga0373924_0181056_127_543 | 135 |
| 355 | 3300035692 | Ga0373935_0001388 | Ga0373935_0001388_11790_12206 | 135 |
| 356 | 3300035695 | Ga0373927_0002855 | Ga0373927_0002855_11393_11809 | 135 |
| 357 | 3300035725 | Ga0373947_0001825 | Ga0373947_0001825_1209_1625 | 135 |
| 358 | 3300036401 | Ga0373937_0184384 | Ga0373937_0184384_557_973 | 135 |
| 359 | 3300037068 | Ga0373925_0087327 | Ga0373925_0087327_977_1393 | 135 |
| 360 | 3300044694 | Ga0466963_0377094 | Ga0466963_0377094_383_799 | 135 |
| 361 | 3300045836 | Ga0466958_0020079 | Ga0466958_0020079_367_789 | 135 |
| 362 | 3300045976 | Ga0466967_0150199 | Ga0466967_0150199_131_547 | 135 |
| 363 | 3300046455 | Ga0495603_0195040 | Ga0495603_0195040_221_637 | 135 |
| 364 | 3300046459 | Ga0495629_0483866 | Ga0495629_0483866_47_463 | 135 |
| 365 | 3300046461 | Ga0495641_0034906 | Ga0495641_0034906_1791_2207 | 135 |
| 366 | 3300046462 | Ga0495651_0167721 | Ga0495651_0167721_836_1252 | 135 |
| 367 | 3300046463 | Ga0495653_0074089 | Ga0495653_0074089_1276_1692 | 135 |
| 368 | 3300046463 | Ga0495653_0880739 | Ga0495653_0880739_68_484 | 135 |
| 369 | 3300046473 | Ga0495582_0212711 | Ga0495582_0212711_607_1023 | 135 |
| 370 | 3300046473 | Ga0495582_0568352 | Ga0495582_0568352_202_618 | 135 |
| 371 | 3300046475 | Ga0495639_0108682 | Ga0495639_0108682_683_1099 | 135 |
| 372 | 3300046477 | Ga0495664_0052571 | Ga0495664_0052571_1175_1591 | 135 |
| 373 | 3300046507 | Ga0495606_0000072 | Ga0495606_0000072_45567_45983 | 135 |
| 374 | 3300046511 | Ga0495608_0114171 | Ga0495608_0114171_497_913 | 135 |
| 375 | 3300046511 | Ga0495608_0848705 | Ga0495608_0848705_20_436 | 135 |
| 376 | 3300046514 | Ga0495618_0706959 | Ga0495618_0706959_118_534 | 135 |
| 377 | 3300046517 | Ga0495630_0000012 | Ga0495630_0000012_182348_182764 | 135 |
| 378 | 3300046517 | Ga0495630_0100853 | Ga0495630_0100853_850_1266 | 135 |
| 379 | 3300046529 | Ga0495652_0291496 | Ga0495652_0291496_591_1007 | 135 |
| 380 | 3300046531 | Ga0495665_0028357 | Ga0495665_0028357_1713_2129 | 135 |
| 381 | 3300046543 | Ga0495645_0189180 | Ga0495645_0189180_108_524 | 135 |
| 382 | 3300046559 | Ga0495667_0059057 | Ga0495667_0059057_825_1241 | 135 |
| 383 | 3300046642 | Ga0495634_0211704 | Ga0495634_0211704_139_555 | 135 |
| 384 | 3300046663 | Ga0495635_0024877 | Ga0495635_0024877_2769_3185 | 135 |
| 385 | 3300046674 | Ga0495588_0464983 | Ga0495588_0464983_139_555 | 135 |
| 386 | 3300046675 | Ga0495657_0079152 | Ga0495657_0079152_785_1201 | 135 |
| 387 | 3300046675 | Ga0495657_0384091 | Ga0495657_0384091_71_487 | 135 |
| 388 | 3300046678 | Ga0495599_0481386 | Ga0495599_0481386_153_569 | 135 |
| 389 | 3300046683 | Ga0495658_0222203 | Ga0495658_0222203_301_717 | 135 |
| 390 | 3300046689 | Ga0495613_0583601 | Ga0495613_0583601_93_509 | 135 |
| 391 | 3300046690 | Ga0495624_0020055 | Ga0495624_0020055_838_1254 | 135 |
| 392 | 3300046809 | Ga0495600_0347778 | Ga0495600_0347778_289_705 | 135 |
| 393 | 3300047319 | Ga0495674_0100208 | Ga0495674_0100208_774_1190 | 135 |
| 394 | 3300047319 | Ga0495674_0662663 | Ga0495674_0662663_41_457 | 135 |
| 395 | 3300047321 | Ga0495676_0315349 | Ga0495676_0315349_70_486 | 135 |
| 396 | 3300047322 | Ga0495680_0057875 | Ga0495680_0057875_1159_1575 | 135 |
| 397 | 3300047322 | Ga0495680_0370716 | Ga0495680_0370716_214_630 | 135 |
| 398 | 3300047444 | Ga0495675_0399069 | Ga0495675_0399069_205_621 | 135 |
| 399 | 3300047471 | Ga0495684_0043342 | Ga0495684_0043342_853_1269 | 135 |
| 400 | 3300047673 | Ga0495593_0099781 | Ga0495593_0099781_470_886 | 135 |
| 401 | 3300047673 | Ga0495593_0167030 | Ga0495593_0167030_170_586 | 135 |
| 402 | 3300048903 | Ga0496100_0431138 | Ga0496100_0431138_386_802 | 135 |
| 403 | 3300048903 | Ga0496100_0475623 | Ga0496100_0475623_52_525 | 135 |
| 404 | 3300048904 | Ga0496101_0007793 | Ga0496101_0007793_1528_1944 | 135 |
| 405 | 3300048905 | Ga0496102_0014198 | Ga0496102_0014198_3415_3831 | 135 |
| 406 | 3300048905 | Ga0496102_0040050 | Ga0496102_0040050_3257_3673 | 135 |
| 407 | 3300048905 | Ga0496102_0320742 | Ga0496102_0320742_906_1322 | 135 |
| 408 | 3300048905 | Ga0496102_0955857 | Ga0496102_0955857_107_523 | 135 |
| 409 | 3300048907 | Ga0496104_0048196 | Ga0496104_0048196_1706_2122 | 135 |
| 410 | 3300048907 | Ga0496104_0192241 | Ga0496104_0192241_13_429 | 135 |
| 411 | 3300048909 | Ga0496106_0430244 | Ga0496106_0430244_445_861 | 135 |
| 412 | 3300048910 | Ga0496107_0125582 | Ga0496107_0125582_306_773 | 135 |
| 413 | 3300048911 | Ga0496108_0274898 | Ga0496108_0274898_1017_1433 | 135 |
| 414 | 3300048912 | Ga0496109_0001465 | Ga0496109_0001465_1852_2268 | 135 |
| 415 | 3300048912 | Ga0496109_1716844 | Ga0496109_1716844_88_504 | 135 |
| 416 | 3300048913 | Ga0496110_0148886 | Ga0496110_0148886_188_604 | 135 |
| 417 | 3300048914 | Ga0496111_0003865 | Ga0496111_0003865_8580_8996 | 135 |
| 418 | 3300048915 | Ga0496112_0365136 | Ga0496112_0365136_115_531 | 135 |
| 419 | 3300048915 | Ga0496112_1785174 | Ga0496112_1785174_78_497 | 135 |
| 420 | 3300048916 | Ga0496113_0019066 | Ga0496113_0019066_3757_4173 | 135 |
| 421 | 3300048916 | Ga0496113_0185102 | Ga0496113_0185102_565_981 | 135 |
| 422 | 3300048917 | Ga0496114_0023615 | Ga0496114_0023615_4459_4875 | 135 |
| 423 | 3300048917 | Ga0496114_0030724 | Ga0496114_0030724_3722_4138 | 135 |
| 424 | 3300048918 | Ga0496115_0040341 | Ga0496115_0040341_1350_1769 | 135 |
| 425 | 3300050492 | nmdc:mga0yw44_11369_c1 | nmdc:mga0yw44_11369_c1_483_899 | 135 |
| 426 | 3300050512 | nmdc:mga0n895_5571_c1 | nmdc:mga0n895_5571_c1_9570_9986 | 135 |
| 427 | 3300053084 | Ga0495595_0460014 | Ga0495595_0460014_89_505 | 135 |
| 428 | 3300002067 | JGI24735J21928_10093896 | JGI24735J21928_100938962 | 136 |
| 429 | 3300003316 | rootH1_10033476 | rootH1_100334762 | 136 |
| 430 | 3300003322 | rootL2_10189113 | rootL2_101891133 | 136 |
| 431 | 3300003323 | rootH1_10275024 | rootH1_102750242 | 136 |
| 432 | 3300005329 | Ga0070683_100098524 | Ga0070683_1000985241 | 136 |
| 433 | 3300005329 | Ga0070683_100456016 | Ga0070683_1004560162 | 136 |
| 434 | 3300005336 | Ga0070680_100044013 | Ga0070680_1000440134 | 136 |
| 435 | 3300005336 | Ga0070680_100232023 | Ga0070680_1002320232 | 136 |
| 436 | 3300005337 | Ga0070682_100075106 | Ga0070682_1000751062 | 136 |
| 437 | 3300005337 | Ga0070682_100347263 | Ga0070682_1003472633 | 136 |
| 438 | 3300005339 | Ga0070660_100124326 | Ga0070660_1001243262 | 136 |
| 439 | 3300005341 | Ga0070691_10114805 | Ga0070691_101148052 | 136 |
| 440 | 3300005344 | Ga0070661_100030094 | Ga0070661_1000300943 | 136 |
| 441 | 3300005344 | Ga0070661_100090564 | Ga0070661_1000905643 | 136 |
| 442 | 3300005344 | Ga0070661_100100371 | Ga0070661_1001003712 | 136 |
| 443 | 3300005366 | Ga0070659_100030811 | Ga0070659_1000308113 | 136 |
| 444 | 3300005366 | Ga0070659_100053622 | Ga0070659_1000536225 | 136 |
| 445 | 3300005366 | Ga0070659_100124537 | Ga0070659_1001245373 | 136 |
| 446 | 3300005434 | Ga0070709_10545810 | Ga0070709_105458102 | 136 |
| 447 | 3300005435 | Ga0070714_100313394 | Ga0070714_1003133942 | 136 |
| 448 | 3300005436 | Ga0070713_100050341 | Ga0070713_1000503413 | 136 |
| 449 | 3300005436 | Ga0070713_100574585 | Ga0070713_1005745851 | 136 |
| 450 | 3300005436 | Ga0070713_100730744 | Ga0070713_1007307441 | 136 |
| 451 | 3300005455 | Ga0070663_100383474 | Ga0070663_1003834741 | 136 |
| 452 | 3300005458 | Ga0070681_10059606 | Ga0070681_100596062 | 136 |
| 453 | 3300005530 | Ga0070679_100128239 | Ga0070679_1001282393 | 136 |
| 454 | 3300005535 | Ga0070684_100036526 | Ga0070684_1000365265 | 136 |
| 455 | 3300005535 | Ga0070684_100036742 | Ga0070684_1000367423 | 136 |
| 456 | 3300005539 | Ga0068853_100030444 | Ga0068853_1000304442 | 136 |
| 457 | 3300005539 | Ga0068853_100055436 | Ga0068853_1000554365 | 136 |
| 458 | 3300005547 | Ga0070693_100124146 | Ga0070693_1001241462 | 136 |
| 459 | 3300005548 | Ga0070665_100039549 | Ga0070665_1000395492 | 136 |
| 460 | 3300005563 | Ga0068855_100074382 | Ga0068855_1000743825 | 136 |
| 461 | 3300005564 | Ga0070664_100008834 | Ga0070664_1000088346 | 136 |
| 462 | 3300005577 | Ga0068857_100051092 | Ga0068857_1000510924 | 136 |
| 463 | 3300005577 | Ga0068857_100112578 | Ga0068857_1001125783 | 136 |
| 464 | 3300005577 | Ga0068857_100447286 | Ga0068857_1004472862 | 136 |
| 465 | 3300005578 | Ga0068854_100529153 | Ga0068854_1005291531 | 136 |
| 466 | 3300005578 | Ga0068854_101387964 | Ga0068854_1013879641 | 136 |
| 467 | 3300005614 | Ga0068856_100066434 | Ga0068856_1000664344 | 136 |
| 468 | 3300005614 | Ga0068856_100087537 | Ga0068856_1000875373 | 136 |
| 469 | 3300005616 | Ga0068852_100032362 | Ga0068852_1000323624 | 136 |
| 470 | 3300005616 | Ga0068852_100182426 | Ga0068852_1001824264 | 136 |
| 471 | 3300005834 | Ga0068851_10040917 | Ga0068851_100409172 | 136 |
| 472 | 3300005834 | Ga0068851_10074048 | Ga0068851_100740483 | 136 |
| 473 | 3300005983 | Ga0081540_1001813 | Ga0081540_10018137 | 136 |
| 474 | 3300006028 | Ga0070717_10126571 | Ga0070717_101265711 | 136 |
| 475 | 3300006028 | Ga0070717_10158193 | Ga0070717_101581933 | 136 |
| 476 | 3300006028 | Ga0070717_10814818 | Ga0070717_108148182 | 136 |
| 477 | 3300006173 | Ga0070716_100801455 | Ga0070716_1008014551 | 136 |
| 478 | 3300006175 | Ga0070712_101077049 | Ga0070712_1010770491 | 136 |
| 479 | 3300006177 | Ga0075362_10004816 | Ga0075362_100048163 | 136 |
| 480 | 3300006177 | Ga0075362_10635765 | Ga0075362_106357652 | 136 |
| 481 | 3300007788 | Ga0099795_10024989 | Ga0099795_100249891 | 136 |
| 482 | 3300009093 | Ga0105240_10103917 | Ga0105240_101039173 | 136 |
| 483 | 3300009093 | Ga0105240_10652148 | Ga0105240_106521482 | 136 |
| 484 | 3300009093 | Ga0105240_10962847 | Ga0105240_109628472 | 136 |
| 485 | 3300009174 | Ga0105241_10185343 | Ga0105241_101853433 | 136 |
| 486 | 3300009174 | Ga0105241_10661487 | Ga0105241_106614872 | 136 |
| 487 | 3300009174 | Ga0105241_11180351 | Ga0105241_111803512 | 136 |
| 488 | 3300009545 | Ga0105237_10059086 | Ga0105237_100590865 | 136 |
| 489 | 3300009545 | Ga0105237_10118873 | Ga0105237_101188733 | 136 |
| 490 | 3300009545 | Ga0105237_10322017 | Ga0105237_103220173 | 136 |
| 491 | 3300009551 | Ga0105238_10027104 | Ga0105238_100271047 | 136 |
| 492 | 3300009551 | Ga0105238_10066644 | Ga0105238_100666443 | 136 |
| 493 | 3300009551 | Ga0105238_10165538 | Ga0105238_101655382 | 136 |
| 494 | 3300010159 | Ga0099796_10111980 | Ga0099796_101119802 | 136 |
| 495 | 3300010375 | Ga0105239_10020284 | Ga0105239_1002028410 | 136 |
| 496 | 3300010375 | Ga0105239_10388880 | Ga0105239_103888802 | 136 |
| 497 | 3300010375 | Ga0105239_10518771 | Ga0105239_105187712 | 136 |
| 498 | 3300011119 | Ga0105246_10586641 | Ga0105246_105866412 | 136 |
| 499 | 3300013100 | Ga0157373_10074337 | Ga0157373_100743375 | 136 |
| 500 | 3300013102 | Ga0157371_10158476 | Ga0157371_101584762 | 136 |
| 501 | 3300013102 | Ga0157371_10402460 | Ga0157371_104024601 | 136 |
| 502 | 3300013104 | Ga0157370_10010709 | Ga0157370_100107094 | 136 |
| 503 | 3300013104 | Ga0157370_10024697 | Ga0157370_100246974 | 136 |
| 504 | 3300013105 | Ga0157369_10094814 | Ga0157369_100948142 | 136 |
| 505 | 3300013105 | Ga0157369_10096249 | Ga0157369_100962493 | 136 |
| 506 | 3300013105 | Ga0157369_10107775 | Ga0157369_101077753 | 136 |
| 507 | 3300013105 | Ga0157369_10658539 | Ga0157369_106585392 | 136 |
| 508 | 3300013296 | Ga0157374_10033326 | Ga0157374_100333262 | 136 |
| 509 | 3300013296 | Ga0157374_10318830 | Ga0157374_103188301 | 136 |
| 510 | 3300013296 | Ga0157374_10632020 | Ga0157374_106320202 | 136 |
| 511 | 3300013307 | Ga0157372_10074100 | Ga0157372_100741005 | 136 |
| 512 | 3300013307 | Ga0157372_10106760 | Ga0157372_101067602 | 136 |
| 513 | 3300013307 | Ga0157372_10125407 | Ga0157372_101254073 | 136 |
| 514 | 3300015261 | Ga0182006_1172614 | Ga0182006_11726141 | 136 |
| 515 | 3300020069 | Ga0197907_10945116 | Ga0197907_109451162 | 136 |
| 516 | 3300020069 | Ga0197907_11497267 | Ga0197907_114972671 | 136 |
| 517 | 3300020070 | Ga0206356_11004064 | Ga0206356_110040643 | 136 |
| 518 | 3300020070 | Ga0206356_11565528 | Ga0206356_115655281 | 136 |
| 519 | 3300020070 | Ga0206356_11575385 | Ga0206356_115753853 | 136 |
| 520 | 3300020070 | Ga0206356_11610432 | Ga0206356_116104322 | 136 |
| 521 | 3300020076 | Ga0206355_1043589 | Ga0206355_10435892 | 136 |
| 522 | 3300020078 | Ga0206352_11335040 | Ga0206352_113350401 | 136 |
| 523 | 3300020080 | Ga0206350_10723844 | Ga0206350_107238442 | 136 |
| 524 | 3300020081 | Ga0206354_11054448 | Ga0206354_110544482 | 136 |
| 525 | 3300020082 | Ga0206353_10598295 | Ga0206353_105982955 | 136 |
| 526 | 3300020082 | Ga0206353_10682216 | Ga0206353_106822162 | 136 |
| 527 | 3300020082 | Ga0206353_12026389 | Ga0206353_120263892 | 136 |
| 528 | 3300021384 | Ga0213876_10003068 | Ga0213876_100030686 | 136 |
| 529 | 3300021384 | Ga0213876_10123418 | Ga0213876_101234182 | 136 |
| 530 | 3300021388 | Ga0213875_10000372 | Ga0213875_100003724 | 136 |
| 531 | 3300022467 | Ga0224712_10156848 | Ga0224712_101568482 | 136 |
| 532 | 3300022467 | Ga0224712_10183289 | Ga0224712_101832891 | 136 |
| 533 | 3300025321 | Ga0207656_10052530 | Ga0207656_100525301 | 136 |
| 534 | 3300025909 | Ga0207705_10056274 | Ga0207705_100562745 | 136 |
| 535 | 3300025910 | Ga0207684_10130365 | Ga0207684_101303652 | 136 |
| 536 | 3300025912 | Ga0207707_10008078 | Ga0207707_100080782 | 136 |
| 537 | 3300025913 | Ga0207695_10543841 | Ga0207695_105438413 | 136 |
| 538 | 3300025913 | Ga0207695_10562238 | Ga0207695_105622382 | 136 |
| 539 | 3300025915 | Ga0207693_10616637 | Ga0207693_106166372 | 136 |
| 540 | 3300025916 | Ga0207663_11187447 | Ga0207663_111874471 | 136 |
| 541 | 3300025917 | Ga0207660_10006117 | Ga0207660_100061177 | 136 |
| 542 | 3300025919 | Ga0207657_10013235 | Ga0207657_100132358 | 136 |
| 543 | 3300025919 | Ga0207657_10088438 | Ga0207657_100884384 | 136 |
| 544 | 3300025920 | Ga0207649_10072721 | Ga0207649_100727213 | 136 |
| 545 | 3300025920 | Ga0207649_10090378 | Ga0207649_100903782 | 136 |
| 546 | 3300025920 | Ga0207649_10365928 | Ga0207649_103659282 | 136 |
| 547 | 3300025921 | Ga0207652_10202070 | Ga0207652_102020702 | 136 |
| 548 | 3300025921 | Ga0207652_10629846 | Ga0207652_106298462 | 136 |
| 549 | 3300025922 | Ga0207646_10666162 | Ga0207646_106661622 | 136 |
| 550 | 3300025924 | Ga0207694_10151960 | Ga0207694_101519601 | 136 |
| 551 | 3300025924 | Ga0207694_10232967 | Ga0207694_102329672 | 136 |
| 552 | 3300025927 | Ga0207687_10834463 | Ga0207687_108344631 | 136 |
| 553 | 3300025928 | Ga0207700_10079042 | Ga0207700_100790424 | 136 |
| 554 | 3300025928 | Ga0207700_11043043 | Ga0207700_110430432 | 136 |
| 555 | 3300025929 | Ga0207664_10000778 | Ga0207664_1000077818 | 136 |
| 556 | 3300025931 | Ga0207644_11332203 | Ga0207644_113322031 | 136 |
| 557 | 3300025932 | Ga0207690_10071975 | Ga0207690_100719755 | 136 |
| 558 | 3300025932 | Ga0207690_10235730 | Ga0207690_102357303 | 136 |
| 559 | 3300025933 | Ga0207706_10614786 | Ga0207706_106147861 | 136 |
| 560 | 3300025944 | Ga0207661_10061435 | Ga0207661_100614353 | 136 |
| 561 | 3300025944 | Ga0207661_10416533 | Ga0207661_104165332 | 136 |
| 562 | 3300025944 | Ga0207661_10428497 | Ga0207661_104284971 | 136 |
| 563 | 3300025944 | Ga0207661_10437658 | Ga0207661_104376581 | 136 |
| 564 | 3300025949 | Ga0207667_10054633 | Ga0207667_100546334 | 136 |
| 565 | 3300025981 | Ga0207640_10596323 | Ga0207640_105963232 | 136 |
| 566 | 3300025981 | Ga0207640_10893290 | Ga0207640_108932902 | 136 |
| 567 | 3300026041 | Ga0207639_10076332 | Ga0207639_100763322 | 136 |
| 568 | 3300026041 | Ga0207639_11251475 | Ga0207639_112514751 | 136 |
| 569 | 3300026078 | Ga0207702_10152015 | Ga0207702_101520153 | 136 |
| 570 | 3300026116 | Ga0207674_10011322 | Ga0207674_100113225 | 136 |
| 571 | 3300026116 | Ga0207674_10179789 | Ga0207674_101797893 | 136 |
| 572 | 3300026142 | Ga0207698_10152588 | Ga0207698_101525884 | 136 |
| 573 | 3300027512 | Ga0209179_1027110 | Ga0209179_10271103 | 136 |
| 574 | 3300028380 | Ga0268265_10536192 | Ga0268265_105361922 | 136 |
| 575 | 3300035083 | Ga0373926_0106256 | Ga0373926_0106256_16_441 | 136 |
| 576 | 3300035111 | Ga0373923_0085041 | Ga0373923_0085041_862_1287 | 136 |
| 577 | 3300035113 | Ga0373936_0001416 | Ga0373936_0001416_7997_8422 | 136 |
| 578 | 3300035116 | Ga0373945_0526815 | Ga0373945_0526815_50_475 | 136 |
| 579 | 3300035117 | Ga0373953_0003397 | Ga0373953_0003397_1167_1592 | 136 |
| 580 | 3300035118 | Ga0373954_0291535 | Ga0373954_0291535_189_614 | 136 |
| 581 | 3300035119 | Ga0373956_0016029 | Ga0373956_0016029_189_614 | 136 |
| 582 | 3300035120 | Ga0373957_0003429 | Ga0373957_0003429_1297_1722 | 136 |
| 583 | 3300035172 | Ga0373955_0036865 | Ga0373955_0036865_1311_1736 | 136 |
| 584 | 3300035410 | Ga0373924_0014859 | Ga0373924_0014859_1909_2334 | 136 |
| 585 | 3300035692 | Ga0373935_0052905 | Ga0373935_0052905_298_723 | 136 |
| 586 | 3300035695 | Ga0373927_0393999 | Ga0373927_0393999_82_510 | 136 |
| 587 | 3300035695 | Ga0373927_0980996 | Ga0373927_0980996_86_511 | 136 |
| 588 | 3300035724 | Ga0373933_0797276 | Ga0373933_0797276_85_510 | 136 |
| 589 | 3300035725 | Ga0373947_0132535 | Ga0373947_0132535_781_1209 | 136 |
| 590 | 3300036401 | Ga0373937_0245980 | Ga0373937_0245980_1127_1552 | 136 |
| 591 | 3300037068 | Ga0373925_0031273 | Ga0373925_0031273_1022_1450 | 136 |
| 592 | 3300037068 | Ga0373925_0112986 | Ga0373925_0112986_1523_1951 | 136 |
| 593 | 3300037068 | Ga0373925_0274201 | Ga0373925_0274201_672_1097 | 136 |
| 594 | 3300037853 | Ga0436364_1205415 | Ga0436364_1205415_2865_3296 | 136 |
| 595 | 3300037853 | Ga0436364_1511050 | Ga0436364_1511050_17544_17978 | 136 |
| 596 | 3300038443 | Ga0395901_0228419 | Ga0395901_0228419_318_740 | 136 |
| 597 | 3300039437 | Ga0436365_0696108 | Ga0436365_0696108_11032_11475 | 136 |
| 598 | 3300039437 | Ga0436365_1526623 | Ga0436365_1526623_1791_2234 | 136 |
| 599 | 3300039437 | Ga0436365_1760587 | Ga0436365_1760587_98_520 | 136 |
| 600 | 3300039437 | Ga0436365_1763225 | Ga0436365_1763225_909_1331 | 136 |
| 601 | 3300039450 | Ga0436363_1019899 | Ga0436363_1019899_176_598 | 136 |
| 602 | 3300044656 | Ga0466969_0059763 | Ga0466969_0059763_1051_1467 | 136 |
| 603 | 3300044684 | Ga0466966_0024387 | Ga0466966_0024387_2438_2854 | 136 |
| 604 | 3300044693 | Ga0466961_0017861 | Ga0466961_0017861_4125_4541 | 136 |
| 605 | 3300044693 | Ga0466961_0651365 | Ga0466961_0651365_32_457 | 136 |
| 606 | 3300044694 | Ga0466963_0032573 | Ga0466963_0032573_2906_3328 | 136 |
| 607 | 3300044694 | Ga0466963_0340886 | Ga0466963_0340886_592_1029 | 136 |
| 608 | 3300044694 | Ga0466963_0748576 | Ga0466963_0748576_53_478 | 136 |
| 609 | 3300044706 | Ga0466964_0212003 | Ga0466964_0212003_52_480 | 136 |
| 610 | 3300044706 | Ga0466964_0565304 | Ga0466964_0565304_47_469 | 136 |
| 611 | 3300044719 | Ga0466971_0003213 | Ga0466971_0003213_5657_6073 | 136 |
| 612 | 3300044719 | Ga0466971_0221357 | Ga0466971_0221357_129_557 | 136 |
| 613 | 3300044735 | Ga0466968_0598812 | Ga0466968_0598812_120_545 | 136 |
| 614 | 3300045049 | Ga0466959_0219097 | Ga0466959_0219097_576_992 | 136 |
| 615 | 3300045836 | Ga0466958_0032123 | Ga0466958_0032123_1892_2320 | 136 |
| 616 | 3300045836 | Ga0466958_0095830 | Ga0466958_0095830_421_858 | 136 |
| 617 | 3300045976 | Ga0466967_0003362 | Ga0466967_0003362_467_889 | 136 |
| 618 | 3300045976 | Ga0466967_0007930 | Ga0466967_0007930_7009_7437 | 136 |
| 619 | 3300045976 | Ga0466967_0138314 | Ga0466967_0138314_1444_1866 | 136 |
| 620 | 3300045976 | Ga0466967_0187894 | Ga0466967_0187894_1091_1528 | 136 |
| 621 | 3300045976 | Ga0466967_0843493 | Ga0466967_0843493_386_814 | 136 |
| 622 | 3300045976 | Ga0466967_1584739 | Ga0466967_1584739_88_510 | 136 |
| 623 | 3300046459 | Ga0495629_0068008 | Ga0495629_0068008_1860_2285 | 136 |
| 624 | 3300046461 | Ga0495641_0016250 | Ga0495641_0016250_1629_2054 | 136 |
| 625 | 3300046462 | Ga0495651_0020085 | Ga0495651_0020085_2066_2491 | 136 |
| 626 | 3300046463 | Ga0495653_0055308 | Ga0495653_0055308_1509_1934 | 136 |
| 627 | 3300046472 | Ga0495580_0397385 | Ga0495580_0397385_111_536 | 136 |
| 628 | 3300046473 | Ga0495582_0002876 | Ga0495582_0002876_3541_3966 | 136 |
| 629 | 3300046475 | Ga0495639_0018327 | Ga0495639_0018327_309_734 | 136 |
| 630 | 3300046476 | Ga0495662_0019397 | Ga0495662_0019397_2574_2999 | 136 |
| 631 | 3300046476 | Ga0495662_0045733 | Ga0495662_0045733_13_441 | 136 |
| 632 | 3300046477 | Ga0495664_0002450 | Ga0495664_0002450_9512_9937 | 136 |
| 633 | 3300046477 | Ga0495664_0079993 | Ga0495664_0079993_943_1368 | 136 |
| 634 | 3300046511 | Ga0495608_0042303 | Ga0495608_0042303_1113_1538 | 136 |
| 635 | 3300046514 | Ga0495618_0047239 | Ga0495618_0047239_1732_2157 | 136 |
| 636 | 3300046516 | Ga0495628_0041347 | Ga0495628_0041347_2694_3119 | 136 |
| 637 | 3300046516 | Ga0495628_0369597 | Ga0495628_0369597_42_470 | 136 |
| 638 | 3300046516 | Ga0495628_0725432 | Ga0495628_0725432_10_435 | 136 |
| 639 | 3300046517 | Ga0495630_0040582 | Ga0495630_0040582_3022_3450 | 136 |
| 640 | 3300046526 | Ga0495666_0025471 | Ga0495666_0025471_214_639 | 136 |
| 641 | 3300046529 | Ga0495652_0052505 | Ga0495652_0052505_189_614 | 136 |
| 642 | 3300046529 | Ga0495652_0175807 | Ga0495652_0175807_65_493 | 136 |
| 643 | 3300046531 | Ga0495665_0001745 | Ga0495665_0001745_8329_8754 | 136 |
| 644 | 3300046533 | Ga0495640_0006215 | Ga0495640_0006215_7004_7432 | 136 |
| 645 | 3300046533 | Ga0495640_0176935 | Ga0495640_0176935_323_748 | 136 |
| 646 | 3300046535 | Ga0495586_0003691 | Ga0495586_0003691_2251_2676 | 136 |
| 647 | 3300046535 | Ga0495586_0332231 | Ga0495586_0332231_393_821 | 136 |
| 648 | 3300046536 | Ga0495587_0026804 | Ga0495587_0026804_2426_2851 | 136 |
| 649 | 3300046543 | Ga0495645_0211511 | Ga0495645_0211511_610_1038 | 136 |
| 650 | 3300046543 | Ga0495645_0262772 | Ga0495645_0262772_624_1049 | 136 |
| 651 | 3300046642 | Ga0495634_0504485 | Ga0495634_0504485_233_661 | 136 |
| 652 | 3300046663 | Ga0495635_0161383 | Ga0495635_0161383_967_1392 | 136 |
| 653 | 3300046663 | Ga0495635_0280850 | Ga0495635_0280850_158_586 | 136 |
| 654 | 3300046675 | Ga0495657_0005434 | Ga0495657_0005434_8633_9058 | 136 |
| 655 | 3300046678 | Ga0495599_0026464 | Ga0495599_0026464_2518_2943 | 136 |
| 656 | 3300046678 | Ga0495599_0298953 | Ga0495599_0298953_309_737 | 136 |
| 657 | 3300046680 | Ga0495646_0084132 | Ga0495646_0084132_862_1287 | 136 |
| 658 | 3300046689 | Ga0495613_0032515 | Ga0495613_0032515_2450_2875 | 136 |
| 659 | 3300046689 | Ga0495613_0451996 | Ga0495613_0451996_388_816 | 136 |
| 660 | 3300046690 | Ga0495624_0046372 | Ga0495624_0046372_189_614 | 136 |
| 661 | 3300046690 | Ga0495624_0782025 | Ga0495624_0782025_41_463 | 136 |
| 662 | 3300046809 | Ga0495600_0008278 | Ga0495600_0008278_3978_4403 | 136 |
| 663 | 3300047315 | Ga0495581_0011873 | Ga0495581_0011873_4319_4744 | 136 |
| 664 | 3300047317 | Ga0495604_0073009 | Ga0495604_0073009_1832_2257 | 136 |
| 665 | 3300047319 | Ga0495674_0000950 | Ga0495674_0000950_20383_20811 | 136 |
| 666 | 3300047321 | Ga0495676_0575681 | Ga0495676_0575681_250_675 | 136 |
| 667 | 3300047322 | Ga0495680_0007738 | Ga0495680_0007738_1509_1934 | 136 |
| 668 | 3300047444 | Ga0495675_0323080 | Ga0495675_0323080_189_614 | 136 |
| 669 | 3300047471 | Ga0495684_0135336 | Ga0495684_0135336_302_727 | 136 |
| 670 | 3300047471 | Ga0495684_0335123 | Ga0495684_0335123_437_865 | 136 |
| 671 | 3300047673 | Ga0495593_0001519 | Ga0495593_0001519_11940_12365 | 136 |
| 672 | 3300048088 | Ga0495602_0072788 | Ga0495602_0072788_995_1420 | 136 |
| 673 | 3300048089 | Ga0495614_0403498 | Ga0495614_0403498_137_562 | 136 |
| 674 | 3300048903 | Ga0496100_0138840 | Ga0496100_0138840_207_629 | 136 |
| 675 | 3300048904 | Ga0496101_0028460 | Ga0496101_0028460_37_459 | 136 |
| 676 | 3300048908 | Ga0496105_0155634 | Ga0496105_0155634_927_1349 | 136 |
| 677 | 3300048910 | Ga0496107_0034574 | Ga0496107_0034574_3104_3526 | 136 |
| 678 | 3300048911 | Ga0496108_1073427 | Ga0496108_1073427_251_673 | 136 |
| 679 | 3300048912 | Ga0496109_0021563 | Ga0496109_0021563_1159_1581 | 136 |
| 680 | 3300048912 | Ga0496109_0203799 | Ga0496109_0203799_36_455 | 136 |
| 681 | 3300048913 | Ga0496110_0527484 | Ga0496110_0527484_654_1064 | 136 |
| 682 | 3300048914 | Ga0496111_0768797 | Ga0496111_0768797_22_444 | 136 |
| 683 | 3300048914 | Ga0496111_0803148 | Ga0496111_0803148_41_451 | 136 |
| 684 | 3300048917 | Ga0496114_0003593 | Ga0496114_0003593_10666_11088 | 136 |
| 685 | 3300048918 | Ga0496115_0006669 | Ga0496115_0006669_2422_2844 | 136 |
| 686 | 3300048918 | Ga0496115_0084410 | Ga0496115_0084410_826_1251 | 136 |
| 687 | 3300049585 | Ga0501069_0217153 | Ga0501069_0217153_84_503 | 136 |
| 688 | 3300049586 | Ga0501070_0693901 | Ga0501070_0693901_123_542 | 136 |
| 689 | 3300049593 | Ga0501077_0776441 | Ga0501077_0776441_129_548 | 136 |
| 690 | 3300049822 | Ga0501035_0123223 | Ga0501035_0123223_1438_1863 | 136 |
| 691 | 3300050489 | nmdc:mga03683_42793_c1 | nmdc:mga03683_42793_c1_995_1441 | 136 |
| 692 | 3300050512 | nmdc:mga0n895_1009659_c1 | nmdc:mga0n895_1009659_c1_290_715 | 136 |
| 693 | 3300050513 | nmdc:mga0rr50_1421086_c1 | nmdc:mga0rr50_1421086_c1_142_561 | 136 |
| 694 | 3300050514 | nmdc:mga08x19_267178_c1 | nmdc:mga08x19_267178_c1_306_776 | 136 |
| 695 | 3300050514 | nmdc:mga08x19_562736_c1 | nmdc:mga08x19_562736_c1_343_765 | 136 |
| 696 | 3300053077 | Ga0495601_0019317 | Ga0495601_0019317_614_1039 | 136 |
| 697 | 3300053077 | Ga0495601_0938365 | Ga0495601_0938365_108_533 | 136 |
| 698 | 3300053078 | Ga0495612_0009518 | Ga0495612_0009518_3352_3777 | 136 |
| 699 | 3300053078 | Ga0495612_0212510 | Ga0495612_0212510_219_647 | 136 |
| 700 | 3300053084 | Ga0495595_0069736 | Ga0495595_0069736_567_992 | 136 |
| 701 | 3300053085 | Ga0495619_0001433 | Ga0495619_0001433_11710_12135 | 136 |
| 702 | 3300053085 | Ga0495619_0327816 | Ga0495619_0327816_93_521 | 136 |
| 703 | 3300053736 | Ga0500599_005577 | Ga0500599_005577_826_1254 | 136 |
| 704 | 3300061719 | Ga0466962_0003291 | Ga0466962_0003291_7196_7612 | 136 |
| 705 | 3300061734 | Ga0530510_0267547 | Ga0530510_0267547_123_542 | 136 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kmz-assembly1.cif.gz_A | molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative | 0.8124 | 4 | 129 |
| 1kmz-assembly1.cif.gz_A | molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative | 0.7896 | 4 | 129 |
| 3oxh-assembly1.cif.gz_A | mycobacterium tuberculosis kinase inhibitor homolog rv0577 | 0.7455 | 6 | 130 |
| 2r6u-assembly2.cif.gz_D | crystal structure of gene product rha04853 from rhodococcus sp. rha1 | 0.7195 | 3 | 130 |
| 2r6u-assembly2.cif.gz_B | crystal structure of gene product rha04853 from rhodococcus sp. rha1 | 0.7166 | 2 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8972 | 76 | 127 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8597 | 76 | 129 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8175 | 76 | 127 | 3.30.720.110 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8083 | 78 | 130 | 3.30.720.110 |
| 3bt3B02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8005 | 76 | 130 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1A2XNA7-F1-model_v4 | Glyoxalase | 0.9934 | 1 | 135 |
|
| AF-A0A2P9ADF3-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9862 | 1 | 134 |
GO:0051213
|
| AF-A0A1X2A2B1-F1-model_v4 | Glyoxalase | 0.9846 | 2 | 136 |
|
| AF-A0A4Y3KJS4-F1-model_v4 | Glyoxalase | 0.9816 | 2 | 136 |
|
| AF-A0A1X6WY33-F1-model_v4 | ASCH domain-containing protein | 0.9808 | 1 | 134 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar