F476361
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 354 | 666 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300028380|Ga0268265_10110737|Ga0268265_101107373 |
| Length | 311 |
| Sequence | MIHSRPPDGTVTLRRRLTFVRGRGRHARTRSVHRDQWFRTDIYREGYLSLLARLAPHLPYVRRYARALTGDQISGDQYVRVALEALAAGERTLDPGLSPRVALYRVFHAIWCTTGAQLEDRTEEEAGGDPRQRLMRIAPRSRQAFLLTALEGFTPSETAQILDTDFEEIDALIAKAQQEIDAELATDVLIIEDEPVIAADIEALVRELGHNVLDIAATRSEAVEAAARHRPGLVLADIQLADGSSGIDAVKDILGRFDVPVIFITAFPERLLTGERPEPTFLITKPFQPETVKAAIGQALFFHPTRQKEAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 7 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 8 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 9 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 10 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 11 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 12 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 13 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 14 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 15 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 16 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 17 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 18 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 19 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 20 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 21 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 22 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 23 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 24 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 25 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 26 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 27 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 28 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 29 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 30 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 31 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 32 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 33 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 34 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 35 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 36 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 37 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 44 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 117 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 118 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 179 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 180 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 199 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 203 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 209 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 210 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 211 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 212 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 213 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 214 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 215 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 218 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 221 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 222 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 223 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 224 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 225 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 226 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 227 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 228 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 274 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 275 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 285 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 286 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 287 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 288 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 289 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 290 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 291 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 292 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 293 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 314 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 315 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 318 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 319 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 320 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 321 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 322 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 323 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 324 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 325 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 326 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 327 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 328 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 329 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 330 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 331 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 333 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 334 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 335 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 336 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 337 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 338 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 339 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 340 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 342 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 343 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 344 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 345 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 348 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 349 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 350 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 351 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 353 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.32 |
| Metatranscriptomes | 1.28 |
| Isolates | 5.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.62 |
| Nodule | 0.14 |
| Rhizoplane | 2.7 |
| Rhizosphere | 71.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10034119 | 3300003215 | Bacteria | 1668 |
| 2 | Ga0055526_1018273 | 3300003771 | Bacteria | 2625 |
| 3 | Ga0055537_1004582 | 3300003773 | Bacteria | 3922 |
| 4 | Ga0055524_1008284 | 3300003775 | Bacteria | 4329 |
| 5 | Ga0055536_1001254 | 3300003781 | Bacteria | 15617 |
| 6 | Ga0055528_1004170 | 3300003790 | Bacteria | 7033 |
| 7 | Ga0055530_10002063 | 3300003791 | Bacteria | 13509 |
| 8 | Ga0055530_10008853 | 3300003791 | Bacteria | 3962 |
| 9 | Ga0055531_10001364 | 3300003794 | Bacteria | 18136 |
| 10 | Ga0055531_10003088 | 3300003794 | Bacteria | 10767 |
| 11 | Ga0055531_10005840 | 3300003794 | Bacteria | 7113 |
| 12 | Ga0055531_10013178 | 3300003794 | Bacteria | 3832 |
| 13 | Ga0058862_12862074 | 3300004803 | Bacteria | 886 |
| 14 | Ga0065165_1001500 | 3300005262 | Bacteria | 24692 |
| 15 | Ga0065165_1001741 | 3300005262 | Bacteria | 21716 |
| 16 | Ga0065165_1023862 | 3300005262 | Bacteria | 2066 |
| 17 | Ga0065165_1027898 | 3300005262 | Bacteria | 1832 |
| 18 | Ga0070658_10048570 | 3300005327 | Bacteria | 3436 |
| 19 | Ga0070658_10093397 | 3300005327 | Bacteria | 2482 |
| 20 | Ga0070658_10111645 | 3300005327 | Bacteria | 2265 |
| 21 | Ga0070683_100214460 | 3300005329 | Bacteria | 1829 |
| 22 | Ga0070670_100000007 | 3300005331 | Bacteria | 318672 |
| 23 | Ga0070670_100069961 | 3300005331 | Bacteria | 3013 |
| 24 | Ga0070677_10006543 | 3300005333 | Bacteria | 3872 |
| 25 | Ga0070666_10358267 | 3300005335 | Bacteria | 1045 |
| 26 | Ga0070680_100037532 | 3300005336 | Bacteria | 3915 |
| 27 | Ga0070680_100054717 | 3300005336 | Bacteria | 3259 |
| 28 | Ga0070660_100013760 | 3300005339 | Bacteria | 5818 |
| 29 | Ga0070660_100068786 | 3300005339 | Bacteria | 2760 |
| 30 | Ga0070691_10002769 | 3300005341 | Bacteria | 7822 |
| 31 | Ga0070661_100030083 | 3300005344 | Bacteria | 3922 |
| 32 | Ga0070668_100000129 | 3300005347 | Bacteria | 47127 |
| 33 | Ga0070668_100000545 | 3300005347 | Bacteria | 25182 |
| 34 | Ga0070668_100005299 | 3300005347 | Bacteria | 9570 |
| 35 | Ga0070668_100005838 | 3300005347 | Bacteria | 9127 |
| 36 | Ga0070668_100011144 | 3300005347 | Bacteria | 6692 |
| 37 | Ga0070668_100033288 | 3300005347 | Bacteria | 3924 |
| 38 | Ga0070668_100058996 | 3300005347 | Bacteria | 2970 |
| 39 | Ga0070668_100257243 | 3300005347 | Bacteria | 1451 |
| 40 | Ga0070669_100065309 | 3300005353 | Bacteria | 2681 |
| 41 | Ga0070669_100193381 | 3300005353 | Bacteria | 1597 |
| 42 | Ga0070675_100012398 | 3300005354 | Bacteria | 6679 |
| 43 | Ga0070671_100097113 | 3300005355 | Bacteria | 2471 |
| 44 | Ga0070671_100183051 | 3300005355 | Bacteria | 1774 |
| 45 | Ga0070671_100212500 | 3300005355 | Bacteria | 1641 |
| 46 | Ga0070659_100000457 | 3300005366 | Bacteria | 30130 |
| 47 | Ga0070659_100014839 | 3300005366 | Bacteria | 5826 |
| 48 | Ga0070659_100016600 | 3300005366 | Bacteria | 5529 |
| 49 | Ga0070667_100000611 | 3300005367 | Bacteria | 34865 |
| 50 | Ga0070667_100008781 | 3300005367 | Bacteria | 8374 |
| 51 | Ga0070667_100017154 | 3300005367 | Bacteria | 5996 |
| 52 | Ga0070667_100029432 | 3300005367 | Bacteria | 4575 |
| 53 | Ga0070713_100542169 | 3300005436 | Bacteria | 1101 |
| 54 | Ga0070662_100014019 | 3300005457 | Bacteria | 5343 |
| 55 | Ga0070681_10006503 | 3300005458 | Bacteria | 11372 |
| 56 | Ga0070681_10042610 | 3300005458 | Bacteria | 4548 |
| 57 | Ga0070679_100034113 | 3300005530 | Bacteria | 5042 |
| 58 | Ga0070679_100045077 | 3300005530 | Bacteria | 4394 |
| 59 | Ga0070679_100341758 | 3300005530 | Bacteria | 1445 |
| 60 | Ga0068853_100001308 | 3300005539 | Bacteria | 17886 |
| 61 | Ga0068853_100026565 | 3300005539 | Bacteria | 4862 |
| 62 | Ga0068853_100062079 | 3300005539 | Bacteria | 3233 |
| 63 | Ga0068853_100166221 | 3300005539 | Bacteria | 1994 |
| 64 | Ga0068853_100166610 | 3300005539 | Bacteria | 1991 |
| 65 | Ga0070665_100000246 | 3300005548 | Bacteria | 90170 |
| 66 | Ga0070665_100000689 | 3300005548 | Bacteria | 45116 |
| 67 | Ga0070665_100000692 | 3300005548 | Bacteria | 44982 |
| 68 | Ga0070665_100041944 | 3300005548 | Bacteria | 4600 |
| 69 | Ga0070665_100056913 | 3300005548 | Bacteria | 3921 |
| 70 | Ga0070665_100057618 | 3300005548 | Bacteria | 3895 |
| 71 | Ga0070665_100112614 | 3300005548 | Bacteria | 2724 |
| 72 | Ga0068855_100000144 | 3300005563 | Bacteria | 91639 |
| 73 | Ga0068855_100024093 | 3300005563 | Bacteria | 7286 |
| 74 | Ga0068855_100029641 | 3300005563 | Bacteria | 6541 |
| 75 | Ga0068855_100362658 | 3300005563 | Bacteria | 1594 |
| 76 | Ga0068855_100534466 | 3300005563 | Bacteria | 1271 |
| 77 | Ga0070664_100051493 | 3300005564 | Bacteria | 3486 |
| 78 | Ga0070664_100357377 | 3300005564 | Bacteria | 1330 |
| 79 | Ga0068857_100140545 | 3300005577 | Bacteria | 2182 |
| 80 | Ga0068854_100202358 | 3300005578 | Bacteria | 1562 |
| 81 | Ga0068856_100024065 | 3300005614 | Bacteria | 5926 |
| 82 | Ga0068852_100013845 | 3300005616 | Bacteria | 6186 |
| 83 | Ga0068852_100264271 | 3300005616 | Bacteria | 1653 |
| 84 | Ga0068859_100000111 | 3300005617 | Bacteria | 77474 |
| 85 | Ga0068859_100017207 | 3300005617 | Bacteria | 7260 |
| 86 | Ga0068864_100000225 | 3300005618 | Bacteria | 51133 |
| 87 | Ga0068864_100000304 | 3300005618 | Bacteria | 43692 |
| 88 | Ga0068864_100001043 | 3300005618 | Bacteria | 23260 |
| 89 | Ga0068864_100011010 | 3300005618 | Bacteria | 7477 |
| 90 | Ga0068864_100138567 | 3300005618 | Bacteria | 2193 |
| 91 | Ga0068864_100357201 | 3300005618 | Bacteria | 1380 |
| 92 | Ga0068861_100153294 | 3300005719 | Bacteria | 1893 |
| 93 | Ga0068861_100216290 | 3300005719 | Bacteria | 1617 |
| 94 | Ga0068863_100000076 | 3300005841 | Bacteria | 109412 |
| 95 | Ga0068863_100000295 | 3300005841 | Bacteria | 51532 |
| 96 | Ga0068863_100005065 | 3300005841 | Bacteria | 12999 |
| 97 | Ga0068863_100051072 | 3300005841 | Bacteria | 3919 |
| 98 | Ga0068863_100101228 | 3300005841 | Bacteria | 2739 |
| 99 | Ga0068858_100000079 | 3300005842 | Bacteria | 100753 |
| 100 | Ga0068858_100000500 | 3300005842 | Bacteria | 41083 |
| 101 | Ga0068860_100000027 | 3300005843 | Bacteria | 267207 |
| 102 | Ga0068860_100000047 | 3300005843 | Bacteria | 213287 |
| 103 | Ga0068860_100005396 | 3300005843 | Bacteria | 12973 |
| 104 | Ga0068862_100000396 | 3300005844 | Bacteria | 47054 |
| 105 | Ga0068862_100009983 | 3300005844 | Bacteria | 7845 |
| 106 | Ga0068862_100041258 | 3300005844 | Bacteria | 3926 |
| 107 | Ga0068862_100102330 | 3300005844 | Bacteria | 2507 |
| 108 | Ga0081540_1083201 | 3300005983 | Bacteria | 1432 |
| 109 | Ga0081539_10017674 | 3300005985 | Bacteria | 4993 |
| 110 | Ga0075368_10000230 | 3300006042 | Bacteria | 15775 |
| 111 | Ga0075363_100013053 | 3300006048 | Bacteria | 4016 |
| 112 | Ga0075364_10004820 | 3300006051 | Bacteria | 7810 |
| 113 | Ga0075367_10000291 | 3300006178 | Bacteria | 17585 |
| 114 | Ga0075369_10001551 | 3300006186 | Bacteria | 7877 |
| 115 | Ga0075369_10081739 | 3300006186 | Bacteria | 1433 |
| 116 | Ga0075366_10007206 | 3300006195 | Bacteria | 6128 |
| 117 | Ga0075366_10307884 | 3300006195 | Bacteria | 970 |
| 118 | Ga0075370_10069294 | 3300006353 | Bacteria | 2016 |
| 119 | Ga0075370_10154055 | 3300006353 | Bacteria | 1347 |
| 120 | Ga0068865_100002622 | 3300006881 | Bacteria | 10692 |
| 121 | Ga0097620_100000111 | 3300006931 | Bacteria | 77474 |
| 122 | Ga0097620_100017207 | 3300006931 | Bacteria | 7260 |
| 123 | Ga0079104_1006367 | 3300006946 | Bacteria | 4487 |
| 124 | Ga0105240_10000314 | 3300009093 | Bacteria | 93043 |
| 125 | Ga0105240_10002602 | 3300009093 | Bacteria | 28871 |
| 126 | Ga0105240_10003899 | 3300009093 | Bacteria | 23042 |
| 127 | Ga0105240_10161382 | 3300009093 | Bacteria | 2662 |
| 128 | Ga0105240_10163815 | 3300009093 | Bacteria | 2639 |
| 129 | Ga0105240_10214524 | 3300009093 | Bacteria | 2246 |
| 130 | Ga0105240_10382110 | 3300009093 | Bacteria | 1590 |
| 131 | Ga0105245_10190260 | 3300009098 | Bacteria | 1965 |
| 132 | Ga0105243_10156788 | 3300009148 | Bacteria | 1958 |
| 133 | Ga0105241_10121304 | 3300009174 | Bacteria | 2105 |
| 134 | Ga0105241_10292303 | 3300009174 | Bacteria | 1395 |
| 135 | Ga0105248_10000112 | 3300009177 | Bacteria | 91321 |
| 136 | Ga0105248_10004201 | 3300009177 | Bacteria | 15925 |
| 137 | Ga0105248_10005373 | 3300009177 | Bacteria | 14081 |
| 138 | Ga0105248_10039683 | 3300009177 | Bacteria | 5277 |
| 139 | Ga0105248_10446280 | 3300009177 | Bacteria | 1458 |
| 140 | Ga0105237_10149381 | 3300009545 | Bacteria | 2332 |
| 141 | Ga0105238_10002209 | 3300009551 | Bacteria | 19627 |
| 142 | Ga0105238_10009812 | 3300009551 | Bacteria | 9587 |
| 143 | Ga0105238_10015232 | 3300009551 | Bacteria | 7784 |
| 144 | Ga0105249_10000550 | 3300009553 | Bacteria | 34737 |
| 145 | Ga0105249_10246336 | 3300009553 | Bacteria | 1769 |
| 146 | Ga0105239_10001128 | 3300010375 | Bacteria | 36839 |
| 147 | Ga0105239_10007021 | 3300010375 | Bacteria | 12962 |
| 148 | Ga0105239_10273124 | 3300010375 | Bacteria | 1902 |
| 149 | Ga0157373_10001054 | 3300013100 | Bacteria | 21230 |
| 150 | Ga0157373_10002934 | 3300013100 | Bacteria | 12916 |
| 151 | Ga0157371_10036519 | 3300013102 | Bacteria | 3518 |
| 152 | Ga0157370_10084892 | 3300013104 | Bacteria | 2975 |
| 153 | Ga0157370_10095014 | 3300013104 | Bacteria | 2796 |
| 154 | Ga0157370_10735773 | 3300013104 | Bacteria | 899 |
| 155 | Ga0157369_10003463 | 3300013105 | Bacteria | 18722 |
| 156 | Ga0157369_10008596 | 3300013105 | Bacteria | 11711 |
| 157 | Ga0157369_10016064 | 3300013105 | Bacteria | 8422 |
| 158 | Ga0157378_10540112 | 3300013297 | Bacteria | 1170 |
| 159 | Ga0163162_10130170 | 3300013306 | Bacteria | 2625 |
| 160 | Ga0163162_10206060 | 3300013306 | Bacteria | 2096 |
| 161 | Ga0163162_10286514 | 3300013306 | Bacteria | 1779 |
| 162 | Ga0163162_10347525 | 3300013306 | Bacteria | 1616 |
| 163 | Ga0157372_10017170 | 3300013307 | Bacteria | 7770 |
| 164 | Ga0157375_10026212 | 3300013308 | Bacteria | 5429 |
| 165 | Ga0163163_10002482 | 3300014325 | Bacteria | 15605 |
| 166 | Ga0163163_10067243 | 3300014325 | Bacteria | 3562 |
| 167 | Ga0157380_10019148 | 3300014326 | Bacteria | 5098 |
| 168 | Ga0157379_10000416 | 3300014968 | Bacteria | 34546 |
| 169 | Ga0157379_10017950 | 3300014968 | Bacteria | 6234 |
| 170 | Ga0197907_11194425 | 3300020069 | Bacteria | 1464 |
| 171 | Ga0206356_10431916 | 3300020070 | Bacteria | 1447 |
| 172 | Ga0206355_1092300 | 3300020076 | Bacteria | 1566 |
| 173 | Ga0213872_10017319 | 3300021361 | Bacteria | 3332 |
| 174 | Ga0213872_10032970 | 3300021361 | Bacteria | 2373 |
| 175 | Ga0213874_10023016 | 3300021377 | Bacteria | 1734 |
| 176 | Ga0213876_10000130 | 3300021384 | Bacteria | 81967 |
| 177 | Ga0213876_10000480 | 3300021384 | Bacteria | 31634 |
| 178 | Ga0209026_1000556 | 3300025250 | Bacteria | 25593 |
| 179 | Ga0209148_1012042 | 3300025254 | Bacteria | 1591 |
| 180 | Ga0209148_1020121 | 3300025254 | Bacteria | 1101 |
| 181 | Ga0209565_1000192 | 3300025263 | Bacteria | 74812 |
| 182 | Ga0209673_1001547 | 3300025273 | Bacteria | 20783 |
| 183 | Ga0209676_1000115 | 3300025292 | Bacteria | 205183 |
| 184 | Ga0209676_1000308 | 3300025292 | Bacteria | 95847 |
| 185 | Ga0209676_1000320 | 3300025292 | Bacteria | 93515 |
| 186 | Ga0209676_1003173 | 3300025292 | Bacteria | 10459 |
| 187 | Ga0209564_1001722 | 3300025295 | Bacteria | 20531 |
| 188 | Ga0209564_1033076 | 3300025295 | Bacteria | 1544 |
| 189 | Ga0209758_1000404 | 3300025297 | Bacteria | 74016 |
| 190 | Ga0209758_1001124 | 3300025297 | Bacteria | 34364 |
| 191 | Ga0209758_1002337 | 3300025297 | Bacteria | 19570 |
| 192 | Ga0209050_1000466 | 3300025298 | Bacteria | 71734 |
| 193 | Ga0209050_1000911 | 3300025298 | Bacteria | 39103 |
| 194 | Ga0209050_1001951 | 3300025298 | Bacteria | 19521 |
| 195 | Ga0209050_1015944 | 3300025298 | Bacteria | 3111 |
| 196 | Ga0209050_1037073 | 3300025298 | Bacteria | 1412 |
| 197 | Ga0209256_1000810 | 3300025299 | Bacteria | 40058 |
| 198 | Ga0209256_1004878 | 3300025299 | Bacteria | 8081 |
| 199 | Ga0209256_1053536 | 3300025299 | Bacteria | 965 |
| 200 | Ga0209051_1001718 | 3300025303 | Bacteria | 17480 |
| 201 | Ga0209257_1000090 | 3300025304 | Bacteria | 274746 |
| 202 | Ga0209257_1000227 | 3300025304 | Bacteria | 133512 |
| 203 | Ga0209257_1000338 | 3300025304 | Bacteria | 97721 |
| 204 | Ga0209257_1000507 | 3300025304 | Bacteria | 68362 |
| 205 | Ga0209257_1000554 | 3300025304 | Bacteria | 64085 |
| 206 | Ga0209257_1005664 | 3300025304 | Bacteria | 8624 |
| 207 | Ga0207682_10009214 | 3300025893 | Bacteria | 3899 |
| 208 | Ga0207645_10075528 | 3300025907 | Bacteria | 2157 |
| 209 | Ga0207643_10231562 | 3300025908 | Bacteria | 1133 |
| 210 | Ga0207705_10020966 | 3300025909 | Bacteria | 4662 |
| 211 | Ga0207705_10058229 | 3300025909 | Bacteria | 2787 |
| 212 | Ga0207705_10191783 | 3300025909 | Bacteria | 1546 |
| 213 | Ga0207705_10266877 | 3300025909 | Bacteria | 1308 |
| 214 | Ga0207707_10031921 | 3300025912 | Bacteria | 4610 |
| 215 | Ga0207695_10000012 | 3300025913 | Bacteria | 840961 |
| 216 | Ga0207695_10001434 | 3300025913 | Bacteria | 40063 |
| 217 | Ga0207695_10002208 | 3300025913 | Bacteria | 29280 |
| 218 | Ga0207695_10008553 | 3300025913 | Bacteria | 12789 |
| 219 | Ga0207695_10010460 | 3300025913 | Bacteria | 11347 |
| 220 | Ga0207695_10062992 | 3300025913 | Bacteria | 3825 |
| 221 | Ga0207695_10247340 | 3300025913 | Bacteria | 1683 |
| 222 | Ga0207660_10112537 | 3300025917 | Bacteria | 2050 |
| 223 | Ga0207657_10009221 | 3300025919 | Bacteria | 9947 |
| 224 | Ga0207657_10054397 | 3300025919 | Bacteria | 3461 |
| 225 | Ga0207657_10079861 | 3300025919 | Bacteria | 2751 |
| 226 | Ga0207649_10036828 | 3300025920 | Bacteria | 2950 |
| 227 | Ga0207652_10008581 | 3300025921 | Bacteria | 8223 |
| 228 | Ga0207652_10073367 | 3300025921 | Bacteria | 2977 |
| 229 | Ga0207652_10301602 | 3300025921 | Bacteria | 1446 |
| 230 | Ga0207681_10026142 | 3300025923 | Bacteria | 3762 |
| 231 | Ga0207681_10247864 | 3300025923 | Bacteria | 1389 |
| 232 | Ga0207681_10434961 | 3300025923 | Bacteria | 1065 |
| 233 | Ga0207694_10000006 | 3300025924 | Bacteria | 631109 |
| 234 | Ga0207694_10009016 | 3300025924 | Bacteria | 7532 |
| 235 | Ga0207694_10061569 | 3300025924 | Bacteria | 2921 |
| 236 | Ga0207694_10103279 | 3300025924 | Bacteria | 2260 |
| 237 | Ga0207694_10351773 | 3300025924 | Bacteria | 1220 |
| 238 | Ga0207650_10000030 | 3300025925 | Bacteria | 235824 |
| 239 | Ga0207650_10220019 | 3300025925 | Bacteria | 1528 |
| 240 | Ga0207650_10476370 | 3300025925 | Bacteria | 1041 |
| 241 | Ga0207659_10212741 | 3300025926 | Bacteria | 1550 |
| 242 | Ga0207687_10121269 | 3300025927 | Bacteria | 1956 |
| 243 | Ga0207644_10040659 | 3300025931 | Bacteria | 3287 |
| 244 | Ga0207644_10078662 | 3300025931 | Bacteria | 2431 |
| 245 | Ga0207690_10000230 | 3300025932 | Bacteria | 41628 |
| 246 | Ga0207690_10008980 | 3300025932 | Bacteria | 5932 |
| 247 | Ga0207690_10055025 | 3300025932 | Bacteria | 2678 |
| 248 | Ga0207706_10053367 | 3300025933 | Bacteria | 3569 |
| 249 | Ga0207709_10136663 | 3300025935 | Bacteria | 1679 |
| 250 | Ga0207704_10038218 | 3300025938 | Bacteria | 2781 |
| 251 | Ga0207711_10000718 | 3300025941 | Bacteria | 32642 |
| 252 | Ga0207711_10000998 | 3300025941 | Bacteria | 27132 |
| 253 | Ga0207711_10004868 | 3300025941 | Bacteria | 11397 |
| 254 | Ga0207711_10017546 | 3300025941 | Bacteria | 5946 |
| 255 | Ga0207711_10380187 | 3300025941 | Bacteria | 1310 |
| 256 | Ga0207689_10246808 | 3300025942 | Bacteria | 1476 |
| 257 | Ga0207679_10042321 | 3300025945 | Bacteria | 3273 |
| 258 | Ga0207667_10000026 | 3300025949 | Bacteria | 343713 |
| 259 | Ga0207667_10023360 | 3300025949 | Bacteria | 6808 |
| 260 | Ga0207667_10037950 | 3300025949 | Bacteria | 5148 |
| 261 | Ga0207667_10363451 | 3300025949 | Bacteria | 1476 |
| 262 | Ga0207651_10152703 | 3300025960 | Bacteria | 1800 |
| 263 | Ga0207712_10003727 | 3300025961 | Bacteria | 9618 |
| 264 | Ga0207712_10468830 | 3300025961 | Bacteria | 1071 |
| 265 | Ga0207668_10000042 | 3300025972 | Bacteria | 103877 |
| 266 | Ga0207668_10004107 | 3300025972 | Bacteria | 8550 |
| 267 | Ga0207668_10007793 | 3300025972 | Bacteria | 6371 |
| 268 | Ga0207668_10025841 | 3300025972 | Bacteria | 3805 |
| 269 | Ga0207668_10028006 | 3300025972 | Bacteria | 3678 |
| 270 | Ga0207668_10160525 | 3300025972 | Bacteria | 1751 |
| 271 | Ga0207668_10348571 | 3300025972 | Bacteria | 1237 |
| 272 | Ga0207640_10121830 | 3300025981 | Bacteria | 1870 |
| 273 | Ga0207658_10000417 | 3300025986 | Bacteria | 40403 |
| 274 | Ga0207658_10001987 | 3300025986 | Bacteria | 15254 |
| 275 | Ga0207658_10005993 | 3300025986 | Bacteria | 8309 |
| 276 | Ga0207658_10632973 | 3300025986 | Bacteria | 963 |
| 277 | Ga0207703_10000051 | 3300026035 | Bacteria | 145390 |
| 278 | Ga0207703_10004794 | 3300026035 | Bacteria | 11023 |
| 279 | Ga0207703_10159162 | 3300026035 | Bacteria | 1976 |
| 280 | Ga0207639_10001861 | 3300026041 | Bacteria | 14184 |
| 281 | Ga0207639_10056227 | 3300026041 | Bacteria | 3015 |
| 282 | Ga0207639_10149239 | 3300026041 | Bacteria | 1956 |
| 283 | Ga0207639_10181729 | 3300026041 | Bacteria | 1790 |
| 284 | Ga0207678_10561479 | 3300026067 | Bacteria | 999 |
| 285 | Ga0207702_10390091 | 3300026078 | Unclassified | 1341 |
| 286 | Ga0207641_10000003 | 3300026088 | Bacteria | 496984 |
| 287 | Ga0207641_10006137 | 3300026088 | Bacteria | 10167 |
| 288 | Ga0207641_10006181 | 3300026088 | Bacteria | 10132 |
| 289 | Ga0207641_10021767 | 3300026088 | Bacteria | 5270 |
| 290 | Ga0207641_10024325 | 3300026088 | Bacteria | 4992 |
| 291 | Ga0207641_10064399 | 3300026088 | Bacteria | 3133 |
| 292 | Ga0207641_10499424 | 3300026088 | Bacteria | 1181 |
| 293 | Ga0207676_10000227 | 3300026095 | Bacteria | 48869 |
| 294 | Ga0207676_10001439 | 3300026095 | Bacteria | 17699 |
| 295 | Ga0207676_10002708 | 3300026095 | Bacteria | 12609 |
| 296 | Ga0207676_10083156 | 3300026095 | Bacteria | 2606 |
| 297 | Ga0207676_10105806 | 3300026095 | Bacteria | 2343 |
| 298 | Ga0207675_100013589 | 3300026118 | Bacteria | 7600 |
| 299 | Ga0207675_100243719 | 3300026118 | Bacteria | 1737 |
| 300 | Ga0207683_10029433 | 3300026121 | Bacteria | 4755 |
| 301 | Ga0207698_10008529 | 3300026142 | Bacteria | 6491 |
| 302 | Ga0207698_10208457 | 3300026142 | Bacteria | 1756 |
| 303 | Ga0210000_1013411 | 3300027462 | Bacteria | 1223 |
| 304 | Ga0209999_1008725 | 3300027543 | Bacteria | 1831 |
| 305 | Ga0209813_10000758 | 3300027866 | Bacteria | 7387 |
| 306 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 307 | Ga0268266_10000705 | 3300028379 | Bacteria | 45155 |
| 308 | Ga0268266_10082767 | 3300028379 | Bacteria | 2800 |
| 309 | Ga0268266_10138329 | 3300028379 | Bacteria | 2183 |
| 310 | Ga0268266_10190056 | 3300028379 | Bacteria | 1874 |
| 311 | Ga0268266_10268142 | 3300028379 | Bacteria | 1584 |
| 312 | Ga0268265_10000661 | 3300028380 | Bacteria | 34194 |
| 313 | Ga0268265_10004852 | 3300028380 | Bacteria | 9269 |
| 314 | Ga0268265_10015154 | 3300028380 | Bacteria | 5268 |
| 315 | Ga0268265_10018691 | 3300028380 | Bacteria | 4806 |
| 316 | Ga0268265_10042070 | 3300028380 | Bacteria | 3387 |
| 317 | Ga0268265_10096082 | 3300028380 | Bacteria | 2381 |
| 318 | Ga0268265_10110737 | 3300028380 | Bacteria | 2241 |
| 319 | Ga0268265_10158000 | 3300028380 | Bacteria | 1921 |
| 320 | Ga0268265_10279993 | 3300028380 | Bacteria | 1492 |
| 321 | Ga0268264_10000014 | 3300028381 | Bacteria | 509962 |
| 322 | Ga0268264_10000205 | 3300028381 | Bacteria | 120743 |
| 323 | Ga0268264_10009334 | 3300028381 | Bacteria | 8122 |
| 324 | Ga0268264_10018682 | 3300028381 | Bacteria | 5667 |
| 325 | Ga0265326_10027024 | 3300028558 | Bacteria | 1636 |
| 326 | Ga0265334_10035943 | 3300028573 | Bacteria | 1958 |
| 327 | Ga0265318_10000017 | 3300028577 | Bacteria | 174748 |
| 328 | Ga0265318_10070474 | 3300028577 | Bacteria | 1296 |
| 329 | Ga0307517_10045813 | 3300028786 | Bacteria | 4583 |
| 330 | Ga0307517_10048553 | 3300028786 | Bacteria | 4364 |
| 331 | Ga0307517_10071774 | 3300028786 | Bacteria | 3098 |
| 332 | Ga0307517_10191367 | 3300028786 | Bacteria | 1298 |
| 333 | Ga0307515_10024830 | 3300028794 | Bacteria | 10409 |
| 334 | Ga0265338_10000006 | 3300028800 | Bacteria | 570804 |
| 335 | Ga0265338_10041785 | 3300028800 | Bacteria | 4283 |
| 336 | Ga0265338_10068152 | 3300028800 | Bacteria | 3068 |
| 337 | Ga0265338_10186578 | 3300028800 | Bacteria | 1575 |
| 338 | Ga0265338_10260139 | 3300028800 | Bacteria | 1276 |
| 339 | Ga0265338_10295138 | 3300028800 | Bacteria | 1180 |
| 340 | Ga0307511_10044730 | 3300030521 | Bacteria | 3672 |
| 341 | Ga0265769_103594 | 3300030888 | Bacteria | 871 |
| 342 | Ga0265325_10000003 | 3300031241 | Bacteria | 370490 |
| 343 | Ga0265325_10160057 | 3300031241 | Bacteria | 1060 |
| 344 | Ga0265329_10024642 | 3300031242 | Bacteria | 1996 |
| 345 | Ga0265340_10006929 | 3300031247 | Bacteria | 6193 |
| 346 | Ga0265339_10000384 | 3300031249 | Bacteria | 34921 |
| 347 | Ga0265331_10039098 | 3300031250 | Bacteria | 2315 |
| 348 | Ga0265327_10000757 | 3300031251 | Bacteria | 50106 |
| 349 | Ga0265327_10001467 | 3300031251 | Bacteria | 29538 |
| 350 | Ga0265327_10001695 | 3300031251 | Bacteria | 26327 |
| 351 | Ga0307513_10000433 | 3300031456 | Bacteria | 60335 |
| 352 | Ga0307513_10000816 | 3300031456 | Bacteria | 45405 |
| 353 | Ga0307513_10002967 | 3300031456 | Bacteria | 23138 |
| 354 | Ga0307513_10012141 | 3300031456 | Bacteria | 10654 |
| 355 | Ga0307513_10523364 | 3300031456 | Bacteria | 901 |
| 356 | Ga0307408_100556620 | 3300031548 | Bacteria | 1013 |
| 357 | Ga0265314_10019618 | 3300031711 | Bacteria | 5234 |
| 358 | Ga0307516_10000006 | 3300031730 | Bacteria | 298586 |
| 359 | Ga0307516_10113587 | 3300031730 | Bacteria | 2506 |
| 360 | Ga0307405_10076422 | 3300031731 | Bacteria | 2173 |
| 361 | Ga0307413_10000908 | 3300031824 | Bacteria | 10480 |
| 362 | Ga0307413_10188813 | 3300031824 | Bacteria | 1477 |
| 363 | Ga0307413_10461761 | 3300031824 | Bacteria | 1010 |
| 364 | Ga0307410_10001707 | 3300031852 | Bacteria | 10130 |
| 365 | Ga0307410_10201253 | 3300031852 | Bacteria | 1520 |
| 366 | Ga0307410_10311332 | 3300031852 | Bacteria | 1246 |
| 367 | Ga0307406_10001617 | 3300031901 | Bacteria | 12386 |
| 368 | Ga0307409_100004772 | 3300031995 | Bacteria | 7683 |
| 369 | Ga0307409_100005890 | 3300031995 | Bacteria | 7121 |
| 370 | Ga0307409_100009208 | 3300031995 | Bacteria | 6053 |
| 371 | Ga0307409_100238072 | 3300031995 | Bacteria | 1655 |
| 372 | Ga0307416_100013050 | 3300032002 | Bacteria | 5631 |
| 373 | Ga0307416_100055631 | 3300032002 | Bacteria | 3188 |
| 374 | Ga0307416_100285114 | 3300032002 | Bacteria | 1631 |
| 375 | Ga0307414_10011419 | 3300032004 | Bacteria | 5207 |
| 376 | Ga0307414_10036540 | 3300032004 | Bacteria | 3280 |
| 377 | Ga0307414_10085657 | 3300032004 | Bacteria | 2322 |
| 378 | Ga0307414_10139254 | 3300032004 | Bacteria | 1897 |
| 379 | Ga0307414_10330168 | 3300032004 | Bacteria | 1301 |
| 380 | Ga0307414_10387112 | 3300032004 | Bacteria | 1211 |
| 381 | Ga0307414_10658417 | 3300032004 | Bacteria | 945 |
| 382 | Ga0307411_10001268 | 3300032005 | Bacteria | 10104 |
| 383 | Ga0307411_10033153 | 3300032005 | Bacteria | 3201 |
| 384 | Ga0307411_10064613 | 3300032005 | Bacteria | 2451 |
| 385 | Ga0307411_10205217 | 3300032005 | Bacteria | 1517 |
| 386 | Ga0307415_100030346 | 3300032126 | Bacteria | 3469 |
| 387 | Ga0307415_100113175 | 3300032126 | Bacteria | 2018 |
| 388 | Ga0307415_100122113 | 3300032126 | Bacteria | 1955 |
| 389 | Ga0307510_10002824 | 3300033180 | Bacteria | 19930 |
| 390 | Ga0307510_10003236 | 3300033180 | Bacteria | 18933 |
| 391 | Ga0307510_10029037 | 3300033180 | Bacteria | 6302 |
| 392 | Ga0307510_10152558 | 3300033180 | Bacteria | 1925 |
| 393 | Ga0373944_0034569 | 3300035089 | Bacteria | 1537 |
| 394 | Ga0373936_0002568 | 3300035113 | Bacteria | 6819 |
| 395 | Ga0373935_0047465 | 3300035692 | Bacteria | 2716 |
| 396 | Ga0373927_0000257 | 3300035695 | Bacteria | 41787 |
| 397 | Ga0373925_0000083 | 3300037068 | Bacteria | 101171 |
| 398 | Ga0373925_0105563 | 3300037068 | Bacteria | 2171 |
| 399 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 400 | Ga0395899_0000052 | 3300037312 | Bacteria | 221643 |
| 401 | Ga0395899_0087942 | 3300037312 | Bacteria | 2254 |
| 402 | Ga0395900_0001389 | 3300037418 | Bacteria | 28998 |
| 403 | Ga0395900_0006917 | 3300037418 | Bacteria | 11767 |
| 404 | Ga0395900_0141922 | 3300037418 | Bacteria | 2459 |
| 405 | Ga0395898_0022674 | 3300037466 | Bacteria | 6355 |
| 406 | Ga0395898_0420535 | 3300037466 | Bacteria | 1273 |
| 407 | Ga0395905_0001773 | 3300037471 | Bacteria | 25060 |
| 408 | Ga0395905_0021064 | 3300037471 | Bacteria | 6173 |
| 409 | Ga0395905_0073206 | 3300037471 | Bacteria | 3212 |
| 410 | Ga0395905_0081858 | 3300037471 | Bacteria | 3025 |
| 411 | Ga0395905_0300101 | 3300037471 | Bacteria | 1494 |
| 412 | Ga0395905_0381049 | 3300037471 | Bacteria | 1304 |
| 413 | Ga0436364_0441706 | 3300037853 | Bacteria | 1870 |
| 414 | Ga0395901_0000013 | 3300038443 | Bacteria | 375733 |
| 415 | Ga0395901_0010737 | 3300038443 | Bacteria | 9285 |
| 416 | Ga0395901_0053727 | 3300038443 | Bacteria | 4186 |
| 417 | Ga0395901_0156512 | 3300038443 | Bacteria | 2393 |
| 418 | Ga0395901_0252500 | 3300038443 | Bacteria | 1837 |
| 419 | Ga0395901_0925144 | 3300038443 | Bacteria | 852 |
| 420 | Ga0436365_0031959 | 3300039437 | Bacteria | 106267 |
| 421 | Ga0436365_1867062 | 3300039437 | Bacteria | 44331 |
| 422 | Ga0436361_0135680 | 3300039447 | Bacteria | 12581 |
| 423 | Ga0436361_1069972 | 3300039447 | Bacteria | 36104 |
| 424 | Ga0436363_1657838 | 3300039450 | Bacteria | 2193 |
| 425 | Ga0436362_0933212 | 3300039453 | Bacteria | 972 |
| 426 | Ga0439461_0017965 | 3300041410 | Bacteria | 1380 |
| 427 | Ga0451804_0259378 | 3300041463 | Bacteria | 714 |
| 428 | Ga0451837_0520645 | 3300041494 | Bacteria | 1349 |
| 429 | Ga0439441_020064 | 3300042001 | Bacteria | 1221 |
| 430 | Ga0439445_0016274 | 3300042004 | Bacteria | 1828 |
| 431 | Ga0439446_0012140 | 3300042156 | Bacteria | 2350 |
| 432 | Ga0439435_0006295 | 3300042436 | Bacteria | 2661 |
| 433 | Ga0439459_0011453 | 3300042438 | Bacteria | 1563 |
| 434 | Ga0450901_002401 | 3300042533 | Bacteria | 2024 |
| 435 | Ga0451577_0275287 | 3300042876 | Bacteria | 1525 |
| 436 | Ga0466961_0263845 | 3300044693 | Bacteria | 1056 |
| 437 | Ga0466970_0067814 | 3300044765 | Bacteria | 1916 |
| 438 | Ga0466960_0247039 | 3300044901 | Bacteria | 990 |
| 439 | Ga0466959_0339020 | 3300045049 | Bacteria | 1026 |
| 440 | Ga0495617_077565 | 3300046452 | Bacteria | 1090 |
| 441 | Ga0495627_001730 | 3300046453 | Bacteria | 11887 |
| 442 | Ga0495590_0001060 | 3300046457 | Bacteria | 12109 |
| 443 | Ga0495590_0092828 | 3300046457 | Bacteria | 1069 |
| 444 | Ga0495629_0031201 | 3300046459 | Bacteria | 3775 |
| 445 | Ga0495638_0000185 | 3300046460 | Bacteria | 95220 |
| 446 | Ga0495638_0001447 | 3300046460 | Bacteria | 21472 |
| 447 | Ga0495638_0012370 | 3300046460 | Bacteria | 5851 |
| 448 | Ga0495638_0013285 | 3300046460 | Bacteria | 5614 |
| 449 | Ga0495638_0013631 | 3300046460 | Bacteria | 5523 |
| 450 | Ga0495638_0159809 | 3300046460 | Bacteria | 1301 |
| 451 | Ga0495650_0000262 | 3300046471 | Bacteria | 101769 |
| 452 | Ga0495650_0030802 | 3300046471 | Bacteria | 2424 |
| 453 | Ga0495607_0016419 | 3300046501 | Bacteria | 4777 |
| 454 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 455 | Ga0495583_0008901 | 3300046506 | Bacteria | 6068 |
| 456 | Ga0495583_0017975 | 3300046506 | Bacteria | 3737 |
| 457 | Ga0495606_0026562 | 3300046507 | Bacteria | 4125 |
| 458 | Ga0495610_0000524 | 3300046512 | Bacteria | 38586 |
| 459 | Ga0495610_0004078 | 3300046512 | Bacteria | 10953 |
| 460 | Ga0495610_0004821 | 3300046512 | Bacteria | 9840 |
| 461 | Ga0495616_0000016 | 3300046513 | Bacteria | 182686 |
| 462 | Ga0495620_0037282 | 3300046515 | Bacteria | 2167 |
| 463 | Ga0495620_0065107 | 3300046515 | Bacteria | 1505 |
| 464 | Ga0495620_0076413 | 3300046515 | Bacteria | 1361 |
| 465 | Ga0495632_0005537 | 3300046519 | Bacteria | 8324 |
| 466 | Ga0495637_0008449 | 3300046520 | Bacteria | 5057 |
| 467 | Ga0495637_0012197 | 3300046520 | Bacteria | 4114 |
| 468 | Ga0495643_0005279 | 3300046522 | Bacteria | 8778 |
| 469 | Ga0495643_0021498 | 3300046522 | Bacteria | 3701 |
| 470 | Ga0495643_0040463 | 3300046522 | Bacteria | 2546 |
| 471 | Ga0495648_0000191 | 3300046524 | Bacteria | 70452 |
| 472 | Ga0495648_0058412 | 3300046524 | Bacteria | 2307 |
| 473 | Ga0495663_0065948 | 3300046525 | Bacteria | 1145 |
| 474 | Ga0495642_0002495 | 3300046528 | Bacteria | 7476 |
| 475 | Ga0495642_0156789 | 3300046528 | Bacteria | 986 |
| 476 | Ga0495652_0013684 | 3300046529 | Bacteria | 7300 |
| 477 | Ga0495652_0210369 | 3300046529 | Bacteria | 1469 |
| 478 | Ga0495654_0000039 | 3300046530 | Bacteria | 185363 |
| 479 | Ga0495654_0055861 | 3300046530 | Bacteria | 1910 |
| 480 | Ga0495587_0080652 | 3300046536 | Bacteria | 1886 |
| 481 | Ga0495621_0071935 | 3300046539 | Bacteria | 1275 |
| 482 | Ga0495621_0085032 | 3300046539 | Bacteria | 1185 |
| 483 | Ga0495597_0001783 | 3300046542 | Bacteria | 14781 |
| 484 | Ga0495597_0087967 | 3300046542 | Bacteria | 1321 |
| 485 | Ga0495645_0012405 | 3300046543 | Bacteria | 6006 |
| 486 | Ga0495645_0188755 | 3300046543 | Bacteria | 1406 |
| 487 | Ga0495622_0001637 | 3300046557 | Bacteria | 11065 |
| 488 | Ga0495633_0000400 | 3300046558 | Bacteria | 45378 |
| 489 | Ga0495668_0000196 | 3300046616 | Bacteria | 89097 |
| 490 | Ga0495668_0001487 | 3300046616 | Bacteria | 22445 |
| 491 | Ga0495668_0005577 | 3300046616 | Bacteria | 8463 |
| 492 | Ga0495668_0005918 | 3300046616 | Bacteria | 8137 |
| 493 | Ga0495668_0017075 | 3300046616 | Bacteria | 4215 |
| 494 | Ga0495668_0024518 | 3300046616 | Bacteria | 3430 |
| 495 | Ga0495668_0244086 | 3300046616 | Bacteria | 983 |
| 496 | Ga0495668_0284881 | 3300046616 | Bacteria | 905 |
| 497 | Ga0495625_0000034 | 3300046660 | Bacteria | 225120 |
| 498 | Ga0495625_0003282 | 3300046660 | Bacteria | 16341 |
| 499 | Ga0495625_0007139 | 3300046660 | Bacteria | 9810 |
| 500 | Ga0495625_0008727 | 3300046660 | Bacteria | 8592 |
| 501 | Ga0495625_0024259 | 3300046660 | Bacteria | 4617 |
| 502 | Ga0495625_0024485 | 3300046660 | Bacteria | 4593 |
| 503 | Ga0495625_0040638 | 3300046660 | Bacteria | 3389 |
| 504 | Ga0495669_0000007 | 3300046684 | Bacteria | 180797 |
| 505 | Ga0495669_0013681 | 3300046684 | Bacteria | 3463 |
| 506 | Ga0495669_0244293 | 3300046684 | Bacteria | 862 |
| 507 | Ga0495613_0003944 | 3300046689 | Bacteria | 11112 |
| 508 | Ga0495670_0023533 | 3300046691 | Bacteria | 3040 |
| 509 | Ga0495670_0223527 | 3300046691 | Bacteria | 1000 |
| 510 | Ga0495671_0136725 | 3300046692 | Bacteria | 1195 |
| 511 | Ga0495649_0000118 | 3300046694 | Bacteria | 69833 |
| 512 | Ga0495589_0005947 | 3300046794 | Bacteria | 6440 |
| 513 | Ga0495660_0015047 | 3300046810 | Bacteria | 4472 |
| 514 | Ga0495660_0026931 | 3300046810 | Bacteria | 3254 |
| 515 | Ga0495660_0138168 | 3300046810 | Bacteria | 1215 |
| 516 | Ga0495672_0004263 | 3300047320 | Bacteria | 11806 |
| 517 | Ga0495672_0076163 | 3300047320 | Bacteria | 1885 |
| 518 | Ga0495683_0066750 | 3300047323 | Bacteria | 1772 |
| 519 | Ga0495679_001640 | 3300047446 | Bacteria | 12470 |
| 520 | Ga0495673_0000312 | 3300047469 | Bacteria | 63724 |
| 521 | Ga0495673_0001133 | 3300047469 | Bacteria | 22860 |
| 522 | Ga0495673_0002400 | 3300047469 | Bacteria | 13213 |
| 523 | Ga0495686_0000509 | 3300047472 | Bacteria | 56406 |
| 524 | Ga0495686_0003171 | 3300047472 | Bacteria | 14489 |
| 525 | Ga0495686_0010311 | 3300047472 | Bacteria | 6655 |
| 526 | Ga0495686_0011050 | 3300047472 | Bacteria | 6387 |
| 527 | Ga0495686_0014939 | 3300047472 | Bacteria | 5325 |
| 528 | Ga0495686_0035439 | 3300047472 | Bacteria | 3208 |
| 529 | Ga0495686_0037088 | 3300047472 | Bacteria | 3125 |
| 530 | Ga0495686_0038463 | 3300047472 | Bacteria | 3060 |
| 531 | Ga0495686_0051221 | 3300047472 | Bacteria | 2591 |
| 532 | Ga0495686_0312485 | 3300047472 | Bacteria | 864 |
| 533 | Ga0495602_0167608 | 3300048088 | Bacteria | 1708 |
| 534 | Ga0496102_0164400 | 3300048905 | Bacteria | 2088 |
| 535 | Ga0496102_0317265 | 3300048905 | Bacteria | 1468 |
| 536 | Ga0496103_0141924 | 3300048906 | Bacteria | 1536 |
| 537 | Ga0496104_0346203 | 3300048907 | Bacteria | 1399 |
| 538 | Ga0496106_0003130 | 3300048909 | Bacteria | 12347 |
| 539 | Ga0496106_0489973 | 3300048909 | Bacteria | 988 |
| 540 | Ga0496107_0002780 | 3300048910 | Bacteria | 11536 |
| 541 | Ga0496107_0124198 | 3300048910 | Bacteria | 1902 |
| 542 | Ga0496108_0150024 | 3300048911 | Bacteria | 2011 |
| 543 | Ga0496108_0655089 | 3300048911 | Bacteria | 913 |
| 544 | Ga0496109_0079007 | 3300048912 | Bacteria | 3030 |
| 545 | Ga0496110_0246127 | 3300048913 | Bacteria | 1627 |
| 546 | Ga0496111_0177393 | 3300048914 | Bacteria | 1584 |
| 547 | Ga0496115_0000050 | 3300048918 | Bacteria | 109402 |
| 548 | Ga0496115_0001099 | 3300048918 | Bacteria | 19590 |
| 549 | Ga0496115_0002581 | 3300048918 | Bacteria | 13005 |
| 550 | Ga0496115_0026179 | 3300048918 | Bacteria | 4550 |
| 551 | Ga0496115_0164018 | 3300048918 | Bacteria | 1837 |
| 552 | Ga0496116_0035179 | 3300048919 | Bacteria | 3521 |
| 553 | Ga0496116_0130351 | 3300048919 | Bacteria | 1435 |
| 554 | Ga0496117_0042362 | 3300048920 | Bacteria | 3323 |
| 555 | Ga0496118_0015436 | 3300048921 | Bacteria | 7068 |
| 556 | Ga0496119_0013623 | 3300048922 | Bacteria | 6454 |
| 557 | Ga0496121_0000334 | 3300048924 | Bacteria | 98442 |
| 558 | Ga0496121_0002729 | 3300048924 | Bacteria | 26299 |
| 559 | Ga0496122_0003299 | 3300048925 | Bacteria | 21357 |
| 560 | Ga0496123_0000968 | 3300048926 | Bacteria | 44375 |
| 561 | Ga0496124_0021187 | 3300048927 | Bacteria | 5992 |
| 562 | Ga0496125_0001230 | 3300048928 | Bacteria | 38324 |
| 563 | Ga0496125_0012468 | 3300048928 | Bacteria | 8438 |
| 564 | Ga0496125_0093030 | 3300048928 | Bacteria | 2252 |
| 565 | Ga0496126_0003738 | 3300048929 | Bacteria | 18960 |
| 566 | Ga0501305_026434 | 3300049161 | Bacteria | 885 |
| 567 | Ga0495678_001443 | 3300049459 | Bacteria | 18707 |
| 568 | Ga0495682_0004718 | 3300049460 | Bacteria | 5767 |
| 569 | Ga0501320_014264 | 3300049536 | Bacteria | 857 |
| 570 | Ga0501324_009456 | 3300049540 | Bacteria | 874 |
| 571 | Ga0501032_0000950 | 3300049569 | Bacteria | 23379 |
| 572 | Ga0501033_0001413 | 3300049570 | Bacteria | 21332 |
| 573 | Ga0501033_0086235 | 3300049570 | Bacteria | 2299 |
| 574 | Ga0501034_0011389 | 3300049571 | Bacteria | 9223 |
| 575 | Ga0501034_0056038 | 3300049571 | Bacteria | 3967 |
| 576 | Ga0501034_0344541 | 3300049571 | Bacteria | 1420 |
| 577 | Ga0501036_0085633 | 3300049572 | Bacteria | 2664 |
| 578 | Ga0501037_0013314 | 3300049573 | Bacteria | 6062 |
| 579 | Ga0501037_0028549 | 3300049573 | Bacteria | 4121 |
| 580 | Ga0501043_0027087 | 3300049579 | Bacteria | 4499 |
| 581 | Ga0501047_0013576 | 3300049581 | Bacteria | 7724 |
| 582 | Ga0501047_0066328 | 3300049581 | Bacteria | 3479 |
| 583 | Ga0501047_0087274 | 3300049581 | Bacteria | 2997 |
| 584 | Ga0501047_0214940 | 3300049581 | Bacteria | 1780 |
| 585 | Ga0501047_0365351 | 3300049581 | Bacteria | 1279 |
| 586 | Ga0501048_0137160 | 3300049582 | Bacteria | 1729 |
| 587 | Ga0501067_0000034 | 3300049583 | Bacteria | 84068 |
| 588 | Ga0501067_0012799 | 3300049583 | Bacteria | 4647 |
| 589 | Ga0501068_0000104 | 3300049584 | Bacteria | 36213 |
| 590 | Ga0501068_0013901 | 3300049584 | Bacteria | 4591 |
| 591 | Ga0501073_0000013 | 3300049589 | Bacteria | 160591 |
| 592 | Ga0501073_0023689 | 3300049589 | Bacteria | 4406 |
| 593 | Ga0501077_0000032 | 3300049593 | Bacteria | 69728 |
| 594 | Ga0501080_0001395 | 3300049742 | Bacteria | 20223 |
| 595 | Ga0501080_0003079 | 3300049742 | Bacteria | 14728 |
| 596 | Ga0501080_0088993 | 3300049742 | Bacteria | 2868 |
| 597 | Ga0501035_0225134 | 3300049822 | Bacteria | 1600 |
| 598 | Ga0501044_0000869 | 3300049823 | Bacteria | 36398 |
| 599 | Ga0501044_0006431 | 3300049823 | Bacteria | 12981 |
| 600 | Ga0501044_0010504 | 3300049823 | Bacteria | 10046 |
| 601 | Ga0501044_0115104 | 3300049823 | Bacteria | 2694 |
| 602 | Ga0501044_0141329 | 3300049823 | Bacteria | 2396 |
| 603 | nmdc:mga00v17_1793_c1 | 3300050491 | Bacteria | 11124 |
| 604 | nmdc:mga0k408_31131_c1 | 3300050493 | Bacteria | 3045 |
| 605 | nmdc:mga0k408_50742_c1 | 3300050493 | Bacteria | 2402 |
| 606 | nmdc:mga06z11_1075_c1 | 3300050494 | Bacteria | 9942 |
| 607 | nmdc:mga04h51_752_c1 | 3300050495 | Bacteria | 7493 |
| 608 | nmdc:mga0sz30_2192_c1 | 3300050516 | Bacteria | 6981 |
| 609 | Ga0500635_0001781 | 3300053080 | Bacteria | 5246 |
| 610 | Ga0500578_0000015 | 3300053086 | Bacteria | 179217 |
| 611 | Ga0500578_0125032 | 3300053086 | Bacteria | 1615 |
| 612 | Ga0500643_000738 | 3300053087 | Bacteria | 21327 |
| 613 | Ga0500643_002144 | 3300053087 | Bacteria | 10454 |
| 614 | Ga0500643_004727 | 3300053087 | Bacteria | 6051 |
| 615 | Ga0500643_012764 | 3300053087 | Bacteria | 2995 |
| 616 | Ga0500644_0000058 | 3300053088 | Bacteria | 64557 |
| 617 | Ga0500583_0074174 | 3300053092 | Bacteria | 1632 |
| 618 | Ga0500651_0002465 | 3300053093 | Bacteria | 9784 |
| 619 | Ga0500651_0093292 | 3300053093 | Bacteria | 1851 |
| 620 | Ga0500566_0007869 | 3300053094 | Bacteria | 6312 |
| 621 | Ga0500641_0003231 | 3300053096 | Bacteria | 5760 |
| 622 | Ga0500641_0065355 | 3300053096 | Bacteria | 1521 |
| 623 | Ga0500554_001570 | 3300053102 | Bacteria | 4402 |
| 624 | Ga0500555_001857 | 3300053103 | Bacteria | 6290 |
| 625 | Ga0500556_0000893 | 3300053104 | Bacteria | 16678 |
| 626 | Ga0500556_0002934 | 3300053104 | Bacteria | 5158 |
| 627 | Ga0500556_0095175 | 3300053104 | Bacteria | 1141 |
| 628 | Ga0500556_0156986 | 3300053104 | Bacteria | 897 |
| 629 | Ga0500562_000621 | 3300053108 | Bacteria | 8552 |
| 630 | Ga0500562_004501 | 3300053108 | Bacteria | 3522 |
| 631 | Ga0500562_005117 | 3300053108 | Bacteria | 3295 |
| 632 | Ga0500572_000210 | 3300053111 | Bacteria | 20713 |
| 633 | Ga0500594_0000280 | 3300053118 | Bacteria | 11872 |
| 634 | Ga0500595_003351 | 3300053119 | Bacteria | 7519 |
| 635 | Ga0500595_026993 | 3300053119 | Bacteria | 1972 |
| 636 | Ga0500607_015685 | 3300053121 | Bacteria | 4358 |
| 637 | Ga0500608_001504 | 3300053122 | Bacteria | 8327 |
| 638 | Ga0500608_175879 | 3300053122 | Bacteria | 912 |
| 639 | Ga0500614_000784 | 3300053123 | Bacteria | 8047 |
| 640 | Ga0500618_000014 | 3300053125 | Bacteria | 177186 |
| 641 | Ga0500655_008975 | 3300053133 | Unclassified | 1798 |
| 642 | Ga0500658_0068421 | 3300053134 | Bacteria | 1493 |
| 643 | Ga0500559_0000004 | 3300053136 | Bacteria | 241551 |
| 644 | Ga0500559_0000467 | 3300053136 | Bacteria | 28771 |
| 645 | Ga0500559_0002837 | 3300053136 | Bacteria | 8754 |
| 646 | Ga0500559_0003898 | 3300053136 | Bacteria | 7210 |
| 647 | Ga0500559_0038592 | 3300053136 | Bacteria | 2075 |
| 648 | Ga0500559_0187255 | 3300053136 | Bacteria | 975 |
| 649 | Ga0500564_000229 | 3300053138 | Bacteria | 15600 |
| 650 | Ga0500577_0000828 | 3300053142 | Bacteria | 7999 |
| 651 | Ga0500590_008359 | 3300053148 | Bacteria | 5161 |
| 652 | Ga0500616_0007680 | 3300053153 | Bacteria | 6810 |
| 653 | Ga0500616_0037638 | 3300053153 | Bacteria | 2618 |
| 654 | Ga0500622_0004863 | 3300053156 | Bacteria | 8226 |
| 655 | Ga0500627_0010107 | 3300053158 | Bacteria | 3427 |
| 656 | Ga0500638_005103 | 3300053162 | Bacteria | 5179 |
| 657 | Ga0500639_020561 | 3300053163 | Bacteria | 3485 |
| 658 | Ga0500636_0000445 | 3300053177 | Bacteria | 22803 |
| 659 | Ga0500637_0000895 | 3300053178 | Bacteria | 11997 |
| 660 | Ga0500637_0003583 | 3300053178 | Bacteria | 7203 |
| 661 | Ga0500645_000556 | 3300053730 | Bacteria | 24661 |
| 662 | Ga0500645_003294 | 3300053730 | Bacteria | 6647 |
| 663 | Ga0500609_000324 | 3300053731 | Bacteria | 7071 |
| 664 | Ga0500596_003550 | 3300053735 | Bacteria | 2946 |
| 665 | Ga0587122_009570 | 3300059628 | Bacteria | 899 |
| 666 | Ga0501082_0166411 | 3300060353 | Bacteria | 1916 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041463 | Ga0451804_0259378 | Ga0451804_0259378_21_674 | 216 |
| 2 | 3300048906 | Ga0496103_0141924 | Ga0496103_0141924_21_674 | 217 |
| 3 | 3300013306 | Ga0163162_10286514 | Ga0163162_102865141 | 224 |
| 4 | 3300053122 | Ga0500608_175879 | Ga0500608_175879_202_900 | 231 |
| 5 | 3300009148 | Ga0105243_10156788 | Ga0105243_101567882 | 237 |
| 6 | 3300025935 | Ga0207709_10136663 | Ga0207709_101366632 | 237 |
| 7 | 3300009177 | Ga0105248_10446280 | Ga0105248_104462801 | 241 |
| 8 | 3300014325 | Ga0163163_10067243 | Ga0163163_100672435 | 241 |
| 9 | 3300046684 | Ga0495669_0244293 | Ga0495669_0244293_30_791 | 241 |
| 10 | 3300048910 | Ga0496107_0124198 | Ga0496107_0124198_1121_1879 | 243 |
| 11 | 3300048913 | Ga0496110_0246127 | Ga0496110_0246127_868_1608 | 243 |
| 12 | 3300013308 | Ga0157375_10026212 | Ga0157375_100262127 | 244 |
| 13 | 3300048905 | Ga0496102_0164400 | Ga0496102_0164400_805_1566 | 244 |
| 14 | 3300048907 | Ga0496104_0346203 | Ga0496104_0346203_203_964 | 244 |
| 15 | 3300048911 | Ga0496108_0150024 | Ga0496108_0150024_379_1140 | 244 |
| 16 | 3300048912 | Ga0496109_0079007 | Ga0496109_0079007_1825_2586 | 244 |
| 17 | iso_pu_bacteria | 2643221541 | 2643727451 | 248 |
| 18 | iso_pu_bacteria | 2643221606 | 2644041389 | 248 |
| 19 | iso_pu_bacteria | 2643221671 | 2644394929 | 248 |
| 20 | 3300005347 | Ga0070668_100000545 | Ga0070668_10000054516 | 249 |
| 21 | 3300005843 | Ga0068860_100000027 | Ga0068860_100000027137 | 249 |
| 22 | 3300025972 | Ga0207668_10007793 | Ga0207668_100077939 | 249 |
| 23 | 3300028380 | Ga0268265_10004852 | Ga0268265_100048523 | 249 |
| 24 | 3300028380 | Ga0268265_10015154 | Ga0268265_100151545 | 249 |
| 25 | 3300028381 | Ga0268264_10000014 | Ga0268264_10000014451 | 249 |
| 26 | 3300044765 | Ga0466970_0067814 | Ga0466970_0067814_1031_1783 | 249 |
| 27 | 3300046525 | Ga0495663_0065948 | Ga0495663_0065948_353_1111 | 249 |
| 28 | 3300046616 | Ga0495668_0017075 | Ga0495668_0017075_105_863 | 251 |
| 29 | 3300005347 | Ga0070668_100058996 | Ga0070668_1000589962 | 252 |
| 30 | 3300005841 | Ga0068863_100101228 | Ga0068863_1001012284 | 252 |
| 31 | 3300009551 | Ga0105238_10015232 | Ga0105238_1001523212 | 252 |
| 32 | 3300025972 | Ga0207668_10348571 | Ga0207668_103485712 | 252 |
| 33 | 3300026088 | Ga0207641_10024325 | Ga0207641_100243254 | 252 |
| 34 | 3300028380 | Ga0268265_10042070 | Ga0268265_100420704 | 252 |
| 35 | 3300035692 | Ga0373935_0047465 | Ga0373935_0047465_1433_2194 | 252 |
| 36 | 3300037068 | Ga0373925_0105563 | Ga0373925_0105563_118_879 | 252 |
| 37 | 3300046528 | Ga0495642_0002495 | Ga0495642_0002495_2289_3050 | 252 |
| 38 | 3300046616 | Ga0495668_0024518 | Ga0495668_0024518_838_1599 | 252 |
| 39 | 3300046616 | Ga0495668_0244086 | Ga0495668_0244086_76_837 | 252 |
| 40 | 3300046660 | Ga0495625_0007139 | Ga0495625_0007139_3975_4736 | 252 |
| 41 | 3300047472 | Ga0495686_0014939 | Ga0495686_0014939_3192_3953 | 252 |
| 42 | 3300048088 | Ga0495602_0167608 | Ga0495602_0167608_95_856 | 252 |
| 43 | 3300049540 | Ga0501324_009456 | Ga0501324_009456_14_775 | 252 |
| 44 | 3300049570 | Ga0501033_0086235 | Ga0501033_0086235_214_975 | 252 |
| 45 | 3300049573 | Ga0501037_0028549 | Ga0501037_0028549_2123_2884 | 252 |
| 46 | 3300049581 | Ga0501047_0066328 | Ga0501047_0066328_1117_1878 | 252 |
| 47 | 3300049581 | Ga0501047_0365351 | Ga0501047_0365351_318_1079 | 252 |
| 48 | 3300049823 | Ga0501044_0010504 | Ga0501044_0010504_2352_3113 | 252 |
| 49 | 3300053096 | Ga0500641_0065355 | Ga0500641_0065355_22_783 | 252 |
| 50 | 3300009177 | Ga0105248_10004201 | Ga0105248_100042017 | 253 |
| 51 | 3300009553 | Ga0105249_10246336 | Ga0105249_102463363 | 253 |
| 52 | 3300013306 | Ga0163162_10130170 | Ga0163162_101301704 | 253 |
| 53 | 3300014325 | Ga0163163_10002482 | Ga0163163_1000248210 | 253 |
| 54 | 3300014968 | Ga0157379_10000416 | Ga0157379_100004165 | 253 |
| 55 | 3300037471 | Ga0395905_0001773 | Ga0395905_0001773_9761_10561 | 253 |
| 56 | 3300046459 | Ga0495629_0031201 | Ga0495629_0031201_1276_2040 | 253 |
| 57 | 3300046515 | Ga0495620_0037282 | Ga0495620_0037282_44_808 | 253 |
| 58 | 3300046522 | Ga0495643_0005279 | Ga0495643_0005279_7626_8390 | 253 |
| 59 | 3300046542 | Ga0495597_0001783 | Ga0495597_0001783_5533_6297 | 253 |
| 60 | 3300046557 | Ga0495622_0001637 | Ga0495622_0001637_1889_2653 | 253 |
| 61 | 3300049581 | Ga0501047_0013576 | Ga0501047_0013576_1254_2018 | 253 |
| 62 | 3300053080 | Ga0500635_0001781 | Ga0500635_0001781_1747_2511 | 253 |
| 63 | 3300053092 | Ga0500583_0074174 | Ga0500583_0074174_458_1222 | 253 |
| 64 | 3300053093 | Ga0500651_0002465 | Ga0500651_0002465_490_1254 | 253 |
| 65 | 3300053094 | Ga0500566_0007869 | Ga0500566_0007869_5155_5919 | 253 |
| 66 | 3300053119 | Ga0500595_003351 | Ga0500595_003351_6210_6974 | 253 |
| 67 | 3300053121 | Ga0500607_015685 | Ga0500607_015685_1563_2327 | 253 |
| 68 | 3300053123 | Ga0500614_000784 | Ga0500614_000784_1877_2641 | 253 |
| 69 | 3300053136 | Ga0500559_0003898 | Ga0500559_0003898_4770_5534 | 253 |
| 70 | 3300053148 | Ga0500590_008359 | Ga0500590_008359_3222_3986 | 253 |
| 71 | 3300053162 | Ga0500638_005103 | Ga0500638_005103_4244_5008 | 253 |
| 72 | 3300053177 | Ga0500636_0000445 | Ga0500636_0000445_11640_12404 | 253 |
| 73 | 3300053178 | Ga0500637_0000895 | Ga0500637_0000895_1583_2347 | 253 |
| 74 | 3300053178 | Ga0500637_0003583 | Ga0500637_0003583_3003_3767 | 253 |
| 75 | 3300053735 | Ga0500596_003550 | Ga0500596_003550_661_1425 | 253 |
| 76 | 3300025941 | Ga0207711_10380187 | Ga0207711_103801872 | 254 |
| 77 | 3300031456 | Ga0307513_10000433 | Ga0307513_1000043334 | 254 |
| 78 | 3300009093 | Ga0105240_10000314 | Ga0105240_1000031446 | 255 |
| 79 | 3300009098 | Ga0105245_10190260 | Ga0105245_101902601 | 255 |
| 80 | 3300025927 | Ga0207687_10121269 | Ga0207687_101212693 | 255 |
| 81 | 3300041494 | Ga0451837_0520645 | Ga0451837_0520645_96_878 | 255 |
| 82 | 3300046471 | Ga0495650_0030802 | Ga0495650_0030802_1584_2354 | 255 |
| 83 | 3300046543 | Ga0495645_0188755 | Ga0495645_0188755_30_833 | 255 |
| 84 | 3300047472 | Ga0495686_0000509 | Ga0495686_0000509_6272_7054 | 255 |
| 85 | 3300047472 | Ga0495686_0035439 | Ga0495686_0035439_2331_3113 | 255 |
| 86 | 3300047472 | Ga0495686_0312485 | Ga0495686_0312485_52_834 | 255 |
| 87 | 3300049460 | Ga0495682_0004718 | Ga0495682_0004718_1947_2750 | 255 |
| 88 | 3300049569 | Ga0501032_0000950 | Ga0501032_0000950_20899_21681 | 255 |
| 89 | 3300049571 | Ga0501034_0056038 | Ga0501034_0056038_2599_3381 | 255 |
| 90 | 3300049572 | Ga0501036_0085633 | Ga0501036_0085633_599_1381 | 255 |
| 91 | 3300049579 | Ga0501043_0027087 | Ga0501043_0027087_130_912 | 255 |
| 92 | 3300049581 | Ga0501047_0087274 | Ga0501047_0087274_898_1680 | 255 |
| 93 | 3300049583 | Ga0501067_0000034 | Ga0501067_0000034_57449_58231 | 255 |
| 94 | 3300049583 | Ga0501067_0012799 | Ga0501067_0012799_2592_3374 | 255 |
| 95 | 3300049584 | Ga0501068_0000104 | Ga0501068_0000104_12033_12815 | 255 |
| 96 | 3300049584 | Ga0501068_0013901 | Ga0501068_0013901_1934_2716 | 255 |
| 97 | 3300049589 | Ga0501073_0000013 | Ga0501073_0000013_33972_34754 | 255 |
| 98 | 3300049589 | Ga0501073_0023689 | Ga0501073_0023689_2242_3024 | 255 |
| 99 | 3300049593 | Ga0501077_0000032 | Ga0501077_0000032_61550_62332 | 255 |
| 100 | 3300049742 | Ga0501080_0001395 | Ga0501080_0001395_18248_19030 | 255 |
| 101 | 3300049742 | Ga0501080_0003079 | Ga0501080_0003079_7048_7830 | 255 |
| 102 | 3300049823 | Ga0501044_0006431 | Ga0501044_0006431_8265_9047 | 255 |
| 103 | 3300049823 | Ga0501044_0115104 | Ga0501044_0115104_1865_2647 | 255 |
| 104 | 3300053133 | Ga0500655_008975 | Ga0500655_008975_756_1559 | 255 |
| 105 | 3300060353 | Ga0501082_0166411 | Ga0501082_0166411_14_796 | 255 |
| 106 | 3300028380 | Ga0268265_10279993 | Ga0268265_102799931 | 256 |
| 107 | 3300046452 | Ga0495617_077565 | Ga0495617_077565_56_841 | 256 |
| 108 | 3300047472 | Ga0495686_0037088 | Ga0495686_0037088_1230_2000 | 256 |
| 109 | 3300047472 | Ga0495686_0038463 | Ga0495686_0038463_1620_2405 | 256 |
| 110 | 3300005335 | Ga0070666_10358267 | Ga0070666_103582671 | 257 |
| 111 | 3300005457 | Ga0070662_100014019 | Ga0070662_1000140193 | 257 |
| 112 | 3300005564 | Ga0070664_100357377 | Ga0070664_1003573772 | 257 |
| 113 | 3300005618 | Ga0068864_100011010 | Ga0068864_10001101010 | 257 |
| 114 | 3300005841 | Ga0068863_100051072 | Ga0068863_1000510727 | 257 |
| 115 | 3300025925 | Ga0207650_10476370 | Ga0207650_104763702 | 257 |
| 116 | 3300025933 | Ga0207706_10053367 | Ga0207706_100533675 | 257 |
| 117 | 3300025960 | Ga0207651_10152703 | Ga0207651_101527032 | 257 |
| 118 | 3300025986 | Ga0207658_10632973 | Ga0207658_106329731 | 257 |
| 119 | 3300026088 | Ga0207641_10064399 | Ga0207641_100643995 | 257 |
| 120 | 3300026095 | Ga0207676_10083156 | Ga0207676_100831561 | 257 |
| 121 | 3300026121 | Ga0207683_10029433 | Ga0207683_100294334 | 257 |
| 122 | 3300045049 | Ga0466959_0339020 | Ga0466959_0339020_50_850 | 257 |
| 123 | 3300046528 | Ga0495642_0156789 | Ga0495642_0156789_100_900 | 257 |
| 124 | 3300020076 | Ga0206355_1092300 | Ga0206355_10923001 | 258 |
| 125 | 3300039453 | Ga0436362_0933212 | Ga0436362_0933212_132_911 | 258 |
| 126 | 3300053108 | Ga0500562_004501 | Ga0500562_004501_2450_3229 | 258 |
| 127 | iso_pu_bacteria | 2643221614 | 2644087233 | 258 |
| 128 | iso_pu_bacteria | 2643221661 | 2644342186 | 258 |
| 129 | iso_pu_bacteria | 2643221666 | 2644368472 | 258 |
| 130 | iso_pu_bacteria | 2941485952 | 2941486011 | 258 |
| 131 | 3300005548 | Ga0070665_100056913 | Ga0070665_1000569135 | 259 |
| 132 | 3300009553 | Ga0105249_10000550 | Ga0105249_1000055029 | 259 |
| 133 | 3300014968 | Ga0157379_10017950 | Ga0157379_100179503 | 259 |
| 134 | 3300044693 | Ga0466961_0263845 | Ga0466961_0263845_52_834 | 259 |
| 135 | 3300046539 | Ga0495621_0085032 | Ga0495621_0085032_54_845 | 259 |
| 136 | 3300048905 | Ga0496102_0317265 | Ga0496102_0317265_94_876 | 259 |
| 137 | 3300049161 | Ga0501305_026434 | Ga0501305_026434_32_814 | 259 |
| 138 | iso_pu_bacteria | 2643221663 | 2644351554 | 259 |
| 139 | iso_pu_bacteria | 2791355048 | 2792458716 | 259 |
| 140 | iso_pu_bacteria | 2830075706 | 2830078104 | 259 |
| 141 | iso_pu_bacteria | 2843744320 | 2843745609 | 259 |
| 142 | iso_pu_bacteria | 2849560528 | 2849561224 | 259 |
| 143 | iso_pu_bacteria | 2849573788 | 2849576313 | 259 |
| 144 | iso_pu_bacteria | 2851153111 | 2851157260 | 259 |
| 145 | iso_pu_bacteria | 2898329390 | 2898332922 | 259 |
| 146 | iso_pu_bacteria | 2928972540 | 2928973426 | 259 |
| 147 | iso_pu_bacteria | 2977240413 | 2977240596 | 259 |
| 148 | 3300005563 | Ga0068855_100024093 | Ga0068855_1000240937 | 260 |
| 149 | 3300009093 | Ga0105240_10214524 | Ga0105240_102145242 | 260 |
| 150 | 3300009174 | Ga0105241_10121304 | Ga0105241_101213041 | 260 |
| 151 | 3300013297 | Ga0157378_10540112 | Ga0157378_105401121 | 260 |
| 152 | 3300021384 | Ga0213876_10000480 | Ga0213876_100004808 | 260 |
| 153 | 3300025949 | Ga0207667_10023360 | Ga0207667_100233607 | 260 |
| 154 | 3300032005 | Ga0307411_10064613 | Ga0307411_100646133 | 260 |
| 155 | 3300037418 | Ga0395900_0006917 | Ga0395900_0006917_9120_9920 | 260 |
| 156 | 3300037471 | Ga0395905_0081858 | Ga0395905_0081858_1216_2016 | 260 |
| 157 | 3300038443 | Ga0395901_0053727 | Ga0395901_0053727_2177_2977 | 260 |
| 158 | 3300039437 | Ga0436365_1867062 | Ga0436365_1867062_21689_22516 | 260 |
| 159 | 3300041410 | Ga0439461_0017965 | Ga0439461_0017965_493_1284 | 260 |
| 160 | 3300049571 | Ga0501034_0344541 | Ga0501034_0344541_563_1354 | 260 |
| 161 | 3300049822 | Ga0501035_0225134 | Ga0501035_0225134_641_1432 | 260 |
| 162 | iso_pu_bacteria | 2643221574 | 2643884497 | 260 |
| 163 | iso_pu_bacteria | 2643221598 | 2643998232 | 260 |
| 164 | iso_pu_bacteria | 2643221699 | 2644548560 | 260 |
| 165 | iso_pu_bacteria | 2643221699 | 2644548807 | 260 |
| 166 | 3300003794 | Ga0055531_10001364 | Ga0055531_1000136418 | 261 |
| 167 | 3300005329 | Ga0070683_100214460 | Ga0070683_1002144603 | 261 |
| 168 | 3300005344 | Ga0070661_100030083 | Ga0070661_1000300832 | 261 |
| 169 | 3300005539 | Ga0068853_100001308 | Ga0068853_10000130814 | 261 |
| 170 | 3300005539 | Ga0068853_100166221 | Ga0068853_1001662213 | 261 |
| 171 | 3300005563 | Ga0068855_100000144 | Ga0068855_10000014452 | 261 |
| 172 | 3300005563 | Ga0068855_100534466 | Ga0068855_1005344661 | 261 |
| 173 | 3300005614 | Ga0068856_100024065 | Ga0068856_1000240654 | 261 |
| 174 | 3300005616 | Ga0068852_100013845 | Ga0068852_1000138452 | 261 |
| 175 | 3300009174 | Ga0105241_10292303 | Ga0105241_102923031 | 261 |
| 176 | 3300010375 | Ga0105239_10001128 | Ga0105239_1000112832 | 261 |
| 177 | 3300010375 | Ga0105239_10007021 | Ga0105239_100070218 | 261 |
| 178 | 3300013105 | Ga0157369_10003463 | Ga0157369_100034637 | 261 |
| 179 | 3300013105 | Ga0157369_10016064 | Ga0157369_100160648 | 261 |
| 180 | 3300020069 | Ga0197907_11194425 | Ga0197907_111944252 | 261 |
| 181 | 3300025292 | Ga0209676_1000320 | Ga0209676_100032055 | 261 |
| 182 | 3300025298 | Ga0209050_1000911 | Ga0209050_100091119 | 261 |
| 183 | 3300025304 | Ga0209257_1000338 | Ga0209257_100033855 | 261 |
| 184 | 3300025913 | Ga0207695_10000012 | Ga0207695_1000001247 | 261 |
| 185 | 3300025920 | Ga0207649_10036828 | Ga0207649_100368285 | 261 |
| 186 | 3300025924 | Ga0207694_10000006 | Ga0207694_10000006611 | 261 |
| 187 | 3300025949 | Ga0207667_10000026 | Ga0207667_10000026348 | 261 |
| 188 | 3300026041 | Ga0207639_10001861 | Ga0207639_1000186114 | 261 |
| 189 | 3300026078 | Ga0207702_10390091 | Ga0207702_103900911 | 261 |
| 190 | 3300026142 | Ga0207698_10008529 | Ga0207698_100085292 | 261 |
| 191 | 3300028577 | Ga0265318_10000017 | Ga0265318_10000017163 | 261 |
| 192 | 3300028800 | Ga0265338_10000006 | Ga0265338_10000006449 | 261 |
| 193 | 3300031241 | Ga0265325_10000003 | Ga0265325_1000000393 | 261 |
| 194 | 3300031241 | Ga0265325_10160057 | Ga0265325_101600571 | 261 |
| 195 | 3300031242 | Ga0265329_10024642 | Ga0265329_100246422 | 261 |
| 196 | 3300031247 | Ga0265340_10006929 | Ga0265340_100069295 | 261 |
| 197 | 3300031249 | Ga0265339_10000384 | Ga0265339_100003845 | 261 |
| 198 | 3300031250 | Ga0265331_10039098 | Ga0265331_100390983 | 261 |
| 199 | 3300031251 | Ga0265327_10001695 | Ga0265327_100016958 | 261 |
| 200 | 3300031711 | Ga0265314_10019618 | Ga0265314_100196184 | 261 |
| 201 | 3300031730 | Ga0307516_10113587 | Ga0307516_101135873 | 261 |
| 202 | 3300037418 | Ga0395900_0141922 | Ga0395900_0141922_274_1065 | 261 |
| 203 | 3300037471 | Ga0395905_0073206 | Ga0395905_0073206_895_1686 | 261 |
| 204 | 3300038443 | Ga0395901_0010737 | Ga0395901_0010737_4014_4805 | 261 |
| 205 | 3300038443 | Ga0395901_0252500 | Ga0395901_0252500_645_1436 | 261 |
| 206 | 3300046529 | Ga0495652_0013684 | Ga0495652_0013684_3377_4198 | 261 |
| 207 | 3300046529 | Ga0495652_0210369 | Ga0495652_0210369_556_1347 | 261 |
| 208 | 3300046536 | Ga0495587_0080652 | Ga0495587_0080652_735_1526 | 261 |
| 209 | 3300046689 | Ga0495613_0003944 | Ga0495613_0003944_2896_3687 | 261 |
| 210 | 3300048909 | Ga0496106_0489973 | Ga0496106_0489973_33_824 | 261 |
| 211 | 3300049581 | Ga0501047_0214940 | Ga0501047_0214940_234_1025 | 261 |
| 212 | 3300049742 | Ga0501080_0088993 | Ga0501080_0088993_148_978 | 261 |
| 213 | 3300049823 | Ga0501044_0141329 | Ga0501044_0141329_570_1361 | 261 |
| 214 | 3300053111 | Ga0500572_000210 | Ga0500572_000210_10002_10793 | 261 |
| 215 | 3300053136 | Ga0500559_0038592 | Ga0500559_0038592_600_1391 | 261 |
| 216 | 3300005262 | Ga0065165_1023862 | Ga0065165_10238623 | 262 |
| 217 | 3300005331 | Ga0070670_100069961 | Ga0070670_1000699613 | 262 |
| 218 | 3300005333 | Ga0070677_10006543 | Ga0070677_100065434 | 262 |
| 219 | 3300005347 | Ga0070668_100257243 | Ga0070668_1002572433 | 262 |
| 220 | 3300005353 | Ga0070669_100193381 | Ga0070669_1001933813 | 262 |
| 221 | 3300005354 | Ga0070675_100012398 | Ga0070675_1000123981 | 262 |
| 222 | 3300005355 | Ga0070671_100183051 | Ga0070671_1001830513 | 262 |
| 223 | 3300005530 | Ga0070679_100341758 | Ga0070679_1003417583 | 262 |
| 224 | 3300005548 | Ga0070665_100057618 | Ga0070665_1000576183 | 262 |
| 225 | 3300005577 | Ga0068857_100140545 | Ga0068857_1001405453 | 262 |
| 226 | 3300005983 | Ga0081540_1083201 | Ga0081540_10832011 | 262 |
| 227 | 3300006186 | Ga0075369_10081739 | Ga0075369_100817392 | 262 |
| 228 | 3300014326 | Ga0157380_10019148 | Ga0157380_100191483 | 262 |
| 229 | 3300025893 | Ga0207682_10009214 | Ga0207682_100092144 | 262 |
| 230 | 3300025907 | Ga0207645_10075528 | Ga0207645_100755283 | 262 |
| 231 | 3300025908 | Ga0207643_10231562 | Ga0207643_102315621 | 262 |
| 232 | 3300025921 | Ga0207652_10301602 | Ga0207652_103016022 | 262 |
| 233 | 3300025923 | Ga0207681_10247864 | Ga0207681_102478643 | 262 |
| 234 | 3300025923 | Ga0207681_10434961 | Ga0207681_104349611 | 262 |
| 235 | 3300025926 | Ga0207659_10212741 | Ga0207659_102127412 | 262 |
| 236 | 3300025972 | Ga0207668_10160525 | Ga0207668_101605253 | 262 |
| 237 | 3300028379 | Ga0268266_10190056 | Ga0268266_101900562 | 262 |
| 238 | 3300028577 | Ga0265318_10070474 | Ga0265318_100704743 | 262 |
| 239 | 3300030888 | Ga0265769_103594 | Ga0265769_1035941 | 262 |
| 240 | 3300031824 | Ga0307413_10000908 | Ga0307413_1000090812 | 262 |
| 241 | 3300031824 | Ga0307413_10461761 | Ga0307413_104617611 | 262 |
| 242 | 3300031852 | Ga0307410_10001707 | Ga0307410_100017079 | 262 |
| 243 | 3300031852 | Ga0307410_10201253 | Ga0307410_102012531 | 262 |
| 244 | 3300031852 | Ga0307410_10311332 | Ga0307410_103113321 | 262 |
| 245 | 3300031995 | Ga0307409_100004772 | Ga0307409_1000047726 | 262 |
| 246 | 3300031995 | Ga0307409_100005890 | Ga0307409_1000058908 | 262 |
| 247 | 3300031995 | Ga0307409_100238072 | Ga0307409_1002380723 | 262 |
| 248 | 3300032002 | Ga0307416_100013050 | Ga0307416_1000130503 | 262 |
| 249 | 3300032002 | Ga0307416_100055631 | Ga0307416_1000556312 | 262 |
| 250 | 3300032002 | Ga0307416_100285114 | Ga0307416_1002851143 | 262 |
| 251 | 3300032004 | Ga0307414_10011419 | Ga0307414_100114195 | 262 |
| 252 | 3300032004 | Ga0307414_10387112 | Ga0307414_103871121 | 262 |
| 253 | 3300032005 | Ga0307411_10001268 | Ga0307411_1000126812 | 262 |
| 254 | 3300032005 | Ga0307411_10205217 | Ga0307411_102052172 | 262 |
| 255 | 3300032126 | Ga0307415_100030346 | Ga0307415_1000303461 | 262 |
| 256 | 3300032126 | Ga0307415_100113175 | Ga0307415_1001131753 | 262 |
| 257 | 3300032126 | Ga0307415_100122113 | Ga0307415_1001221131 | 262 |
| 258 | 3300037471 | Ga0395905_0300101 | Ga0395905_0300101_570_1367 | 262 |
| 259 | 3300042533 | Ga0450901_002401 | Ga0450901_002401_964_1755 | 262 |
| 260 | 3300042876 | Ga0451577_0275287 | Ga0451577_0275287_296_1093 | 262 |
| 261 | 3300046501 | Ga0495607_0016419 | Ga0495607_0016419_3444_4241 | 262 |
| 262 | 3300046524 | Ga0495648_0058412 | Ga0495648_0058412_176_991 | 262 |
| 263 | 3300046691 | Ga0495670_0223527 | Ga0495670_0223527_180_977 | 262 |
| 264 | 3300048911 | Ga0496108_0655089 | Ga0496108_0655089_79_876 | 262 |
| 265 | 3300048914 | Ga0496111_0177393 | Ga0496111_0177393_294_1091 | 262 |
| 266 | 3300053087 | Ga0500643_004727 | Ga0500643_004727_997_1794 | 262 |
| 267 | 3300053136 | Ga0500559_0000004 | Ga0500559_0000004_75258_76052 | 262 |
| 268 | 3300053163 | Ga0500639_020561 | Ga0500639_020561_1956_2750 | 262 |
| 269 | iso_pu_bacteria | 2510917020 | 2511120892 | 262 |
| 270 | iso_pu_bacteria | 2582581279 | 2585149901 | 262 |
| 271 | iso_pu_bacteria | 2582581280 | 2585155564 | 262 |
| 272 | iso_pu_bacteria | 2582581293 | 2585199407 | 262 |
| 273 | iso_pu_bacteria | 2585428106 | 2587915614 | 262 |
| 274 | iso_pu_bacteria | 2643221545 | 2643748128 | 262 |
| 275 | iso_pu_bacteria | 2643221552 | 2643781129 | 262 |
| 276 | iso_pu_bacteria | 2643221583 | 2643926863 | 262 |
| 277 | iso_pu_bacteria | 2643221584 | 2643930462 | 262 |
| 278 | iso_pu_bacteria | 2643221640 | 2644223163 | 262 |
| 279 | iso_pu_bacteria | 2643221642 | 2644236567 | 262 |
| 280 | iso_pu_bacteria | 2643221691 | 2644506864 | 262 |
| 281 | iso_pu_bacteria | 2818991435 | 2819540237 | 262 |
| 282 | iso_pu_bacteria | 2818991454 | 2819649201 | 262 |
| 283 | iso_pu_bacteria | 2857504554 | 2857505531 | 262 |
| 284 | iso_pu_bacteria | 2884960567 | 2884960954 | 262 |
| 285 | iso_pu_bacteria | 2928531327 | 2928532360 | 262 |
| 286 | 3300003781 | Ga0055536_1001254 | Ga0055536_100125414 | 263 |
| 287 | 3300003794 | Ga0055531_10013178 | Ga0055531_100131784 | 263 |
| 288 | 3300005347 | Ga0070668_100005838 | Ga0070668_1000058383 | 263 |
| 289 | 3300005618 | Ga0068864_100001043 | Ga0068864_10000104316 | 263 |
| 290 | 3300005719 | Ga0068861_100153294 | Ga0068861_1001532943 | 263 |
| 291 | 3300005985 | Ga0081539_10017674 | Ga0081539_100176743 | 263 |
| 292 | 3300009093 | Ga0105240_10382110 | Ga0105240_103821103 | 263 |
| 293 | 3300009177 | Ga0105248_10039683 | Ga0105248_100396835 | 263 |
| 294 | 3300013102 | Ga0157371_10036519 | Ga0157371_100365194 | 263 |
| 295 | 3300013104 | Ga0157370_10095014 | Ga0157370_100950144 | 263 |
| 296 | 3300013105 | Ga0157369_10008596 | Ga0157369_1000859612 | 263 |
| 297 | 3300013306 | Ga0163162_10347525 | Ga0163162_103475253 | 263 |
| 298 | 3300025292 | Ga0209676_1000115 | Ga0209676_1000115137 | 263 |
| 299 | 3300025292 | Ga0209676_1003173 | Ga0209676_10031738 | 263 |
| 300 | 3300025298 | Ga0209050_1037073 | Ga0209050_10370731 | 263 |
| 301 | 3300025304 | Ga0209257_1000090 | Ga0209257_1000090119 | 263 |
| 302 | 3300025972 | Ga0207668_10004107 | Ga0207668_1000410711 | 263 |
| 303 | 3300026067 | Ga0207678_10561479 | Ga0207678_105614791 | 263 |
| 304 | 3300026095 | Ga0207676_10002708 | Ga0207676_100027082 | 263 |
| 305 | 3300026118 | Ga0207675_100243719 | Ga0207675_1002437191 | 263 |
| 306 | 3300028379 | Ga0268266_10268142 | Ga0268266_102681422 | 263 |
| 307 | 3300028380 | Ga0268265_10110737 | Ga0268265_101107373 | 263 |
| 308 | 3300031251 | Ga0265327_10001467 | Ga0265327_100014677 | 263 |
| 309 | 3300031901 | Ga0307406_10001617 | Ga0307406_1000161712 | 263 |
| 310 | 3300031995 | Ga0307409_100009208 | Ga0307409_1000092085 | 263 |
| 311 | 3300032004 | Ga0307414_10085657 | Ga0307414_100856573 | 263 |
| 312 | 3300032004 | Ga0307414_10658417 | Ga0307414_106584171 | 263 |
| 313 | 3300032005 | Ga0307411_10033153 | Ga0307411_100331532 | 263 |
| 314 | 3300033180 | Ga0307510_10002824 | Ga0307510_1000282414 | 263 |
| 315 | 3300033180 | Ga0307510_10152558 | Ga0307510_101525583 | 263 |
| 316 | 3300046457 | Ga0495590_0092828 | Ga0495590_0092828_35_859 | 263 |
| 317 | 3300046506 | Ga0495583_0017975 | Ga0495583_0017975_642_1466 | 263 |
| 318 | 3300046522 | Ga0495643_0021498 | Ga0495643_0021498_343_1137 | 263 |
| 319 | 3300046539 | Ga0495621_0071935 | Ga0495621_0071935_181_975 | 263 |
| 320 | 3300046558 | Ga0495633_0000400 | Ga0495633_0000400_36485_37279 | 263 |
| 321 | 3300046616 | Ga0495668_0284881 | Ga0495668_0284881_36_860 | 263 |
| 322 | 3300046660 | Ga0495625_0008727 | Ga0495625_0008727_3119_3943 | 263 |
| 323 | 3300046694 | Ga0495649_0000118 | Ga0495649_0000118_56519_57313 | 263 |
| 324 | 3300048918 | Ga0496115_0026179 | Ga0496115_0026179_123_917 | 263 |
| 325 | 3300048919 | Ga0496116_0035179 | Ga0496116_0035179_875_1669 | 263 |
| 326 | 3300048925 | Ga0496122_0003299 | Ga0496122_0003299_15166_15960 | 263 |
| 327 | 3300048926 | Ga0496123_0000968 | Ga0496123_0000968_27330_28124 | 263 |
| 328 | 3300048928 | Ga0496125_0001230 | Ga0496125_0001230_32584_33378 | 263 |
| 329 | 3300048928 | Ga0496125_0093030 | Ga0496125_0093030_1167_1961 | 263 |
| 330 | 3300053087 | Ga0500643_000738 | Ga0500643_000738_849_1646 | 263 |
| 331 | 3300053087 | Ga0500643_002144 | Ga0500643_002144_9203_10027 | 263 |
| 332 | 3300053093 | Ga0500651_0093292 | Ga0500651_0093292_354_1148 | 263 |
| 333 | 3300053096 | Ga0500641_0003231 | Ga0500641_0003231_1123_1920 | 263 |
| 334 | 3300053104 | Ga0500556_0002934 | Ga0500556_0002934_3761_4558 | 263 |
| 335 | 3300053104 | Ga0500556_0095175 | Ga0500556_0095175_62_859 | 263 |
| 336 | 3300053108 | Ga0500562_000621 | Ga0500562_000621_6535_7332 | 263 |
| 337 | 3300053108 | Ga0500562_005117 | Ga0500562_005117_384_1181 | 263 |
| 338 | 3300053153 | Ga0500616_0037638 | Ga0500616_0037638_1639_2436 | 263 |
| 339 | 3300053730 | Ga0500645_000556 | Ga0500645_000556_4015_4812 | 263 |
| 340 | 3300004803 | Ga0058862_12862074 | Ga0058862_128620741 | 264 |
| 341 | 3300005618 | Ga0068864_100138567 | Ga0068864_1001385673 | 264 |
| 342 | 3300009545 | Ga0105237_10149381 | Ga0105237_101493814 | 264 |
| 343 | 3300021361 | Ga0213872_10032970 | Ga0213872_100329704 | 264 |
| 344 | 3300025254 | Ga0209148_1020121 | Ga0209148_10201211 | 264 |
| 345 | 3300026035 | Ga0207703_10159162 | Ga0207703_101591624 | 264 |
| 346 | 3300026095 | Ga0207676_10105806 | Ga0207676_101058064 | 264 |
| 347 | 3300028800 | Ga0265338_10068152 | Ga0265338_100681524 | 264 |
| 348 | 3300030521 | Ga0307511_10044730 | Ga0307511_100447304 | 264 |
| 349 | 3300031456 | Ga0307513_10012141 | Ga0307513_1001214112 | 264 |
| 350 | 3300031731 | Ga0307405_10076422 | Ga0307405_100764222 | 264 |
| 351 | 3300031824 | Ga0307413_10188813 | Ga0307413_101888133 | 264 |
| 352 | 3300032004 | Ga0307414_10036540 | Ga0307414_100365403 | 264 |
| 353 | 3300032004 | Ga0307414_10139254 | Ga0307414_101392543 | 264 |
| 354 | 3300032004 | Ga0307414_10330168 | Ga0307414_103301682 | 264 |
| 355 | 3300033180 | Ga0307510_10029037 | Ga0307510_100290376 | 264 |
| 356 | 3300035113 | Ga0373936_0002568 | Ga0373936_0002568_5151_5948 | 264 |
| 357 | 3300038443 | Ga0395901_0925144 | Ga0395901_0925144_41_838 | 264 |
| 358 | 3300039447 | Ga0436361_0135680 | Ga0436361_0135680_9095_9892 | 264 |
| 359 | 3300046460 | Ga0495638_0159809 | Ga0495638_0159809_13_810 | 264 |
| 360 | 3300047320 | Ga0495672_0076163 | Ga0495672_0076163_136_1002 | 264 |
| 361 | 3300003791 | Ga0055530_10002063 | Ga0055530_100020636 | 265 |
| 362 | 3300003794 | Ga0055531_10003088 | Ga0055531_1000308816 | 265 |
| 363 | 3300005262 | Ga0065165_1001741 | Ga0065165_100174121 | 265 |
| 364 | 3300005262 | Ga0065165_1027898 | Ga0065165_10278983 | 265 |
| 365 | 3300005327 | Ga0070658_10048570 | Ga0070658_100485704 | 265 |
| 366 | 3300005327 | Ga0070658_10111645 | Ga0070658_101116452 | 265 |
| 367 | 3300005331 | Ga0070670_100000007 | Ga0070670_100000007115 | 265 |
| 368 | 3300005336 | Ga0070680_100037532 | Ga0070680_1000375321 | 265 |
| 369 | 3300005336 | Ga0070680_100054717 | Ga0070680_1000547172 | 265 |
| 370 | 3300005339 | Ga0070660_100013760 | Ga0070660_1000137604 | 265 |
| 371 | 3300005339 | Ga0070660_100068786 | Ga0070660_1000687864 | 265 |
| 372 | 3300005347 | Ga0070668_100000129 | Ga0070668_10000012929 | 265 |
| 373 | 3300005355 | Ga0070671_100097113 | Ga0070671_1000971135 | 265 |
| 374 | 3300005366 | Ga0070659_100000457 | Ga0070659_10000045714 | 265 |
| 375 | 3300005366 | Ga0070659_100016600 | Ga0070659_1000166004 | 265 |
| 376 | 3300005367 | Ga0070667_100000611 | Ga0070667_1000006113 | 265 |
| 377 | 3300005436 | Ga0070713_100542169 | Ga0070713_1005421691 | 265 |
| 378 | 3300005458 | Ga0070681_10042610 | Ga0070681_100426102 | 265 |
| 379 | 3300005530 | Ga0070679_100045077 | Ga0070679_1000450775 | 265 |
| 380 | 3300005539 | Ga0068853_100026565 | Ga0068853_1000265655 | 265 |
| 381 | 3300005548 | Ga0070665_100000246 | Ga0070665_10000024615 | 265 |
| 382 | 3300005548 | Ga0070665_100000692 | Ga0070665_10000069227 | 265 |
| 383 | 3300005548 | Ga0070665_100041944 | Ga0070665_1000419445 | 265 |
| 384 | 3300005563 | Ga0068855_100362658 | Ga0068855_1003626582 | 265 |
| 385 | 3300005578 | Ga0068854_100202358 | Ga0068854_1002023581 | 265 |
| 386 | 3300005616 | Ga0068852_100264271 | Ga0068852_1002642712 | 265 |
| 387 | 3300005618 | Ga0068864_100000225 | Ga0068864_10000022541 | 265 |
| 388 | 3300005841 | Ga0068863_100000295 | Ga0068863_10000029511 | 265 |
| 389 | 3300005843 | Ga0068860_100000047 | Ga0068860_100000047117 | 265 |
| 390 | 3300005844 | Ga0068862_100000396 | Ga0068862_1000003961 | 265 |
| 391 | 3300005844 | Ga0068862_100041258 | Ga0068862_1000412584 | 265 |
| 392 | 3300006186 | Ga0075369_10001551 | Ga0075369_100015514 | 265 |
| 393 | 3300009093 | Ga0105240_10002602 | Ga0105240_100026023 | 265 |
| 394 | 3300009093 | Ga0105240_10003899 | Ga0105240_100038992 | 265 |
| 395 | 3300009093 | Ga0105240_10161382 | Ga0105240_101613824 | 265 |
| 396 | 3300009093 | Ga0105240_10163815 | Ga0105240_101638153 | 265 |
| 397 | 3300009177 | Ga0105248_10000112 | Ga0105248_1000011220 | 265 |
| 398 | 3300009551 | Ga0105238_10009812 | Ga0105238_100098125 | 265 |
| 399 | 3300010375 | Ga0105239_10273124 | Ga0105239_102731241 | 265 |
| 400 | 3300013104 | Ga0157370_10084892 | Ga0157370_100848923 | 265 |
| 401 | 3300013104 | Ga0157370_10735773 | Ga0157370_107357731 | 265 |
| 402 | 3300013307 | Ga0157372_10017170 | Ga0157372_100171703 | 265 |
| 403 | 3300021361 | Ga0213872_10017319 | Ga0213872_100173194 | 265 |
| 404 | 3300021377 | Ga0213874_10023016 | Ga0213874_100230162 | 265 |
| 405 | 3300021384 | Ga0213876_10000130 | Ga0213876_1000013069 | 265 |
| 406 | 3300025250 | Ga0209026_1000556 | Ga0209026_100055612 | 265 |
| 407 | 3300025254 | Ga0209148_1012042 | Ga0209148_10120421 | 265 |
| 408 | 3300025297 | Ga0209758_1000404 | Ga0209758_100040418 | 265 |
| 409 | 3300025298 | Ga0209050_1001951 | Ga0209050_100195119 | 265 |
| 410 | 3300025304 | Ga0209257_1000227 | Ga0209257_100022737 | 265 |
| 411 | 3300025304 | Ga0209257_1000507 | Ga0209257_100050734 | 265 |
| 412 | 3300025909 | Ga0207705_10020966 | Ga0207705_100209663 | 265 |
| 413 | 3300025909 | Ga0207705_10058229 | Ga0207705_100582293 | 265 |
| 414 | 3300025909 | Ga0207705_10266877 | Ga0207705_102668772 | 265 |
| 415 | 3300025913 | Ga0207695_10001434 | Ga0207695_1000143413 | 265 |
| 416 | 3300025913 | Ga0207695_10008553 | Ga0207695_100085533 | 265 |
| 417 | 3300025913 | Ga0207695_10010460 | Ga0207695_100104606 | 265 |
| 418 | 3300025913 | Ga0207695_10062992 | Ga0207695_100629928 | 265 |
| 419 | 3300025913 | Ga0207695_10247340 | Ga0207695_102473402 | 265 |
| 420 | 3300025917 | Ga0207660_10112537 | Ga0207660_101125373 | 265 |
| 421 | 3300025919 | Ga0207657_10009221 | Ga0207657_1000922113 | 265 |
| 422 | 3300025919 | Ga0207657_10054397 | Ga0207657_100543974 | 265 |
| 423 | 3300025919 | Ga0207657_10079861 | Ga0207657_100798613 | 265 |
| 424 | 3300025921 | Ga0207652_10073367 | Ga0207652_100733675 | 265 |
| 425 | 3300025924 | Ga0207694_10009016 | Ga0207694_100090163 | 265 |
| 426 | 3300025924 | Ga0207694_10103279 | Ga0207694_101032791 | 265 |
| 427 | 3300025925 | Ga0207650_10000030 | Ga0207650_10000030236 | 265 |
| 428 | 3300025931 | Ga0207644_10078662 | Ga0207644_100786623 | 265 |
| 429 | 3300025932 | Ga0207690_10000230 | Ga0207690_1000023024 | 265 |
| 430 | 3300025932 | Ga0207690_10055025 | Ga0207690_100550253 | 265 |
| 431 | 3300025941 | Ga0207711_10000718 | Ga0207711_1000071819 | 265 |
| 432 | 3300025949 | Ga0207667_10363451 | Ga0207667_103634512 | 265 |
| 433 | 3300025961 | Ga0207712_10003727 | Ga0207712_1000372714 | 265 |
| 434 | 3300025981 | Ga0207640_10121830 | Ga0207640_101218302 | 265 |
| 435 | 3300025986 | Ga0207658_10000417 | Ga0207658_1000041740 | 265 |
| 436 | 3300026041 | Ga0207639_10149239 | Ga0207639_101492392 | 265 |
| 437 | 3300026088 | Ga0207641_10006137 | Ga0207641_100061376 | 265 |
| 438 | 3300026088 | Ga0207641_10499424 | Ga0207641_104994242 | 265 |
| 439 | 3300026095 | Ga0207676_10000227 | Ga0207676_1000022734 | 265 |
| 440 | 3300026142 | Ga0207698_10208457 | Ga0207698_102084572 | 265 |
| 441 | 3300027462 | Ga0210000_1013411 | Ga0210000_10134112 | 265 |
| 442 | 3300027543 | Ga0209999_1008725 | Ga0209999_10087251 | 265 |
| 443 | 3300028379 | Ga0268266_10000003 | Ga0268266_10000003988 | 265 |
| 444 | 3300028379 | Ga0268266_10138329 | Ga0268266_101383293 | 265 |
| 445 | 3300028380 | Ga0268265_10000661 | Ga0268265_1000066140 | 265 |
| 446 | 3300028380 | Ga0268265_10018691 | Ga0268265_100186915 | 265 |
| 447 | 3300028380 | Ga0268265_10096082 | Ga0268265_100960823 | 265 |
| 448 | 3300028381 | Ga0268264_10000205 | Ga0268264_10000205106 | 265 |
| 449 | 3300028558 | Ga0265326_10027024 | Ga0265326_100270243 | 265 |
| 450 | 3300028573 | Ga0265334_10035943 | Ga0265334_100359432 | 265 |
| 451 | 3300028786 | Ga0307517_10048553 | Ga0307517_100485535 | 265 |
| 452 | 3300028786 | Ga0307517_10191367 | Ga0307517_101913672 | 265 |
| 453 | 3300028800 | Ga0265338_10041785 | Ga0265338_100417854 | 265 |
| 454 | 3300028800 | Ga0265338_10186578 | Ga0265338_101865783 | 265 |
| 455 | 3300028800 | Ga0265338_10260139 | Ga0265338_102601392 | 265 |
| 456 | 3300028800 | Ga0265338_10295138 | Ga0265338_102951381 | 265 |
| 457 | 3300031251 | Ga0265327_10000757 | Ga0265327_100007578 | 265 |
| 458 | 3300031456 | Ga0307513_10002967 | Ga0307513_1000296718 | 265 |
| 459 | 3300031548 | Ga0307408_100556620 | Ga0307408_1005566201 | 265 |
| 460 | 3300031730 | Ga0307516_10000006 | Ga0307516_10000006187 | 265 |
| 461 | 3300037312 | Ga0395899_0000018 | Ga0395899_0000018_287881_288681 | 265 |
| 462 | 3300037312 | Ga0395899_0087942 | Ga0395899_0087942_616_1416 | 265 |
| 463 | 3300037466 | Ga0395898_0420535 | Ga0395898_0420535_460_1260 | 265 |
| 464 | 3300037471 | Ga0395905_0381049 | Ga0395905_0381049_481_1281 | 265 |
| 465 | 3300037853 | Ga0436364_0441706 | Ga0436364_0441706_750_1550 | 265 |
| 466 | 3300038443 | Ga0395901_0156512 | Ga0395901_0156512_1323_2123 | 265 |
| 467 | 3300039437 | Ga0436365_0031959 | Ga0436365_0031959_93214_94026 | 265 |
| 468 | 3300039447 | Ga0436361_1069972 | Ga0436361_1069972_12453_13253 | 265 |
| 469 | 3300039450 | Ga0436363_1657838 | Ga0436363_1657838_880_1692 | 265 |
| 470 | 3300046460 | Ga0495638_0000185 | Ga0495638_0000185_44887_45684 | 265 |
| 471 | 3300046506 | Ga0495583_0008901 | Ga0495583_0008901_1430_2230 | 265 |
| 472 | 3300046512 | Ga0495610_0004821 | Ga0495610_0004821_2488_3285 | 265 |
| 473 | 3300046684 | Ga0495669_0000007 | Ga0495669_0000007_3016_3816 | 265 |
| 474 | 3300046684 | Ga0495669_0013681 | Ga0495669_0013681_1081_1881 | 265 |
| 475 | 3300048918 | Ga0496115_0002581 | Ga0496115_0002581_6611_7411 | 265 |
| 476 | 3300048918 | Ga0496115_0164018 | Ga0496115_0164018_18_905 | 265 |
| 477 | 3300048927 | Ga0496124_0021187 | Ga0496124_0021187_5104_5901 | 265 |
| 478 | 3300048928 | Ga0496125_0012468 | Ga0496125_0012468_4854_5651 | 265 |
| 479 | 3300048929 | Ga0496126_0003738 | Ga0496126_0003738_763_1560 | 265 |
| 480 | 3300049459 | Ga0495678_001443 | Ga0495678_001443_797_1594 | 265 |
| 481 | 3300049536 | Ga0501320_014264 | Ga0501320_014264_38_838 | 265 |
| 482 | 3300049570 | Ga0501033_0001413 | Ga0501033_0001413_19696_20496 | 265 |
| 483 | 3300049571 | Ga0501034_0011389 | Ga0501034_0011389_820_1620 | 265 |
| 484 | 3300049573 | Ga0501037_0013314 | Ga0501037_0013314_4183_4983 | 265 |
| 485 | 3300049582 | Ga0501048_0137160 | Ga0501048_0137160_673_1473 | 265 |
| 486 | 3300049823 | Ga0501044_0000869 | Ga0501044_0000869_6017_6817 | 265 |
| 487 | 3300050493 | nmdc:mga0k408_50742_c1 | nmdc:mga0k408_50742_c1_818_1615 | 265 |
| 488 | 3300050516 | nmdc:mga0sz30_2192_c1 | nmdc:mga0sz30_2192_c1_913_1710 | 265 |
| 489 | 3300053086 | Ga0500578_0000015 | Ga0500578_0000015_161960_162757 | 265 |
| 490 | 3300053118 | Ga0500594_0000280 | Ga0500594_0000280_3885_4682 | 265 |
| 491 | 3300053119 | Ga0500595_026993 | Ga0500595_026993_457_1257 | 265 |
| 492 | 3300053156 | Ga0500622_0004863 | Ga0500622_0004863_7384_8184 | 265 |
| 493 | 3300003215 | JGI25153J46596_10034119 | JGI25153J46596_100341191 | 266 |
| 494 | 3300003771 | Ga0055526_1018273 | Ga0055526_10182733 | 266 |
| 495 | 3300003773 | Ga0055537_1004582 | Ga0055537_10045824 | 266 |
| 496 | 3300003775 | Ga0055524_1008284 | Ga0055524_10082845 | 266 |
| 497 | 3300003790 | Ga0055528_1004170 | Ga0055528_10041706 | 266 |
| 498 | 3300003791 | Ga0055530_10008853 | Ga0055530_100088533 | 266 |
| 499 | 3300003794 | Ga0055531_10005840 | Ga0055531_100058406 | 266 |
| 500 | 3300005262 | Ga0065165_1001500 | Ga0065165_100150021 | 266 |
| 501 | 3300005327 | Ga0070658_10093397 | Ga0070658_100933974 | 266 |
| 502 | 3300005341 | Ga0070691_10002769 | Ga0070691_100027698 | 266 |
| 503 | 3300005347 | Ga0070668_100005299 | Ga0070668_10000529913 | 266 |
| 504 | 3300005347 | Ga0070668_100011144 | Ga0070668_1000111442 | 266 |
| 505 | 3300005347 | Ga0070668_100033288 | Ga0070668_1000332884 | 266 |
| 506 | 3300005353 | Ga0070669_100065309 | Ga0070669_1000653095 | 266 |
| 507 | 3300005355 | Ga0070671_100212500 | Ga0070671_1002125002 | 266 |
| 508 | 3300005366 | Ga0070659_100014839 | Ga0070659_1000148399 | 266 |
| 509 | 3300005367 | Ga0070667_100008781 | Ga0070667_10000878110 | 266 |
| 510 | 3300005367 | Ga0070667_100017154 | Ga0070667_1000171547 | 266 |
| 511 | 3300005367 | Ga0070667_100029432 | Ga0070667_1000294325 | 266 |
| 512 | 3300005458 | Ga0070681_10006503 | Ga0070681_1000650316 | 266 |
| 513 | 3300005530 | Ga0070679_100034113 | Ga0070679_1000341134 | 266 |
| 514 | 3300005539 | Ga0068853_100062079 | Ga0068853_1000620795 | 266 |
| 515 | 3300005539 | Ga0068853_100166610 | Ga0068853_1001666104 | 266 |
| 516 | 3300005548 | Ga0070665_100000689 | Ga0070665_10000068945 | 266 |
| 517 | 3300005548 | Ga0070665_100112614 | Ga0070665_1001126144 | 266 |
| 518 | 3300005563 | Ga0068855_100029641 | Ga0068855_1000296419 | 266 |
| 519 | 3300005564 | Ga0070664_100051493 | Ga0070664_1000514931 | 266 |
| 520 | 3300005617 | Ga0068859_100000111 | Ga0068859_10000011136 | 266 |
| 521 | 3300005617 | Ga0068859_100017207 | Ga0068859_1000172076 | 266 |
| 522 | 3300005618 | Ga0068864_100000304 | Ga0068864_10000030421 | 266 |
| 523 | 3300005618 | Ga0068864_100357201 | Ga0068864_1003572012 | 266 |
| 524 | 3300005719 | Ga0068861_100216290 | Ga0068861_1002162902 | 266 |
| 525 | 3300005841 | Ga0068863_100000076 | Ga0068863_10000007645 | 266 |
| 526 | 3300005841 | Ga0068863_100005065 | Ga0068863_10000506510 | 266 |
| 527 | 3300005842 | Ga0068858_100000079 | Ga0068858_10000007969 | 266 |
| 528 | 3300005842 | Ga0068858_100000500 | Ga0068858_10000050038 | 266 |
| 529 | 3300005843 | Ga0068860_100005396 | Ga0068860_10000539616 | 266 |
| 530 | 3300005844 | Ga0068862_100009983 | Ga0068862_1000099838 | 266 |
| 531 | 3300005844 | Ga0068862_100102330 | Ga0068862_1001023304 | 266 |
| 532 | 3300006042 | Ga0075368_10000230 | Ga0075368_1000023016 | 266 |
| 533 | 3300006048 | Ga0075363_100013053 | Ga0075363_1000130537 | 266 |
| 534 | 3300006051 | Ga0075364_10004820 | Ga0075364_1000482010 | 266 |
| 535 | 3300006178 | Ga0075367_10000291 | Ga0075367_1000029122 | 266 |
| 536 | 3300006195 | Ga0075366_10007206 | Ga0075366_100072066 | 266 |
| 537 | 3300006195 | Ga0075366_10307884 | Ga0075366_103078841 | 266 |
| 538 | 3300006353 | Ga0075370_10069294 | Ga0075370_100692943 | 266 |
| 539 | 3300006353 | Ga0075370_10154055 | Ga0075370_101540553 | 266 |
| 540 | 3300006881 | Ga0068865_100002622 | Ga0068865_1000026225 | 266 |
| 541 | 3300006931 | Ga0097620_100000111 | Ga0097620_10000011136 | 266 |
| 542 | 3300006931 | Ga0097620_100017207 | Ga0097620_1000172076 | 266 |
| 543 | 3300006946 | Ga0079104_1006367 | Ga0079104_10063673 | 266 |
| 544 | 3300009177 | Ga0105248_10005373 | Ga0105248_1000537318 | 266 |
| 545 | 3300009551 | Ga0105238_10002209 | Ga0105238_1000220910 | 266 |
| 546 | 3300013100 | Ga0157373_10001054 | Ga0157373_1000105427 | 266 |
| 547 | 3300013100 | Ga0157373_10002934 | Ga0157373_1000293410 | 266 |
| 548 | 3300013306 | Ga0163162_10206060 | Ga0163162_102060603 | 266 |
| 549 | 3300020070 | Ga0206356_10431916 | Ga0206356_104319163 | 266 |
| 550 | 3300025263 | Ga0209565_1000192 | Ga0209565_100019247 | 266 |
| 551 | 3300025273 | Ga0209673_1001547 | Ga0209673_100154713 | 266 |
| 552 | 3300025292 | Ga0209676_1000308 | Ga0209676_100030856 | 266 |
| 553 | 3300025295 | Ga0209564_1001722 | Ga0209564_100172218 | 266 |
| 554 | 3300025295 | Ga0209564_1033076 | Ga0209564_10330761 | 266 |
| 555 | 3300025297 | Ga0209758_1001124 | Ga0209758_100112411 | 266 |
| 556 | 3300025297 | Ga0209758_1002337 | Ga0209758_100233713 | 266 |
| 557 | 3300025298 | Ga0209050_1000466 | Ga0209050_100046644 | 266 |
| 558 | 3300025298 | Ga0209050_1015944 | Ga0209050_10159442 | 266 |
| 559 | 3300025299 | Ga0209256_1000810 | Ga0209256_100081016 | 266 |
| 560 | 3300025299 | Ga0209256_1004878 | Ga0209256_10048789 | 266 |
| 561 | 3300025299 | Ga0209256_1053536 | Ga0209256_10535361 | 266 |
| 562 | 3300025303 | Ga0209051_1001718 | Ga0209051_100171815 | 266 |
| 563 | 3300025304 | Ga0209257_1000554 | Ga0209257_100055436 | 266 |
| 564 | 3300025304 | Ga0209257_1005664 | Ga0209257_10056649 | 266 |
| 565 | 3300025909 | Ga0207705_10191783 | Ga0207705_101917833 | 266 |
| 566 | 3300025912 | Ga0207707_10031921 | Ga0207707_100319217 | 266 |
| 567 | 3300025913 | Ga0207695_10002208 | Ga0207695_1000220828 | 266 |
| 568 | 3300025921 | Ga0207652_10008581 | Ga0207652_100085816 | 266 |
| 569 | 3300025923 | Ga0207681_10026142 | Ga0207681_100261426 | 266 |
| 570 | 3300025924 | Ga0207694_10061569 | Ga0207694_100615695 | 266 |
| 571 | 3300025924 | Ga0207694_10351773 | Ga0207694_103517732 | 266 |
| 572 | 3300025925 | Ga0207650_10220019 | Ga0207650_102200191 | 266 |
| 573 | 3300025931 | Ga0207644_10040659 | Ga0207644_100406593 | 266 |
| 574 | 3300025932 | Ga0207690_10008980 | Ga0207690_100089803 | 266 |
| 575 | 3300025938 | Ga0207704_10038218 | Ga0207704_100382184 | 266 |
| 576 | 3300025941 | Ga0207711_10000998 | Ga0207711_100009986 | 266 |
| 577 | 3300025941 | Ga0207711_10004868 | Ga0207711_1000486812 | 266 |
| 578 | 3300025941 | Ga0207711_10017546 | Ga0207711_100175463 | 266 |
| 579 | 3300025942 | Ga0207689_10246808 | Ga0207689_102468082 | 266 |
| 580 | 3300025945 | Ga0207679_10042321 | Ga0207679_100423211 | 266 |
| 581 | 3300025949 | Ga0207667_10037950 | Ga0207667_100379507 | 266 |
| 582 | 3300025961 | Ga0207712_10468830 | Ga0207712_104688301 | 266 |
| 583 | 3300025972 | Ga0207668_10000042 | Ga0207668_1000004266 | 266 |
| 584 | 3300025972 | Ga0207668_10025841 | Ga0207668_100258418 | 266 |
| 585 | 3300025972 | Ga0207668_10028006 | Ga0207668_100280063 | 266 |
| 586 | 3300025986 | Ga0207658_10001987 | Ga0207658_1000198710 | 266 |
| 587 | 3300025986 | Ga0207658_10005993 | Ga0207658_100059934 | 266 |
| 588 | 3300026035 | Ga0207703_10000051 | Ga0207703_1000005147 | 266 |
| 589 | 3300026035 | Ga0207703_10004794 | Ga0207703_100047943 | 266 |
| 590 | 3300026041 | Ga0207639_10056227 | Ga0207639_100562275 | 266 |
| 591 | 3300026041 | Ga0207639_10181729 | Ga0207639_101817293 | 266 |
| 592 | 3300026088 | Ga0207641_10000003 | Ga0207641_1000000356 | 266 |
| 593 | 3300026088 | Ga0207641_10006181 | Ga0207641_100061817 | 266 |
| 594 | 3300026088 | Ga0207641_10021767 | Ga0207641_100217673 | 266 |
| 595 | 3300026095 | Ga0207676_10001439 | Ga0207676_1000143912 | 266 |
| 596 | 3300026118 | Ga0207675_100013589 | Ga0207675_10001358910 | 266 |
| 597 | 3300027866 | Ga0209813_10000758 | Ga0209813_100007588 | 266 |
| 598 | 3300028379 | Ga0268266_10000705 | Ga0268266_100007059 | 266 |
| 599 | 3300028379 | Ga0268266_10082767 | Ga0268266_100827674 | 266 |
| 600 | 3300028380 | Ga0268265_10158000 | Ga0268265_101580003 | 266 |
| 601 | 3300028381 | Ga0268264_10009334 | Ga0268264_100093349 | 266 |
| 602 | 3300028381 | Ga0268264_10018682 | Ga0268264_100186828 | 266 |
| 603 | 3300028786 | Ga0307517_10045813 | Ga0307517_100458134 | 266 |
| 604 | 3300028786 | Ga0307517_10071774 | Ga0307517_100717744 | 266 |
| 605 | 3300028794 | Ga0307515_10024830 | Ga0307515_1002483011 | 266 |
| 606 | 3300031456 | Ga0307513_10000816 | Ga0307513_1000081614 | 266 |
| 607 | 3300031456 | Ga0307513_10523364 | Ga0307513_105233641 | 266 |
| 608 | 3300033180 | Ga0307510_10003236 | Ga0307510_100032366 | 266 |
| 609 | 3300035089 | Ga0373944_0034569 | Ga0373944_0034569_574_1377 | 266 |
| 610 | 3300035695 | Ga0373927_0000257 | Ga0373927_0000257_39131_39934 | 266 |
| 611 | 3300037068 | Ga0373925_0000083 | Ga0373925_0000083_47695_48498 | 266 |
| 612 | 3300037312 | Ga0395899_0000052 | Ga0395899_0000052_6200_7003 | 266 |
| 613 | 3300037418 | Ga0395900_0001389 | Ga0395900_0001389_20646_21449 | 266 |
| 614 | 3300037466 | Ga0395898_0022674 | Ga0395898_0022674_4119_4922 | 266 |
| 615 | 3300037471 | Ga0395905_0021064 | Ga0395905_0021064_2681_3484 | 266 |
| 616 | 3300038443 | Ga0395901_0000013 | Ga0395901_0000013_7550_8353 | 266 |
| 617 | 3300042001 | Ga0439441_020064 | Ga0439441_020064_169_969 | 266 |
| 618 | 3300042004 | Ga0439445_0016274 | Ga0439445_0016274_32_832 | 266 |
| 619 | 3300042156 | Ga0439446_0012140 | Ga0439446_0012140_1504_2304 | 266 |
| 620 | 3300042436 | Ga0439435_0006295 | Ga0439435_0006295_321_1121 | 266 |
| 621 | 3300042438 | Ga0439459_0011453 | Ga0439459_0011453_381_1181 | 266 |
| 622 | 3300044901 | Ga0466960_0247039 | Ga0466960_0247039_29_874 | 266 |
| 623 | 3300046453 | Ga0495627_001730 | Ga0495627_001730_4661_5461 | 266 |
| 624 | 3300046457 | Ga0495590_0001060 | Ga0495590_0001060_9787_10587 | 266 |
| 625 | 3300046460 | Ga0495638_0001447 | Ga0495638_0001447_3830_4630 | 266 |
| 626 | 3300046460 | Ga0495638_0012370 | Ga0495638_0012370_2484_3284 | 266 |
| 627 | 3300046460 | Ga0495638_0013285 | Ga0495638_0013285_1042_1842 | 266 |
| 628 | 3300046460 | Ga0495638_0013631 | Ga0495638_0013631_939_1739 | 266 |
| 629 | 3300046471 | Ga0495650_0000262 | Ga0495650_0000262_69830_70630 | 266 |
| 630 | 3300046506 | Ga0495583_0000003 | Ga0495583_0000003_684148_684948 | 266 |
| 631 | 3300046507 | Ga0495606_0026562 | Ga0495606_0026562_2977_3777 | 266 |
| 632 | 3300046512 | Ga0495610_0000524 | Ga0495610_0000524_15400_16200 | 266 |
| 633 | 3300046512 | Ga0495610_0004078 | Ga0495610_0004078_7207_8007 | 266 |
| 634 | 3300046513 | Ga0495616_0000016 | Ga0495616_0000016_149050_149850 | 266 |
| 635 | 3300046515 | Ga0495620_0065107 | Ga0495620_0065107_539_1339 | 266 |
| 636 | 3300046515 | Ga0495620_0076413 | Ga0495620_0076413_24_824 | 266 |
| 637 | 3300046519 | Ga0495632_0005537 | Ga0495632_0005537_1327_2127 | 266 |
| 638 | 3300046520 | Ga0495637_0008449 | Ga0495637_0008449_1647_2447 | 266 |
| 639 | 3300046520 | Ga0495637_0012197 | Ga0495637_0012197_743_1543 | 266 |
| 640 | 3300046522 | Ga0495643_0040463 | Ga0495643_0040463_1022_1822 | 266 |
| 641 | 3300046524 | Ga0495648_0000191 | Ga0495648_0000191_53577_54380 | 266 |
| 642 | 3300046530 | Ga0495654_0000039 | Ga0495654_0000039_176823_177623 | 266 |
| 643 | 3300046530 | Ga0495654_0055861 | Ga0495654_0055861_771_1571 | 266 |
| 644 | 3300046542 | Ga0495597_0087967 | Ga0495597_0087967_401_1204 | 266 |
| 645 | 3300046543 | Ga0495645_0012405 | Ga0495645_0012405_447_1250 | 266 |
| 646 | 3300046616 | Ga0495668_0000196 | Ga0495668_0000196_46460_47263 | 266 |
| 647 | 3300046616 | Ga0495668_0001487 | Ga0495668_0001487_13896_14696 | 266 |
| 648 | 3300046616 | Ga0495668_0005577 | Ga0495668_0005577_6508_7311 | 266 |
| 649 | 3300046616 | Ga0495668_0005918 | Ga0495668_0005918_1258_2058 | 266 |
| 650 | 3300046660 | Ga0495625_0000034 | Ga0495625_0000034_37439_38239 | 266 |
| 651 | 3300046660 | Ga0495625_0003282 | Ga0495625_0003282_4659_5459 | 266 |
| 652 | 3300046660 | Ga0495625_0024259 | Ga0495625_0024259_42_842 | 266 |
| 653 | 3300046660 | Ga0495625_0024485 | Ga0495625_0024485_42_842 | 266 |
| 654 | 3300046660 | Ga0495625_0040638 | Ga0495625_0040638_443_1243 | 266 |
| 655 | 3300046691 | Ga0495670_0023533 | Ga0495670_0023533_801_1601 | 266 |
| 656 | 3300046692 | Ga0495671_0136725 | Ga0495671_0136725_27_827 | 266 |
| 657 | 3300046794 | Ga0495589_0005947 | Ga0495589_0005947_1346_2146 | 266 |
| 658 | 3300046810 | Ga0495660_0015047 | Ga0495660_0015047_680_1480 | 266 |
| 659 | 3300046810 | Ga0495660_0026931 | Ga0495660_0026931_1361_2161 | 266 |
| 660 | 3300046810 | Ga0495660_0138168 | Ga0495660_0138168_204_1004 | 266 |
| 661 | 3300047320 | Ga0495672_0004263 | Ga0495672_0004263_10895_11695 | 266 |
| 662 | 3300047323 | Ga0495683_0066750 | Ga0495683_0066750_136_936 | 266 |
| 663 | 3300047446 | Ga0495679_001640 | Ga0495679_001640_1975_2775 | 266 |
| 664 | 3300047469 | Ga0495673_0000312 | Ga0495673_0000312_54838_55638 | 266 |
| 665 | 3300047469 | Ga0495673_0001133 | Ga0495673_0001133_7577_8380 | 266 |
| 666 | 3300047469 | Ga0495673_0002400 | Ga0495673_0002400_11110_11910 | 266 |
| 667 | 3300047472 | Ga0495686_0003171 | Ga0495686_0003171_6246_7046 | 266 |
| 668 | 3300047472 | Ga0495686_0010311 | Ga0495686_0010311_5333_6133 | 266 |
| 669 | 3300047472 | Ga0495686_0011050 | Ga0495686_0011050_2687_3487 | 266 |
| 670 | 3300047472 | Ga0495686_0051221 | Ga0495686_0051221_36_836 | 266 |
| 671 | 3300048909 | Ga0496106_0003130 | Ga0496106_0003130_9048_9848 | 266 |
| 672 | 3300048910 | Ga0496107_0002780 | Ga0496107_0002780_4711_5511 | 266 |
| 673 | 3300048918 | Ga0496115_0000050 | Ga0496115_0000050_9448_10251 | 266 |
| 674 | 3300048918 | Ga0496115_0001099 | Ga0496115_0001099_3441_4241 | 266 |
| 675 | 3300048919 | Ga0496116_0130351 | Ga0496116_0130351_20_823 | 266 |
| 676 | 3300048920 | Ga0496117_0042362 | Ga0496117_0042362_2237_3040 | 266 |
| 677 | 3300048921 | Ga0496118_0015436 | Ga0496118_0015436_3731_4534 | 266 |
| 678 | 3300048922 | Ga0496119_0013623 | Ga0496119_0013623_5122_5925 | 266 |
| 679 | 3300048924 | Ga0496121_0000334 | Ga0496121_0000334_24736_25539 | 266 |
| 680 | 3300048924 | Ga0496121_0002729 | Ga0496121_0002729_4045_4845 | 266 |
| 681 | 3300050491 | nmdc:mga00v17_1793_c1 | nmdc:mga00v17_1793_c1_4183_4986 | 266 |
| 682 | 3300050493 | nmdc:mga0k408_31131_c1 | nmdc:mga0k408_31131_c1_1896_2699 | 266 |
| 683 | 3300050494 | nmdc:mga06z11_1075_c1 | nmdc:mga06z11_1075_c1_3541_4344 | 266 |
| 684 | 3300050495 | nmdc:mga04h51_752_c1 | nmdc:mga04h51_752_c1_5051_5854 | 266 |
| 685 | 3300053086 | Ga0500578_0125032 | Ga0500578_0125032_10_810 | 266 |
| 686 | 3300053087 | Ga0500643_012764 | Ga0500643_012764_1838_2641 | 266 |
| 687 | 3300053088 | Ga0500644_0000058 | Ga0500644_0000058_7315_8118 | 266 |
| 688 | 3300053102 | Ga0500554_001570 | Ga0500554_001570_787_1587 | 266 |
| 689 | 3300053103 | Ga0500555_001857 | Ga0500555_001857_5066_5902 | 266 |
| 690 | 3300053104 | Ga0500556_0000893 | Ga0500556_0000893_11159_11959 | 266 |
| 691 | 3300053104 | Ga0500556_0156986 | Ga0500556_0156986_79_882 | 266 |
| 692 | 3300053122 | Ga0500608_001504 | Ga0500608_001504_7404_8207 | 266 |
| 693 | 3300053125 | Ga0500618_000014 | Ga0500618_000014_7410_8210 | 266 |
| 694 | 3300053134 | Ga0500658_0068421 | Ga0500658_0068421_147_947 | 266 |
| 695 | 3300053136 | Ga0500559_0000467 | Ga0500559_0000467_23293_24093 | 266 |
| 696 | 3300053136 | Ga0500559_0002837 | Ga0500559_0002837_5843_6643 | 266 |
| 697 | 3300053136 | Ga0500559_0187255 | Ga0500559_0187255_79_882 | 266 |
| 698 | 3300053138 | Ga0500564_000229 | Ga0500564_000229_7303_8106 | 266 |
| 699 | 3300053142 | Ga0500577_0000828 | Ga0500577_0000828_4671_5471 | 266 |
| 700 | 3300053153 | Ga0500616_0007680 | Ga0500616_0007680_4414_5214 | 266 |
| 701 | 3300053158 | Ga0500627_0010107 | Ga0500627_0010107_2453_3253 | 266 |
| 702 | 3300053730 | Ga0500645_003294 | Ga0500645_003294_2350_3150 | 266 |
| 703 | 3300053731 | Ga0500609_000324 | Ga0500609_000324_1698_2498 | 266 |
| 704 | 3300059628 | Ga0587122_009570 | Ga0587122_009570_25_828 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o8x-assembly1.cif.gz_A | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.987 | 86 | 135 |
| 2o8x-assembly1.cif.gz_B | "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" | 0.982 | 86 | 135 |
| 3vep-assembly4.cif.gz_H | crystal structure of sigd4 in complex with its negative regulator rsda | 0.9687 | 85 | 139 |
| 2h27-assembly2.cif.gz_D | crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna | 0.9686 | 87 | 138 |
| 3hug-assembly2.cif.gz_E | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.9638 | 86 | 139 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3t0yA01 | Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif | 0.9901 | 1 | 64 | 1.10.1740.10 |
| 2o8xA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.987 | 86 | 135 | 1.10.10.10 |
| 2o8xB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.982 | 86 | 135 | 1.10.10.10 |
| 4cxfA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.978 | 85 | 139 | 1.10.10.10 |
| af_P0AGB6_121_191_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9741 | 87 | 136 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q98FM8-F1-model_v4 | Sensory transduction regulatory protein | 0.9867 | 140 | 257 |
GO:0000160
|
| AF-A0A528PI55-F1-model_v4 | deleted | 0.9836 | 140 | 244 |
|
| AF-A0A530R2W7-F1-model_v4 | Response regulator | 0.9826 | 160 | 257 |
GO:0000160
|
| AF-A0A4Q3GZW4-F1-model_v4 | Response regulator | 0.9662 | 140 | 257 |
GO:0000160
|
| AF-A0A3D6A0W2-F1-model_v4 | deleted | 0.9643 | 146 | 263 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar