F476361

General Info

Members Datasets Scaffolds Average Seq Length
704 354 666 265

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10110737|Ga0268265_101107373
Length 311
Sequence MIHSRPPDGTVTLRRRLTFVRGRGRHARTRSVHRDQWFRTDIYREGYLSLLARLAPHLPYVRRYARALTGDQISGDQYVRVALEALAAGERTLDPGLSPRVALYRVFHAIWCTTGAQLEDRTEEEAGGDPRQRLMRIAPRSRQAFLLTALEGFTPSETAQILDTDFEEIDALIAKAQQEIDAELATDVLIIEDEPVIAADIEALVRELGHNVLDIAATRSEAVEAAARHRPGLVLADIQLADGSSGIDAVKDILGRFDVPVIFITAFPERLLTGERPEPTFLITKPFQPETVKAAIGQALFFHPTRQKEAA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
7 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
8 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
9 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
10 2643221583 Caulobacter sp. Root655 Isolate Unclassified
11 2643221584 Caulobacter sp. Root656 Isolate Unclassified
12 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
13 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
14 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
15 2643221640 Caulobacter sp. Root342 Isolate Unclassified
16 2643221642 Caulobacter sp. Root343 Isolate Unclassified
17 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
18 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
19 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
20 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
21 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
22 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
23 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
24 2818991435 Caulobacter henricii 536 Isolate Unclassified
25 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
26 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
27 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
28 2849560528 Caulobacter zeae 410 Isolate Unclassified
29 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
30 2851153111 Caulobacter radicis 736 Isolate Unclassified
31 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
32 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
33 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
34 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
35 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
36 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
37 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
44 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
51 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
54 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
117 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
118 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
176 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
213 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
218 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
221 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
222 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
225 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
226 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
227 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
228 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
229 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
230 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
231 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
232 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
237 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
238 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
239 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
240 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
246 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
247 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
248 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
257 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
258 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
270 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
271 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
272 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
273 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
274 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
285 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
286 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
289 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
290 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
291 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
292 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
293 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
295 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
296 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
307 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
318 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
319 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
320 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
321 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
322 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
323 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
324 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
325 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
326 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
327 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
328 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
329 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
330 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
331 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
332 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
333 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
334 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
335 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
336 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
337 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
338 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
339 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
340 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
341 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
342 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
343 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
344 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
345 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
346 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
347 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
348 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
349 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
350 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
351 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
352 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
353 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.32
Metatranscriptomes 1.28
Isolates 5.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.62
Nodule 0.14
Rhizoplane 2.7
Rhizosphere 71.31
Stem 0
Stem Tuber 0
Unclassified 9.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10034119 3300003215 Bacteria 1668
2 Ga0055526_1018273 3300003771 Bacteria 2625
3 Ga0055537_1004582 3300003773 Bacteria 3922
4 Ga0055524_1008284 3300003775 Bacteria 4329
5 Ga0055536_1001254 3300003781 Bacteria 15617
6 Ga0055528_1004170 3300003790 Bacteria 7033
7 Ga0055530_10002063 3300003791 Bacteria 13509
8 Ga0055530_10008853 3300003791 Bacteria 3962
9 Ga0055531_10001364 3300003794 Bacteria 18136
10 Ga0055531_10003088 3300003794 Bacteria 10767
11 Ga0055531_10005840 3300003794 Bacteria 7113
12 Ga0055531_10013178 3300003794 Bacteria 3832
13 Ga0058862_12862074 3300004803 Bacteria 886
14 Ga0065165_1001500 3300005262 Bacteria 24692
15 Ga0065165_1001741 3300005262 Bacteria 21716
16 Ga0065165_1023862 3300005262 Bacteria 2066
17 Ga0065165_1027898 3300005262 Bacteria 1832
18 Ga0070658_10048570 3300005327 Bacteria 3436
19 Ga0070658_10093397 3300005327 Bacteria 2482
20 Ga0070658_10111645 3300005327 Bacteria 2265
21 Ga0070683_100214460 3300005329 Bacteria 1829
22 Ga0070670_100000007 3300005331 Bacteria 318672
23 Ga0070670_100069961 3300005331 Bacteria 3013
24 Ga0070677_10006543 3300005333 Bacteria 3872
25 Ga0070666_10358267 3300005335 Bacteria 1045
26 Ga0070680_100037532 3300005336 Bacteria 3915
27 Ga0070680_100054717 3300005336 Bacteria 3259
28 Ga0070660_100013760 3300005339 Bacteria 5818
29 Ga0070660_100068786 3300005339 Bacteria 2760
30 Ga0070691_10002769 3300005341 Bacteria 7822
31 Ga0070661_100030083 3300005344 Bacteria 3922
32 Ga0070668_100000129 3300005347 Bacteria 47127
33 Ga0070668_100000545 3300005347 Bacteria 25182
34 Ga0070668_100005299 3300005347 Bacteria 9570
35 Ga0070668_100005838 3300005347 Bacteria 9127
36 Ga0070668_100011144 3300005347 Bacteria 6692
37 Ga0070668_100033288 3300005347 Bacteria 3924
38 Ga0070668_100058996 3300005347 Bacteria 2970
39 Ga0070668_100257243 3300005347 Bacteria 1451
40 Ga0070669_100065309 3300005353 Bacteria 2681
41 Ga0070669_100193381 3300005353 Bacteria 1597
42 Ga0070675_100012398 3300005354 Bacteria 6679
43 Ga0070671_100097113 3300005355 Bacteria 2471
44 Ga0070671_100183051 3300005355 Bacteria 1774
45 Ga0070671_100212500 3300005355 Bacteria 1641
46 Ga0070659_100000457 3300005366 Bacteria 30130
47 Ga0070659_100014839 3300005366 Bacteria 5826
48 Ga0070659_100016600 3300005366 Bacteria 5529
49 Ga0070667_100000611 3300005367 Bacteria 34865
50 Ga0070667_100008781 3300005367 Bacteria 8374
51 Ga0070667_100017154 3300005367 Bacteria 5996
52 Ga0070667_100029432 3300005367 Bacteria 4575
53 Ga0070713_100542169 3300005436 Bacteria 1101
54 Ga0070662_100014019 3300005457 Bacteria 5343
55 Ga0070681_10006503 3300005458 Bacteria 11372
56 Ga0070681_10042610 3300005458 Bacteria 4548
57 Ga0070679_100034113 3300005530 Bacteria 5042
58 Ga0070679_100045077 3300005530 Bacteria 4394
59 Ga0070679_100341758 3300005530 Bacteria 1445
60 Ga0068853_100001308 3300005539 Bacteria 17886
61 Ga0068853_100026565 3300005539 Bacteria 4862
62 Ga0068853_100062079 3300005539 Bacteria 3233
63 Ga0068853_100166221 3300005539 Bacteria 1994
64 Ga0068853_100166610 3300005539 Bacteria 1991
65 Ga0070665_100000246 3300005548 Bacteria 90170
66 Ga0070665_100000689 3300005548 Bacteria 45116
67 Ga0070665_100000692 3300005548 Bacteria 44982
68 Ga0070665_100041944 3300005548 Bacteria 4600
69 Ga0070665_100056913 3300005548 Bacteria 3921
70 Ga0070665_100057618 3300005548 Bacteria 3895
71 Ga0070665_100112614 3300005548 Bacteria 2724
72 Ga0068855_100000144 3300005563 Bacteria 91639
73 Ga0068855_100024093 3300005563 Bacteria 7286
74 Ga0068855_100029641 3300005563 Bacteria 6541
75 Ga0068855_100362658 3300005563 Bacteria 1594
76 Ga0068855_100534466 3300005563 Bacteria 1271
77 Ga0070664_100051493 3300005564 Bacteria 3486
78 Ga0070664_100357377 3300005564 Bacteria 1330
79 Ga0068857_100140545 3300005577 Bacteria 2182
80 Ga0068854_100202358 3300005578 Bacteria 1562
81 Ga0068856_100024065 3300005614 Bacteria 5926
82 Ga0068852_100013845 3300005616 Bacteria 6186
83 Ga0068852_100264271 3300005616 Bacteria 1653
84 Ga0068859_100000111 3300005617 Bacteria 77474
85 Ga0068859_100017207 3300005617 Bacteria 7260
86 Ga0068864_100000225 3300005618 Bacteria 51133
87 Ga0068864_100000304 3300005618 Bacteria 43692
88 Ga0068864_100001043 3300005618 Bacteria 23260
89 Ga0068864_100011010 3300005618 Bacteria 7477
90 Ga0068864_100138567 3300005618 Bacteria 2193
91 Ga0068864_100357201 3300005618 Bacteria 1380
92 Ga0068861_100153294 3300005719 Bacteria 1893
93 Ga0068861_100216290 3300005719 Bacteria 1617
94 Ga0068863_100000076 3300005841 Bacteria 109412
95 Ga0068863_100000295 3300005841 Bacteria 51532
96 Ga0068863_100005065 3300005841 Bacteria 12999
97 Ga0068863_100051072 3300005841 Bacteria 3919
98 Ga0068863_100101228 3300005841 Bacteria 2739
99 Ga0068858_100000079 3300005842 Bacteria 100753
100 Ga0068858_100000500 3300005842 Bacteria 41083
101 Ga0068860_100000027 3300005843 Bacteria 267207
102 Ga0068860_100000047 3300005843 Bacteria 213287
103 Ga0068860_100005396 3300005843 Bacteria 12973
104 Ga0068862_100000396 3300005844 Bacteria 47054
105 Ga0068862_100009983 3300005844 Bacteria 7845
106 Ga0068862_100041258 3300005844 Bacteria 3926
107 Ga0068862_100102330 3300005844 Bacteria 2507
108 Ga0081540_1083201 3300005983 Bacteria 1432
109 Ga0081539_10017674 3300005985 Bacteria 4993
110 Ga0075368_10000230 3300006042 Bacteria 15775
111 Ga0075363_100013053 3300006048 Bacteria 4016
112 Ga0075364_10004820 3300006051 Bacteria 7810
113 Ga0075367_10000291 3300006178 Bacteria 17585
114 Ga0075369_10001551 3300006186 Bacteria 7877
115 Ga0075369_10081739 3300006186 Bacteria 1433
116 Ga0075366_10007206 3300006195 Bacteria 6128
117 Ga0075366_10307884 3300006195 Bacteria 970
118 Ga0075370_10069294 3300006353 Bacteria 2016
119 Ga0075370_10154055 3300006353 Bacteria 1347
120 Ga0068865_100002622 3300006881 Bacteria 10692
121 Ga0097620_100000111 3300006931 Bacteria 77474
122 Ga0097620_100017207 3300006931 Bacteria 7260
123 Ga0079104_1006367 3300006946 Bacteria 4487
124 Ga0105240_10000314 3300009093 Bacteria 93043
125 Ga0105240_10002602 3300009093 Bacteria 28871
126 Ga0105240_10003899 3300009093 Bacteria 23042
127 Ga0105240_10161382 3300009093 Bacteria 2662
128 Ga0105240_10163815 3300009093 Bacteria 2639
129 Ga0105240_10214524 3300009093 Bacteria 2246
130 Ga0105240_10382110 3300009093 Bacteria 1590
131 Ga0105245_10190260 3300009098 Bacteria 1965
132 Ga0105243_10156788 3300009148 Bacteria 1958
133 Ga0105241_10121304 3300009174 Bacteria 2105
134 Ga0105241_10292303 3300009174 Bacteria 1395
135 Ga0105248_10000112 3300009177 Bacteria 91321
136 Ga0105248_10004201 3300009177 Bacteria 15925
137 Ga0105248_10005373 3300009177 Bacteria 14081
138 Ga0105248_10039683 3300009177 Bacteria 5277
139 Ga0105248_10446280 3300009177 Bacteria 1458
140 Ga0105237_10149381 3300009545 Bacteria 2332
141 Ga0105238_10002209 3300009551 Bacteria 19627
142 Ga0105238_10009812 3300009551 Bacteria 9587
143 Ga0105238_10015232 3300009551 Bacteria 7784
144 Ga0105249_10000550 3300009553 Bacteria 34737
145 Ga0105249_10246336 3300009553 Bacteria 1769
146 Ga0105239_10001128 3300010375 Bacteria 36839
147 Ga0105239_10007021 3300010375 Bacteria 12962
148 Ga0105239_10273124 3300010375 Bacteria 1902
149 Ga0157373_10001054 3300013100 Bacteria 21230
150 Ga0157373_10002934 3300013100 Bacteria 12916
151 Ga0157371_10036519 3300013102 Bacteria 3518
152 Ga0157370_10084892 3300013104 Bacteria 2975
153 Ga0157370_10095014 3300013104 Bacteria 2796
154 Ga0157370_10735773 3300013104 Bacteria 899
155 Ga0157369_10003463 3300013105 Bacteria 18722
156 Ga0157369_10008596 3300013105 Bacteria 11711
157 Ga0157369_10016064 3300013105 Bacteria 8422
158 Ga0157378_10540112 3300013297 Bacteria 1170
159 Ga0163162_10130170 3300013306 Bacteria 2625
160 Ga0163162_10206060 3300013306 Bacteria 2096
161 Ga0163162_10286514 3300013306 Bacteria 1779
162 Ga0163162_10347525 3300013306 Bacteria 1616
163 Ga0157372_10017170 3300013307 Bacteria 7770
164 Ga0157375_10026212 3300013308 Bacteria 5429
165 Ga0163163_10002482 3300014325 Bacteria 15605
166 Ga0163163_10067243 3300014325 Bacteria 3562
167 Ga0157380_10019148 3300014326 Bacteria 5098
168 Ga0157379_10000416 3300014968 Bacteria 34546
169 Ga0157379_10017950 3300014968 Bacteria 6234
170 Ga0197907_11194425 3300020069 Bacteria 1464
171 Ga0206356_10431916 3300020070 Bacteria 1447
172 Ga0206355_1092300 3300020076 Bacteria 1566
173 Ga0213872_10017319 3300021361 Bacteria 3332
174 Ga0213872_10032970 3300021361 Bacteria 2373
175 Ga0213874_10023016 3300021377 Bacteria 1734
176 Ga0213876_10000130 3300021384 Bacteria 81967
177 Ga0213876_10000480 3300021384 Bacteria 31634
178 Ga0209026_1000556 3300025250 Bacteria 25593
179 Ga0209148_1012042 3300025254 Bacteria 1591
180 Ga0209148_1020121 3300025254 Bacteria 1101
181 Ga0209565_1000192 3300025263 Bacteria 74812
182 Ga0209673_1001547 3300025273 Bacteria 20783
183 Ga0209676_1000115 3300025292 Bacteria 205183
184 Ga0209676_1000308 3300025292 Bacteria 95847
185 Ga0209676_1000320 3300025292 Bacteria 93515
186 Ga0209676_1003173 3300025292 Bacteria 10459
187 Ga0209564_1001722 3300025295 Bacteria 20531
188 Ga0209564_1033076 3300025295 Bacteria 1544
189 Ga0209758_1000404 3300025297 Bacteria 74016
190 Ga0209758_1001124 3300025297 Bacteria 34364
191 Ga0209758_1002337 3300025297 Bacteria 19570
192 Ga0209050_1000466 3300025298 Bacteria 71734
193 Ga0209050_1000911 3300025298 Bacteria 39103
194 Ga0209050_1001951 3300025298 Bacteria 19521
195 Ga0209050_1015944 3300025298 Bacteria 3111
196 Ga0209050_1037073 3300025298 Bacteria 1412
197 Ga0209256_1000810 3300025299 Bacteria 40058
198 Ga0209256_1004878 3300025299 Bacteria 8081
199 Ga0209256_1053536 3300025299 Bacteria 965
200 Ga0209051_1001718 3300025303 Bacteria 17480
201 Ga0209257_1000090 3300025304 Bacteria 274746
202 Ga0209257_1000227 3300025304 Bacteria 133512
203 Ga0209257_1000338 3300025304 Bacteria 97721
204 Ga0209257_1000507 3300025304 Bacteria 68362
205 Ga0209257_1000554 3300025304 Bacteria 64085
206 Ga0209257_1005664 3300025304 Bacteria 8624
207 Ga0207682_10009214 3300025893 Bacteria 3899
208 Ga0207645_10075528 3300025907 Bacteria 2157
209 Ga0207643_10231562 3300025908 Bacteria 1133
210 Ga0207705_10020966 3300025909 Bacteria 4662
211 Ga0207705_10058229 3300025909 Bacteria 2787
212 Ga0207705_10191783 3300025909 Bacteria 1546
213 Ga0207705_10266877 3300025909 Bacteria 1308
214 Ga0207707_10031921 3300025912 Bacteria 4610
215 Ga0207695_10000012 3300025913 Bacteria 840961
216 Ga0207695_10001434 3300025913 Bacteria 40063
217 Ga0207695_10002208 3300025913 Bacteria 29280
218 Ga0207695_10008553 3300025913 Bacteria 12789
219 Ga0207695_10010460 3300025913 Bacteria 11347
220 Ga0207695_10062992 3300025913 Bacteria 3825
221 Ga0207695_10247340 3300025913 Bacteria 1683
222 Ga0207660_10112537 3300025917 Bacteria 2050
223 Ga0207657_10009221 3300025919 Bacteria 9947
224 Ga0207657_10054397 3300025919 Bacteria 3461
225 Ga0207657_10079861 3300025919 Bacteria 2751
226 Ga0207649_10036828 3300025920 Bacteria 2950
227 Ga0207652_10008581 3300025921 Bacteria 8223
228 Ga0207652_10073367 3300025921 Bacteria 2977
229 Ga0207652_10301602 3300025921 Bacteria 1446
230 Ga0207681_10026142 3300025923 Bacteria 3762
231 Ga0207681_10247864 3300025923 Bacteria 1389
232 Ga0207681_10434961 3300025923 Bacteria 1065
233 Ga0207694_10000006 3300025924 Bacteria 631109
234 Ga0207694_10009016 3300025924 Bacteria 7532
235 Ga0207694_10061569 3300025924 Bacteria 2921
236 Ga0207694_10103279 3300025924 Bacteria 2260
237 Ga0207694_10351773 3300025924 Bacteria 1220
238 Ga0207650_10000030 3300025925 Bacteria 235824
239 Ga0207650_10220019 3300025925 Bacteria 1528
240 Ga0207650_10476370 3300025925 Bacteria 1041
241 Ga0207659_10212741 3300025926 Bacteria 1550
242 Ga0207687_10121269 3300025927 Bacteria 1956
243 Ga0207644_10040659 3300025931 Bacteria 3287
244 Ga0207644_10078662 3300025931 Bacteria 2431
245 Ga0207690_10000230 3300025932 Bacteria 41628
246 Ga0207690_10008980 3300025932 Bacteria 5932
247 Ga0207690_10055025 3300025932 Bacteria 2678
248 Ga0207706_10053367 3300025933 Bacteria 3569
249 Ga0207709_10136663 3300025935 Bacteria 1679
250 Ga0207704_10038218 3300025938 Bacteria 2781
251 Ga0207711_10000718 3300025941 Bacteria 32642
252 Ga0207711_10000998 3300025941 Bacteria 27132
253 Ga0207711_10004868 3300025941 Bacteria 11397
254 Ga0207711_10017546 3300025941 Bacteria 5946
255 Ga0207711_10380187 3300025941 Bacteria 1310
256 Ga0207689_10246808 3300025942 Bacteria 1476
257 Ga0207679_10042321 3300025945 Bacteria 3273
258 Ga0207667_10000026 3300025949 Bacteria 343713
259 Ga0207667_10023360 3300025949 Bacteria 6808
260 Ga0207667_10037950 3300025949 Bacteria 5148
261 Ga0207667_10363451 3300025949 Bacteria 1476
262 Ga0207651_10152703 3300025960 Bacteria 1800
263 Ga0207712_10003727 3300025961 Bacteria 9618
264 Ga0207712_10468830 3300025961 Bacteria 1071
265 Ga0207668_10000042 3300025972 Bacteria 103877
266 Ga0207668_10004107 3300025972 Bacteria 8550
267 Ga0207668_10007793 3300025972 Bacteria 6371
268 Ga0207668_10025841 3300025972 Bacteria 3805
269 Ga0207668_10028006 3300025972 Bacteria 3678
270 Ga0207668_10160525 3300025972 Bacteria 1751
271 Ga0207668_10348571 3300025972 Bacteria 1237
272 Ga0207640_10121830 3300025981 Bacteria 1870
273 Ga0207658_10000417 3300025986 Bacteria 40403
274 Ga0207658_10001987 3300025986 Bacteria 15254
275 Ga0207658_10005993 3300025986 Bacteria 8309
276 Ga0207658_10632973 3300025986 Bacteria 963
277 Ga0207703_10000051 3300026035 Bacteria 145390
278 Ga0207703_10004794 3300026035 Bacteria 11023
279 Ga0207703_10159162 3300026035 Bacteria 1976
280 Ga0207639_10001861 3300026041 Bacteria 14184
281 Ga0207639_10056227 3300026041 Bacteria 3015
282 Ga0207639_10149239 3300026041 Bacteria 1956
283 Ga0207639_10181729 3300026041 Bacteria 1790
284 Ga0207678_10561479 3300026067 Bacteria 999
285 Ga0207702_10390091 3300026078 Unclassified 1341
286 Ga0207641_10000003 3300026088 Bacteria 496984
287 Ga0207641_10006137 3300026088 Bacteria 10167
288 Ga0207641_10006181 3300026088 Bacteria 10132
289 Ga0207641_10021767 3300026088 Bacteria 5270
290 Ga0207641_10024325 3300026088 Bacteria 4992
291 Ga0207641_10064399 3300026088 Bacteria 3133
292 Ga0207641_10499424 3300026088 Bacteria 1181
293 Ga0207676_10000227 3300026095 Bacteria 48869
294 Ga0207676_10001439 3300026095 Bacteria 17699
295 Ga0207676_10002708 3300026095 Bacteria 12609
296 Ga0207676_10083156 3300026095 Bacteria 2606
297 Ga0207676_10105806 3300026095 Bacteria 2343
298 Ga0207675_100013589 3300026118 Bacteria 7600
299 Ga0207675_100243719 3300026118 Bacteria 1737
300 Ga0207683_10029433 3300026121 Bacteria 4755
301 Ga0207698_10008529 3300026142 Bacteria 6491
302 Ga0207698_10208457 3300026142 Bacteria 1756
303 Ga0210000_1013411 3300027462 Bacteria 1223
304 Ga0209999_1008725 3300027543 Bacteria 1831
305 Ga0209813_10000758 3300027866 Bacteria 7387
306 Ga0268266_10000003 3300028379 Bacteria 1701703
307 Ga0268266_10000705 3300028379 Bacteria 45155
308 Ga0268266_10082767 3300028379 Bacteria 2800
309 Ga0268266_10138329 3300028379 Bacteria 2183
310 Ga0268266_10190056 3300028379 Bacteria 1874
311 Ga0268266_10268142 3300028379 Bacteria 1584
312 Ga0268265_10000661 3300028380 Bacteria 34194
313 Ga0268265_10004852 3300028380 Bacteria 9269
314 Ga0268265_10015154 3300028380 Bacteria 5268
315 Ga0268265_10018691 3300028380 Bacteria 4806
316 Ga0268265_10042070 3300028380 Bacteria 3387
317 Ga0268265_10096082 3300028380 Bacteria 2381
318 Ga0268265_10110737 3300028380 Bacteria 2241
319 Ga0268265_10158000 3300028380 Bacteria 1921
320 Ga0268265_10279993 3300028380 Bacteria 1492
321 Ga0268264_10000014 3300028381 Bacteria 509962
322 Ga0268264_10000205 3300028381 Bacteria 120743
323 Ga0268264_10009334 3300028381 Bacteria 8122
324 Ga0268264_10018682 3300028381 Bacteria 5667
325 Ga0265326_10027024 3300028558 Bacteria 1636
326 Ga0265334_10035943 3300028573 Bacteria 1958
327 Ga0265318_10000017 3300028577 Bacteria 174748
328 Ga0265318_10070474 3300028577 Bacteria 1296
329 Ga0307517_10045813 3300028786 Bacteria 4583
330 Ga0307517_10048553 3300028786 Bacteria 4364
331 Ga0307517_10071774 3300028786 Bacteria 3098
332 Ga0307517_10191367 3300028786 Bacteria 1298
333 Ga0307515_10024830 3300028794 Bacteria 10409
334 Ga0265338_10000006 3300028800 Bacteria 570804
335 Ga0265338_10041785 3300028800 Bacteria 4283
336 Ga0265338_10068152 3300028800 Bacteria 3068
337 Ga0265338_10186578 3300028800 Bacteria 1575
338 Ga0265338_10260139 3300028800 Bacteria 1276
339 Ga0265338_10295138 3300028800 Bacteria 1180
340 Ga0307511_10044730 3300030521 Bacteria 3672
341 Ga0265769_103594 3300030888 Bacteria 871
342 Ga0265325_10000003 3300031241 Bacteria 370490
343 Ga0265325_10160057 3300031241 Bacteria 1060
344 Ga0265329_10024642 3300031242 Bacteria 1996
345 Ga0265340_10006929 3300031247 Bacteria 6193
346 Ga0265339_10000384 3300031249 Bacteria 34921
347 Ga0265331_10039098 3300031250 Bacteria 2315
348 Ga0265327_10000757 3300031251 Bacteria 50106
349 Ga0265327_10001467 3300031251 Bacteria 29538
350 Ga0265327_10001695 3300031251 Bacteria 26327
351 Ga0307513_10000433 3300031456 Bacteria 60335
352 Ga0307513_10000816 3300031456 Bacteria 45405
353 Ga0307513_10002967 3300031456 Bacteria 23138
354 Ga0307513_10012141 3300031456 Bacteria 10654
355 Ga0307513_10523364 3300031456 Bacteria 901
356 Ga0307408_100556620 3300031548 Bacteria 1013
357 Ga0265314_10019618 3300031711 Bacteria 5234
358 Ga0307516_10000006 3300031730 Bacteria 298586
359 Ga0307516_10113587 3300031730 Bacteria 2506
360 Ga0307405_10076422 3300031731 Bacteria 2173
361 Ga0307413_10000908 3300031824 Bacteria 10480
362 Ga0307413_10188813 3300031824 Bacteria 1477
363 Ga0307413_10461761 3300031824 Bacteria 1010
364 Ga0307410_10001707 3300031852 Bacteria 10130
365 Ga0307410_10201253 3300031852 Bacteria 1520
366 Ga0307410_10311332 3300031852 Bacteria 1246
367 Ga0307406_10001617 3300031901 Bacteria 12386
368 Ga0307409_100004772 3300031995 Bacteria 7683
369 Ga0307409_100005890 3300031995 Bacteria 7121
370 Ga0307409_100009208 3300031995 Bacteria 6053
371 Ga0307409_100238072 3300031995 Bacteria 1655
372 Ga0307416_100013050 3300032002 Bacteria 5631
373 Ga0307416_100055631 3300032002 Bacteria 3188
374 Ga0307416_100285114 3300032002 Bacteria 1631
375 Ga0307414_10011419 3300032004 Bacteria 5207
376 Ga0307414_10036540 3300032004 Bacteria 3280
377 Ga0307414_10085657 3300032004 Bacteria 2322
378 Ga0307414_10139254 3300032004 Bacteria 1897
379 Ga0307414_10330168 3300032004 Bacteria 1301
380 Ga0307414_10387112 3300032004 Bacteria 1211
381 Ga0307414_10658417 3300032004 Bacteria 945
382 Ga0307411_10001268 3300032005 Bacteria 10104
383 Ga0307411_10033153 3300032005 Bacteria 3201
384 Ga0307411_10064613 3300032005 Bacteria 2451
385 Ga0307411_10205217 3300032005 Bacteria 1517
386 Ga0307415_100030346 3300032126 Bacteria 3469
387 Ga0307415_100113175 3300032126 Bacteria 2018
388 Ga0307415_100122113 3300032126 Bacteria 1955
389 Ga0307510_10002824 3300033180 Bacteria 19930
390 Ga0307510_10003236 3300033180 Bacteria 18933
391 Ga0307510_10029037 3300033180 Bacteria 6302
392 Ga0307510_10152558 3300033180 Bacteria 1925
393 Ga0373944_0034569 3300035089 Bacteria 1537
394 Ga0373936_0002568 3300035113 Bacteria 6819
395 Ga0373935_0047465 3300035692 Bacteria 2716
396 Ga0373927_0000257 3300035695 Bacteria 41787
397 Ga0373925_0000083 3300037068 Bacteria 101171
398 Ga0373925_0105563 3300037068 Bacteria 2171
399 Ga0395899_0000018 3300037312 Bacteria 423194
400 Ga0395899_0000052 3300037312 Bacteria 221643
401 Ga0395899_0087942 3300037312 Bacteria 2254
402 Ga0395900_0001389 3300037418 Bacteria 28998
403 Ga0395900_0006917 3300037418 Bacteria 11767
404 Ga0395900_0141922 3300037418 Bacteria 2459
405 Ga0395898_0022674 3300037466 Bacteria 6355
406 Ga0395898_0420535 3300037466 Bacteria 1273
407 Ga0395905_0001773 3300037471 Bacteria 25060
408 Ga0395905_0021064 3300037471 Bacteria 6173
409 Ga0395905_0073206 3300037471 Bacteria 3212
410 Ga0395905_0081858 3300037471 Bacteria 3025
411 Ga0395905_0300101 3300037471 Bacteria 1494
412 Ga0395905_0381049 3300037471 Bacteria 1304
413 Ga0436364_0441706 3300037853 Bacteria 1870
414 Ga0395901_0000013 3300038443 Bacteria 375733
415 Ga0395901_0010737 3300038443 Bacteria 9285
416 Ga0395901_0053727 3300038443 Bacteria 4186
417 Ga0395901_0156512 3300038443 Bacteria 2393
418 Ga0395901_0252500 3300038443 Bacteria 1837
419 Ga0395901_0925144 3300038443 Bacteria 852
420 Ga0436365_0031959 3300039437 Bacteria 106267
421 Ga0436365_1867062 3300039437 Bacteria 44331
422 Ga0436361_0135680 3300039447 Bacteria 12581
423 Ga0436361_1069972 3300039447 Bacteria 36104
424 Ga0436363_1657838 3300039450 Bacteria 2193
425 Ga0436362_0933212 3300039453 Bacteria 972
426 Ga0439461_0017965 3300041410 Bacteria 1380
427 Ga0451804_0259378 3300041463 Bacteria 714
428 Ga0451837_0520645 3300041494 Bacteria 1349
429 Ga0439441_020064 3300042001 Bacteria 1221
430 Ga0439445_0016274 3300042004 Bacteria 1828
431 Ga0439446_0012140 3300042156 Bacteria 2350
432 Ga0439435_0006295 3300042436 Bacteria 2661
433 Ga0439459_0011453 3300042438 Bacteria 1563
434 Ga0450901_002401 3300042533 Bacteria 2024
435 Ga0451577_0275287 3300042876 Bacteria 1525
436 Ga0466961_0263845 3300044693 Bacteria 1056
437 Ga0466970_0067814 3300044765 Bacteria 1916
438 Ga0466960_0247039 3300044901 Bacteria 990
439 Ga0466959_0339020 3300045049 Bacteria 1026
440 Ga0495617_077565 3300046452 Bacteria 1090
441 Ga0495627_001730 3300046453 Bacteria 11887
442 Ga0495590_0001060 3300046457 Bacteria 12109
443 Ga0495590_0092828 3300046457 Bacteria 1069
444 Ga0495629_0031201 3300046459 Bacteria 3775
445 Ga0495638_0000185 3300046460 Bacteria 95220
446 Ga0495638_0001447 3300046460 Bacteria 21472
447 Ga0495638_0012370 3300046460 Bacteria 5851
448 Ga0495638_0013285 3300046460 Bacteria 5614
449 Ga0495638_0013631 3300046460 Bacteria 5523
450 Ga0495638_0159809 3300046460 Bacteria 1301
451 Ga0495650_0000262 3300046471 Bacteria 101769
452 Ga0495650_0030802 3300046471 Bacteria 2424
453 Ga0495607_0016419 3300046501 Bacteria 4777
454 Ga0495583_0000003 3300046506 Bacteria 709273
455 Ga0495583_0008901 3300046506 Bacteria 6068
456 Ga0495583_0017975 3300046506 Bacteria 3737
457 Ga0495606_0026562 3300046507 Bacteria 4125
458 Ga0495610_0000524 3300046512 Bacteria 38586
459 Ga0495610_0004078 3300046512 Bacteria 10953
460 Ga0495610_0004821 3300046512 Bacteria 9840
461 Ga0495616_0000016 3300046513 Bacteria 182686
462 Ga0495620_0037282 3300046515 Bacteria 2167
463 Ga0495620_0065107 3300046515 Bacteria 1505
464 Ga0495620_0076413 3300046515 Bacteria 1361
465 Ga0495632_0005537 3300046519 Bacteria 8324
466 Ga0495637_0008449 3300046520 Bacteria 5057
467 Ga0495637_0012197 3300046520 Bacteria 4114
468 Ga0495643_0005279 3300046522 Bacteria 8778
469 Ga0495643_0021498 3300046522 Bacteria 3701
470 Ga0495643_0040463 3300046522 Bacteria 2546
471 Ga0495648_0000191 3300046524 Bacteria 70452
472 Ga0495648_0058412 3300046524 Bacteria 2307
473 Ga0495663_0065948 3300046525 Bacteria 1145
474 Ga0495642_0002495 3300046528 Bacteria 7476
475 Ga0495642_0156789 3300046528 Bacteria 986
476 Ga0495652_0013684 3300046529 Bacteria 7300
477 Ga0495652_0210369 3300046529 Bacteria 1469
478 Ga0495654_0000039 3300046530 Bacteria 185363
479 Ga0495654_0055861 3300046530 Bacteria 1910
480 Ga0495587_0080652 3300046536 Bacteria 1886
481 Ga0495621_0071935 3300046539 Bacteria 1275
482 Ga0495621_0085032 3300046539 Bacteria 1185
483 Ga0495597_0001783 3300046542 Bacteria 14781
484 Ga0495597_0087967 3300046542 Bacteria 1321
485 Ga0495645_0012405 3300046543 Bacteria 6006
486 Ga0495645_0188755 3300046543 Bacteria 1406
487 Ga0495622_0001637 3300046557 Bacteria 11065
488 Ga0495633_0000400 3300046558 Bacteria 45378
489 Ga0495668_0000196 3300046616 Bacteria 89097
490 Ga0495668_0001487 3300046616 Bacteria 22445
491 Ga0495668_0005577 3300046616 Bacteria 8463
492 Ga0495668_0005918 3300046616 Bacteria 8137
493 Ga0495668_0017075 3300046616 Bacteria 4215
494 Ga0495668_0024518 3300046616 Bacteria 3430
495 Ga0495668_0244086 3300046616 Bacteria 983
496 Ga0495668_0284881 3300046616 Bacteria 905
497 Ga0495625_0000034 3300046660 Bacteria 225120
498 Ga0495625_0003282 3300046660 Bacteria 16341
499 Ga0495625_0007139 3300046660 Bacteria 9810
500 Ga0495625_0008727 3300046660 Bacteria 8592
501 Ga0495625_0024259 3300046660 Bacteria 4617
502 Ga0495625_0024485 3300046660 Bacteria 4593
503 Ga0495625_0040638 3300046660 Bacteria 3389
504 Ga0495669_0000007 3300046684 Bacteria 180797
505 Ga0495669_0013681 3300046684 Bacteria 3463
506 Ga0495669_0244293 3300046684 Bacteria 862
507 Ga0495613_0003944 3300046689 Bacteria 11112
508 Ga0495670_0023533 3300046691 Bacteria 3040
509 Ga0495670_0223527 3300046691 Bacteria 1000
510 Ga0495671_0136725 3300046692 Bacteria 1195
511 Ga0495649_0000118 3300046694 Bacteria 69833
512 Ga0495589_0005947 3300046794 Bacteria 6440
513 Ga0495660_0015047 3300046810 Bacteria 4472
514 Ga0495660_0026931 3300046810 Bacteria 3254
515 Ga0495660_0138168 3300046810 Bacteria 1215
516 Ga0495672_0004263 3300047320 Bacteria 11806
517 Ga0495672_0076163 3300047320 Bacteria 1885
518 Ga0495683_0066750 3300047323 Bacteria 1772
519 Ga0495679_001640 3300047446 Bacteria 12470
520 Ga0495673_0000312 3300047469 Bacteria 63724
521 Ga0495673_0001133 3300047469 Bacteria 22860
522 Ga0495673_0002400 3300047469 Bacteria 13213
523 Ga0495686_0000509 3300047472 Bacteria 56406
524 Ga0495686_0003171 3300047472 Bacteria 14489
525 Ga0495686_0010311 3300047472 Bacteria 6655
526 Ga0495686_0011050 3300047472 Bacteria 6387
527 Ga0495686_0014939 3300047472 Bacteria 5325
528 Ga0495686_0035439 3300047472 Bacteria 3208
529 Ga0495686_0037088 3300047472 Bacteria 3125
530 Ga0495686_0038463 3300047472 Bacteria 3060
531 Ga0495686_0051221 3300047472 Bacteria 2591
532 Ga0495686_0312485 3300047472 Bacteria 864
533 Ga0495602_0167608 3300048088 Bacteria 1708
534 Ga0496102_0164400 3300048905 Bacteria 2088
535 Ga0496102_0317265 3300048905 Bacteria 1468
536 Ga0496103_0141924 3300048906 Bacteria 1536
537 Ga0496104_0346203 3300048907 Bacteria 1399
538 Ga0496106_0003130 3300048909 Bacteria 12347
539 Ga0496106_0489973 3300048909 Bacteria 988
540 Ga0496107_0002780 3300048910 Bacteria 11536
541 Ga0496107_0124198 3300048910 Bacteria 1902
542 Ga0496108_0150024 3300048911 Bacteria 2011
543 Ga0496108_0655089 3300048911 Bacteria 913
544 Ga0496109_0079007 3300048912 Bacteria 3030
545 Ga0496110_0246127 3300048913 Bacteria 1627
546 Ga0496111_0177393 3300048914 Bacteria 1584
547 Ga0496115_0000050 3300048918 Bacteria 109402
548 Ga0496115_0001099 3300048918 Bacteria 19590
549 Ga0496115_0002581 3300048918 Bacteria 13005
550 Ga0496115_0026179 3300048918 Bacteria 4550
551 Ga0496115_0164018 3300048918 Bacteria 1837
552 Ga0496116_0035179 3300048919 Bacteria 3521
553 Ga0496116_0130351 3300048919 Bacteria 1435
554 Ga0496117_0042362 3300048920 Bacteria 3323
555 Ga0496118_0015436 3300048921 Bacteria 7068
556 Ga0496119_0013623 3300048922 Bacteria 6454
557 Ga0496121_0000334 3300048924 Bacteria 98442
558 Ga0496121_0002729 3300048924 Bacteria 26299
559 Ga0496122_0003299 3300048925 Bacteria 21357
560 Ga0496123_0000968 3300048926 Bacteria 44375
561 Ga0496124_0021187 3300048927 Bacteria 5992
562 Ga0496125_0001230 3300048928 Bacteria 38324
563 Ga0496125_0012468 3300048928 Bacteria 8438
564 Ga0496125_0093030 3300048928 Bacteria 2252
565 Ga0496126_0003738 3300048929 Bacteria 18960
566 Ga0501305_026434 3300049161 Bacteria 885
567 Ga0495678_001443 3300049459 Bacteria 18707
568 Ga0495682_0004718 3300049460 Bacteria 5767
569 Ga0501320_014264 3300049536 Bacteria 857
570 Ga0501324_009456 3300049540 Bacteria 874
571 Ga0501032_0000950 3300049569 Bacteria 23379
572 Ga0501033_0001413 3300049570 Bacteria 21332
573 Ga0501033_0086235 3300049570 Bacteria 2299
574 Ga0501034_0011389 3300049571 Bacteria 9223
575 Ga0501034_0056038 3300049571 Bacteria 3967
576 Ga0501034_0344541 3300049571 Bacteria 1420
577 Ga0501036_0085633 3300049572 Bacteria 2664
578 Ga0501037_0013314 3300049573 Bacteria 6062
579 Ga0501037_0028549 3300049573 Bacteria 4121
580 Ga0501043_0027087 3300049579 Bacteria 4499
581 Ga0501047_0013576 3300049581 Bacteria 7724
582 Ga0501047_0066328 3300049581 Bacteria 3479
583 Ga0501047_0087274 3300049581 Bacteria 2997
584 Ga0501047_0214940 3300049581 Bacteria 1780
585 Ga0501047_0365351 3300049581 Bacteria 1279
586 Ga0501048_0137160 3300049582 Bacteria 1729
587 Ga0501067_0000034 3300049583 Bacteria 84068
588 Ga0501067_0012799 3300049583 Bacteria 4647
589 Ga0501068_0000104 3300049584 Bacteria 36213
590 Ga0501068_0013901 3300049584 Bacteria 4591
591 Ga0501073_0000013 3300049589 Bacteria 160591
592 Ga0501073_0023689 3300049589 Bacteria 4406
593 Ga0501077_0000032 3300049593 Bacteria 69728
594 Ga0501080_0001395 3300049742 Bacteria 20223
595 Ga0501080_0003079 3300049742 Bacteria 14728
596 Ga0501080_0088993 3300049742 Bacteria 2868
597 Ga0501035_0225134 3300049822 Bacteria 1600
598 Ga0501044_0000869 3300049823 Bacteria 36398
599 Ga0501044_0006431 3300049823 Bacteria 12981
600 Ga0501044_0010504 3300049823 Bacteria 10046
601 Ga0501044_0115104 3300049823 Bacteria 2694
602 Ga0501044_0141329 3300049823 Bacteria 2396
603 nmdc:mga00v17_1793_c1 3300050491 Bacteria 11124
604 nmdc:mga0k408_31131_c1 3300050493 Bacteria 3045
605 nmdc:mga0k408_50742_c1 3300050493 Bacteria 2402
606 nmdc:mga06z11_1075_c1 3300050494 Bacteria 9942
607 nmdc:mga04h51_752_c1 3300050495 Bacteria 7493
608 nmdc:mga0sz30_2192_c1 3300050516 Bacteria 6981
609 Ga0500635_0001781 3300053080 Bacteria 5246
610 Ga0500578_0000015 3300053086 Bacteria 179217
611 Ga0500578_0125032 3300053086 Bacteria 1615
612 Ga0500643_000738 3300053087 Bacteria 21327
613 Ga0500643_002144 3300053087 Bacteria 10454
614 Ga0500643_004727 3300053087 Bacteria 6051
615 Ga0500643_012764 3300053087 Bacteria 2995
616 Ga0500644_0000058 3300053088 Bacteria 64557
617 Ga0500583_0074174 3300053092 Bacteria 1632
618 Ga0500651_0002465 3300053093 Bacteria 9784
619 Ga0500651_0093292 3300053093 Bacteria 1851
620 Ga0500566_0007869 3300053094 Bacteria 6312
621 Ga0500641_0003231 3300053096 Bacteria 5760
622 Ga0500641_0065355 3300053096 Bacteria 1521
623 Ga0500554_001570 3300053102 Bacteria 4402
624 Ga0500555_001857 3300053103 Bacteria 6290
625 Ga0500556_0000893 3300053104 Bacteria 16678
626 Ga0500556_0002934 3300053104 Bacteria 5158
627 Ga0500556_0095175 3300053104 Bacteria 1141
628 Ga0500556_0156986 3300053104 Bacteria 897
629 Ga0500562_000621 3300053108 Bacteria 8552
630 Ga0500562_004501 3300053108 Bacteria 3522
631 Ga0500562_005117 3300053108 Bacteria 3295
632 Ga0500572_000210 3300053111 Bacteria 20713
633 Ga0500594_0000280 3300053118 Bacteria 11872
634 Ga0500595_003351 3300053119 Bacteria 7519
635 Ga0500595_026993 3300053119 Bacteria 1972
636 Ga0500607_015685 3300053121 Bacteria 4358
637 Ga0500608_001504 3300053122 Bacteria 8327
638 Ga0500608_175879 3300053122 Bacteria 912
639 Ga0500614_000784 3300053123 Bacteria 8047
640 Ga0500618_000014 3300053125 Bacteria 177186
641 Ga0500655_008975 3300053133 Unclassified 1798
642 Ga0500658_0068421 3300053134 Bacteria 1493
643 Ga0500559_0000004 3300053136 Bacteria 241551
644 Ga0500559_0000467 3300053136 Bacteria 28771
645 Ga0500559_0002837 3300053136 Bacteria 8754
646 Ga0500559_0003898 3300053136 Bacteria 7210
647 Ga0500559_0038592 3300053136 Bacteria 2075
648 Ga0500559_0187255 3300053136 Bacteria 975
649 Ga0500564_000229 3300053138 Bacteria 15600
650 Ga0500577_0000828 3300053142 Bacteria 7999
651 Ga0500590_008359 3300053148 Bacteria 5161
652 Ga0500616_0007680 3300053153 Bacteria 6810
653 Ga0500616_0037638 3300053153 Bacteria 2618
654 Ga0500622_0004863 3300053156 Bacteria 8226
655 Ga0500627_0010107 3300053158 Bacteria 3427
656 Ga0500638_005103 3300053162 Bacteria 5179
657 Ga0500639_020561 3300053163 Bacteria 3485
658 Ga0500636_0000445 3300053177 Bacteria 22803
659 Ga0500637_0000895 3300053178 Bacteria 11997
660 Ga0500637_0003583 3300053178 Bacteria 7203
661 Ga0500645_000556 3300053730 Bacteria 24661
662 Ga0500645_003294 3300053730 Bacteria 6647
663 Ga0500609_000324 3300053731 Bacteria 7071
664 Ga0500596_003550 3300053735 Bacteria 2946
665 Ga0587122_009570 3300059628 Bacteria 899
666 Ga0501082_0166411 3300060353 Bacteria 1916

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041463 Ga0451804_0259378 Ga0451804_0259378_21_674 216
2 3300048906 Ga0496103_0141924 Ga0496103_0141924_21_674 217
3 3300013306 Ga0163162_10286514 Ga0163162_102865141 224
4 3300053122 Ga0500608_175879 Ga0500608_175879_202_900 231
5 3300009148 Ga0105243_10156788 Ga0105243_101567882 237
6 3300025935 Ga0207709_10136663 Ga0207709_101366632 237
7 3300009177 Ga0105248_10446280 Ga0105248_104462801 241
8 3300014325 Ga0163163_10067243 Ga0163163_100672435 241
9 3300046684 Ga0495669_0244293 Ga0495669_0244293_30_791 241
10 3300048910 Ga0496107_0124198 Ga0496107_0124198_1121_1879 243
11 3300048913 Ga0496110_0246127 Ga0496110_0246127_868_1608 243
12 3300013308 Ga0157375_10026212 Ga0157375_100262127 244
13 3300048905 Ga0496102_0164400 Ga0496102_0164400_805_1566 244
14 3300048907 Ga0496104_0346203 Ga0496104_0346203_203_964 244
15 3300048911 Ga0496108_0150024 Ga0496108_0150024_379_1140 244
16 3300048912 Ga0496109_0079007 Ga0496109_0079007_1825_2586 244
17 iso_pu_bacteria 2643221541 2643727451 248
18 iso_pu_bacteria 2643221606 2644041389 248
19 iso_pu_bacteria 2643221671 2644394929 248
20 3300005347 Ga0070668_100000545 Ga0070668_10000054516 249
21 3300005843 Ga0068860_100000027 Ga0068860_100000027137 249
22 3300025972 Ga0207668_10007793 Ga0207668_100077939 249
23 3300028380 Ga0268265_10004852 Ga0268265_100048523 249
24 3300028380 Ga0268265_10015154 Ga0268265_100151545 249
25 3300028381 Ga0268264_10000014 Ga0268264_10000014451 249
26 3300044765 Ga0466970_0067814 Ga0466970_0067814_1031_1783 249
27 3300046525 Ga0495663_0065948 Ga0495663_0065948_353_1111 249
28 3300046616 Ga0495668_0017075 Ga0495668_0017075_105_863 251
29 3300005347 Ga0070668_100058996 Ga0070668_1000589962 252
30 3300005841 Ga0068863_100101228 Ga0068863_1001012284 252
31 3300009551 Ga0105238_10015232 Ga0105238_1001523212 252
32 3300025972 Ga0207668_10348571 Ga0207668_103485712 252
33 3300026088 Ga0207641_10024325 Ga0207641_100243254 252
34 3300028380 Ga0268265_10042070 Ga0268265_100420704 252
35 3300035692 Ga0373935_0047465 Ga0373935_0047465_1433_2194 252
36 3300037068 Ga0373925_0105563 Ga0373925_0105563_118_879 252
37 3300046528 Ga0495642_0002495 Ga0495642_0002495_2289_3050 252
38 3300046616 Ga0495668_0024518 Ga0495668_0024518_838_1599 252
39 3300046616 Ga0495668_0244086 Ga0495668_0244086_76_837 252
40 3300046660 Ga0495625_0007139 Ga0495625_0007139_3975_4736 252
41 3300047472 Ga0495686_0014939 Ga0495686_0014939_3192_3953 252
42 3300048088 Ga0495602_0167608 Ga0495602_0167608_95_856 252
43 3300049540 Ga0501324_009456 Ga0501324_009456_14_775 252
44 3300049570 Ga0501033_0086235 Ga0501033_0086235_214_975 252
45 3300049573 Ga0501037_0028549 Ga0501037_0028549_2123_2884 252
46 3300049581 Ga0501047_0066328 Ga0501047_0066328_1117_1878 252
47 3300049581 Ga0501047_0365351 Ga0501047_0365351_318_1079 252
48 3300049823 Ga0501044_0010504 Ga0501044_0010504_2352_3113 252
49 3300053096 Ga0500641_0065355 Ga0500641_0065355_22_783 252
50 3300009177 Ga0105248_10004201 Ga0105248_100042017 253
51 3300009553 Ga0105249_10246336 Ga0105249_102463363 253
52 3300013306 Ga0163162_10130170 Ga0163162_101301704 253
53 3300014325 Ga0163163_10002482 Ga0163163_1000248210 253
54 3300014968 Ga0157379_10000416 Ga0157379_100004165 253
55 3300037471 Ga0395905_0001773 Ga0395905_0001773_9761_10561 253
56 3300046459 Ga0495629_0031201 Ga0495629_0031201_1276_2040 253
57 3300046515 Ga0495620_0037282 Ga0495620_0037282_44_808 253
58 3300046522 Ga0495643_0005279 Ga0495643_0005279_7626_8390 253
59 3300046542 Ga0495597_0001783 Ga0495597_0001783_5533_6297 253
60 3300046557 Ga0495622_0001637 Ga0495622_0001637_1889_2653 253
61 3300049581 Ga0501047_0013576 Ga0501047_0013576_1254_2018 253
62 3300053080 Ga0500635_0001781 Ga0500635_0001781_1747_2511 253
63 3300053092 Ga0500583_0074174 Ga0500583_0074174_458_1222 253
64 3300053093 Ga0500651_0002465 Ga0500651_0002465_490_1254 253
65 3300053094 Ga0500566_0007869 Ga0500566_0007869_5155_5919 253
66 3300053119 Ga0500595_003351 Ga0500595_003351_6210_6974 253
67 3300053121 Ga0500607_015685 Ga0500607_015685_1563_2327 253
68 3300053123 Ga0500614_000784 Ga0500614_000784_1877_2641 253
69 3300053136 Ga0500559_0003898 Ga0500559_0003898_4770_5534 253
70 3300053148 Ga0500590_008359 Ga0500590_008359_3222_3986 253
71 3300053162 Ga0500638_005103 Ga0500638_005103_4244_5008 253
72 3300053177 Ga0500636_0000445 Ga0500636_0000445_11640_12404 253
73 3300053178 Ga0500637_0000895 Ga0500637_0000895_1583_2347 253
74 3300053178 Ga0500637_0003583 Ga0500637_0003583_3003_3767 253
75 3300053735 Ga0500596_003550 Ga0500596_003550_661_1425 253
76 3300025941 Ga0207711_10380187 Ga0207711_103801872 254
77 3300031456 Ga0307513_10000433 Ga0307513_1000043334 254
78 3300009093 Ga0105240_10000314 Ga0105240_1000031446 255
79 3300009098 Ga0105245_10190260 Ga0105245_101902601 255
80 3300025927 Ga0207687_10121269 Ga0207687_101212693 255
81 3300041494 Ga0451837_0520645 Ga0451837_0520645_96_878 255
82 3300046471 Ga0495650_0030802 Ga0495650_0030802_1584_2354 255
83 3300046543 Ga0495645_0188755 Ga0495645_0188755_30_833 255
84 3300047472 Ga0495686_0000509 Ga0495686_0000509_6272_7054 255
85 3300047472 Ga0495686_0035439 Ga0495686_0035439_2331_3113 255
86 3300047472 Ga0495686_0312485 Ga0495686_0312485_52_834 255
87 3300049460 Ga0495682_0004718 Ga0495682_0004718_1947_2750 255
88 3300049569 Ga0501032_0000950 Ga0501032_0000950_20899_21681 255
89 3300049571 Ga0501034_0056038 Ga0501034_0056038_2599_3381 255
90 3300049572 Ga0501036_0085633 Ga0501036_0085633_599_1381 255
91 3300049579 Ga0501043_0027087 Ga0501043_0027087_130_912 255
92 3300049581 Ga0501047_0087274 Ga0501047_0087274_898_1680 255
93 3300049583 Ga0501067_0000034 Ga0501067_0000034_57449_58231 255
94 3300049583 Ga0501067_0012799 Ga0501067_0012799_2592_3374 255
95 3300049584 Ga0501068_0000104 Ga0501068_0000104_12033_12815 255
96 3300049584 Ga0501068_0013901 Ga0501068_0013901_1934_2716 255
97 3300049589 Ga0501073_0000013 Ga0501073_0000013_33972_34754 255
98 3300049589 Ga0501073_0023689 Ga0501073_0023689_2242_3024 255
99 3300049593 Ga0501077_0000032 Ga0501077_0000032_61550_62332 255
100 3300049742 Ga0501080_0001395 Ga0501080_0001395_18248_19030 255
101 3300049742 Ga0501080_0003079 Ga0501080_0003079_7048_7830 255
102 3300049823 Ga0501044_0006431 Ga0501044_0006431_8265_9047 255
103 3300049823 Ga0501044_0115104 Ga0501044_0115104_1865_2647 255
104 3300053133 Ga0500655_008975 Ga0500655_008975_756_1559 255
105 3300060353 Ga0501082_0166411 Ga0501082_0166411_14_796 255
106 3300028380 Ga0268265_10279993 Ga0268265_102799931 256
107 3300046452 Ga0495617_077565 Ga0495617_077565_56_841 256
108 3300047472 Ga0495686_0037088 Ga0495686_0037088_1230_2000 256
109 3300047472 Ga0495686_0038463 Ga0495686_0038463_1620_2405 256
110 3300005335 Ga0070666_10358267 Ga0070666_103582671 257
111 3300005457 Ga0070662_100014019 Ga0070662_1000140193 257
112 3300005564 Ga0070664_100357377 Ga0070664_1003573772 257
113 3300005618 Ga0068864_100011010 Ga0068864_10001101010 257
114 3300005841 Ga0068863_100051072 Ga0068863_1000510727 257
115 3300025925 Ga0207650_10476370 Ga0207650_104763702 257
116 3300025933 Ga0207706_10053367 Ga0207706_100533675 257
117 3300025960 Ga0207651_10152703 Ga0207651_101527032 257
118 3300025986 Ga0207658_10632973 Ga0207658_106329731 257
119 3300026088 Ga0207641_10064399 Ga0207641_100643995 257
120 3300026095 Ga0207676_10083156 Ga0207676_100831561 257
121 3300026121 Ga0207683_10029433 Ga0207683_100294334 257
122 3300045049 Ga0466959_0339020 Ga0466959_0339020_50_850 257
123 3300046528 Ga0495642_0156789 Ga0495642_0156789_100_900 257
124 3300020076 Ga0206355_1092300 Ga0206355_10923001 258
125 3300039453 Ga0436362_0933212 Ga0436362_0933212_132_911 258
126 3300053108 Ga0500562_004501 Ga0500562_004501_2450_3229 258
127 iso_pu_bacteria 2643221614 2644087233 258
128 iso_pu_bacteria 2643221661 2644342186 258
129 iso_pu_bacteria 2643221666 2644368472 258
130 iso_pu_bacteria 2941485952 2941486011 258
131 3300005548 Ga0070665_100056913 Ga0070665_1000569135 259
132 3300009553 Ga0105249_10000550 Ga0105249_1000055029 259
133 3300014968 Ga0157379_10017950 Ga0157379_100179503 259
134 3300044693 Ga0466961_0263845 Ga0466961_0263845_52_834 259
135 3300046539 Ga0495621_0085032 Ga0495621_0085032_54_845 259
136 3300048905 Ga0496102_0317265 Ga0496102_0317265_94_876 259
137 3300049161 Ga0501305_026434 Ga0501305_026434_32_814 259
138 iso_pu_bacteria 2643221663 2644351554 259
139 iso_pu_bacteria 2791355048 2792458716 259
140 iso_pu_bacteria 2830075706 2830078104 259
141 iso_pu_bacteria 2843744320 2843745609 259
142 iso_pu_bacteria 2849560528 2849561224 259
143 iso_pu_bacteria 2849573788 2849576313 259
144 iso_pu_bacteria 2851153111 2851157260 259
145 iso_pu_bacteria 2898329390 2898332922 259
146 iso_pu_bacteria 2928972540 2928973426 259
147 iso_pu_bacteria 2977240413 2977240596 259
148 3300005563 Ga0068855_100024093 Ga0068855_1000240937 260
149 3300009093 Ga0105240_10214524 Ga0105240_102145242 260
150 3300009174 Ga0105241_10121304 Ga0105241_101213041 260
151 3300013297 Ga0157378_10540112 Ga0157378_105401121 260
152 3300021384 Ga0213876_10000480 Ga0213876_100004808 260
153 3300025949 Ga0207667_10023360 Ga0207667_100233607 260
154 3300032005 Ga0307411_10064613 Ga0307411_100646133 260
155 3300037418 Ga0395900_0006917 Ga0395900_0006917_9120_9920 260
156 3300037471 Ga0395905_0081858 Ga0395905_0081858_1216_2016 260
157 3300038443 Ga0395901_0053727 Ga0395901_0053727_2177_2977 260
158 3300039437 Ga0436365_1867062 Ga0436365_1867062_21689_22516 260
159 3300041410 Ga0439461_0017965 Ga0439461_0017965_493_1284 260
160 3300049571 Ga0501034_0344541 Ga0501034_0344541_563_1354 260
161 3300049822 Ga0501035_0225134 Ga0501035_0225134_641_1432 260
162 iso_pu_bacteria 2643221574 2643884497 260
163 iso_pu_bacteria 2643221598 2643998232 260
164 iso_pu_bacteria 2643221699 2644548560 260
165 iso_pu_bacteria 2643221699 2644548807 260
166 3300003794 Ga0055531_10001364 Ga0055531_1000136418 261
167 3300005329 Ga0070683_100214460 Ga0070683_1002144603 261
168 3300005344 Ga0070661_100030083 Ga0070661_1000300832 261
169 3300005539 Ga0068853_100001308 Ga0068853_10000130814 261
170 3300005539 Ga0068853_100166221 Ga0068853_1001662213 261
171 3300005563 Ga0068855_100000144 Ga0068855_10000014452 261
172 3300005563 Ga0068855_100534466 Ga0068855_1005344661 261
173 3300005614 Ga0068856_100024065 Ga0068856_1000240654 261
174 3300005616 Ga0068852_100013845 Ga0068852_1000138452 261
175 3300009174 Ga0105241_10292303 Ga0105241_102923031 261
176 3300010375 Ga0105239_10001128 Ga0105239_1000112832 261
177 3300010375 Ga0105239_10007021 Ga0105239_100070218 261
178 3300013105 Ga0157369_10003463 Ga0157369_100034637 261
179 3300013105 Ga0157369_10016064 Ga0157369_100160648 261
180 3300020069 Ga0197907_11194425 Ga0197907_111944252 261
181 3300025292 Ga0209676_1000320 Ga0209676_100032055 261
182 3300025298 Ga0209050_1000911 Ga0209050_100091119 261
183 3300025304 Ga0209257_1000338 Ga0209257_100033855 261
184 3300025913 Ga0207695_10000012 Ga0207695_1000001247 261
185 3300025920 Ga0207649_10036828 Ga0207649_100368285 261
186 3300025924 Ga0207694_10000006 Ga0207694_10000006611 261
187 3300025949 Ga0207667_10000026 Ga0207667_10000026348 261
188 3300026041 Ga0207639_10001861 Ga0207639_1000186114 261
189 3300026078 Ga0207702_10390091 Ga0207702_103900911 261
190 3300026142 Ga0207698_10008529 Ga0207698_100085292 261
191 3300028577 Ga0265318_10000017 Ga0265318_10000017163 261
192 3300028800 Ga0265338_10000006 Ga0265338_10000006449 261
193 3300031241 Ga0265325_10000003 Ga0265325_1000000393 261
194 3300031241 Ga0265325_10160057 Ga0265325_101600571 261
195 3300031242 Ga0265329_10024642 Ga0265329_100246422 261
196 3300031247 Ga0265340_10006929 Ga0265340_100069295 261
197 3300031249 Ga0265339_10000384 Ga0265339_100003845 261
198 3300031250 Ga0265331_10039098 Ga0265331_100390983 261
199 3300031251 Ga0265327_10001695 Ga0265327_100016958 261
200 3300031711 Ga0265314_10019618 Ga0265314_100196184 261
201 3300031730 Ga0307516_10113587 Ga0307516_101135873 261
202 3300037418 Ga0395900_0141922 Ga0395900_0141922_274_1065 261
203 3300037471 Ga0395905_0073206 Ga0395905_0073206_895_1686 261
204 3300038443 Ga0395901_0010737 Ga0395901_0010737_4014_4805 261
205 3300038443 Ga0395901_0252500 Ga0395901_0252500_645_1436 261
206 3300046529 Ga0495652_0013684 Ga0495652_0013684_3377_4198 261
207 3300046529 Ga0495652_0210369 Ga0495652_0210369_556_1347 261
208 3300046536 Ga0495587_0080652 Ga0495587_0080652_735_1526 261
209 3300046689 Ga0495613_0003944 Ga0495613_0003944_2896_3687 261
210 3300048909 Ga0496106_0489973 Ga0496106_0489973_33_824 261
211 3300049581 Ga0501047_0214940 Ga0501047_0214940_234_1025 261
212 3300049742 Ga0501080_0088993 Ga0501080_0088993_148_978 261
213 3300049823 Ga0501044_0141329 Ga0501044_0141329_570_1361 261
214 3300053111 Ga0500572_000210 Ga0500572_000210_10002_10793 261
215 3300053136 Ga0500559_0038592 Ga0500559_0038592_600_1391 261
216 3300005262 Ga0065165_1023862 Ga0065165_10238623 262
217 3300005331 Ga0070670_100069961 Ga0070670_1000699613 262
218 3300005333 Ga0070677_10006543 Ga0070677_100065434 262
219 3300005347 Ga0070668_100257243 Ga0070668_1002572433 262
220 3300005353 Ga0070669_100193381 Ga0070669_1001933813 262
221 3300005354 Ga0070675_100012398 Ga0070675_1000123981 262
222 3300005355 Ga0070671_100183051 Ga0070671_1001830513 262
223 3300005530 Ga0070679_100341758 Ga0070679_1003417583 262
224 3300005548 Ga0070665_100057618 Ga0070665_1000576183 262
225 3300005577 Ga0068857_100140545 Ga0068857_1001405453 262
226 3300005983 Ga0081540_1083201 Ga0081540_10832011 262
227 3300006186 Ga0075369_10081739 Ga0075369_100817392 262
228 3300014326 Ga0157380_10019148 Ga0157380_100191483 262
229 3300025893 Ga0207682_10009214 Ga0207682_100092144 262
230 3300025907 Ga0207645_10075528 Ga0207645_100755283 262
231 3300025908 Ga0207643_10231562 Ga0207643_102315621 262
232 3300025921 Ga0207652_10301602 Ga0207652_103016022 262
233 3300025923 Ga0207681_10247864 Ga0207681_102478643 262
234 3300025923 Ga0207681_10434961 Ga0207681_104349611 262
235 3300025926 Ga0207659_10212741 Ga0207659_102127412 262
236 3300025972 Ga0207668_10160525 Ga0207668_101605253 262
237 3300028379 Ga0268266_10190056 Ga0268266_101900562 262
238 3300028577 Ga0265318_10070474 Ga0265318_100704743 262
239 3300030888 Ga0265769_103594 Ga0265769_1035941 262
240 3300031824 Ga0307413_10000908 Ga0307413_1000090812 262
241 3300031824 Ga0307413_10461761 Ga0307413_104617611 262
242 3300031852 Ga0307410_10001707 Ga0307410_100017079 262
243 3300031852 Ga0307410_10201253 Ga0307410_102012531 262
244 3300031852 Ga0307410_10311332 Ga0307410_103113321 262
245 3300031995 Ga0307409_100004772 Ga0307409_1000047726 262
246 3300031995 Ga0307409_100005890 Ga0307409_1000058908 262
247 3300031995 Ga0307409_100238072 Ga0307409_1002380723 262
248 3300032002 Ga0307416_100013050 Ga0307416_1000130503 262
249 3300032002 Ga0307416_100055631 Ga0307416_1000556312 262
250 3300032002 Ga0307416_100285114 Ga0307416_1002851143 262
251 3300032004 Ga0307414_10011419 Ga0307414_100114195 262
252 3300032004 Ga0307414_10387112 Ga0307414_103871121 262
253 3300032005 Ga0307411_10001268 Ga0307411_1000126812 262
254 3300032005 Ga0307411_10205217 Ga0307411_102052172 262
255 3300032126 Ga0307415_100030346 Ga0307415_1000303461 262
256 3300032126 Ga0307415_100113175 Ga0307415_1001131753 262
257 3300032126 Ga0307415_100122113 Ga0307415_1001221131 262
258 3300037471 Ga0395905_0300101 Ga0395905_0300101_570_1367 262
259 3300042533 Ga0450901_002401 Ga0450901_002401_964_1755 262
260 3300042876 Ga0451577_0275287 Ga0451577_0275287_296_1093 262
261 3300046501 Ga0495607_0016419 Ga0495607_0016419_3444_4241 262
262 3300046524 Ga0495648_0058412 Ga0495648_0058412_176_991 262
263 3300046691 Ga0495670_0223527 Ga0495670_0223527_180_977 262
264 3300048911 Ga0496108_0655089 Ga0496108_0655089_79_876 262
265 3300048914 Ga0496111_0177393 Ga0496111_0177393_294_1091 262
266 3300053087 Ga0500643_004727 Ga0500643_004727_997_1794 262
267 3300053136 Ga0500559_0000004 Ga0500559_0000004_75258_76052 262
268 3300053163 Ga0500639_020561 Ga0500639_020561_1956_2750 262
269 iso_pu_bacteria 2510917020 2511120892 262
270 iso_pu_bacteria 2582581279 2585149901 262
271 iso_pu_bacteria 2582581280 2585155564 262
272 iso_pu_bacteria 2582581293 2585199407 262
273 iso_pu_bacteria 2585428106 2587915614 262
274 iso_pu_bacteria 2643221545 2643748128 262
275 iso_pu_bacteria 2643221552 2643781129 262
276 iso_pu_bacteria 2643221583 2643926863 262
277 iso_pu_bacteria 2643221584 2643930462 262
278 iso_pu_bacteria 2643221640 2644223163 262
279 iso_pu_bacteria 2643221642 2644236567 262
280 iso_pu_bacteria 2643221691 2644506864 262
281 iso_pu_bacteria 2818991435 2819540237 262
282 iso_pu_bacteria 2818991454 2819649201 262
283 iso_pu_bacteria 2857504554 2857505531 262
284 iso_pu_bacteria 2884960567 2884960954 262
285 iso_pu_bacteria 2928531327 2928532360 262
286 3300003781 Ga0055536_1001254 Ga0055536_100125414 263
287 3300003794 Ga0055531_10013178 Ga0055531_100131784 263
288 3300005347 Ga0070668_100005838 Ga0070668_1000058383 263
289 3300005618 Ga0068864_100001043 Ga0068864_10000104316 263
290 3300005719 Ga0068861_100153294 Ga0068861_1001532943 263
291 3300005985 Ga0081539_10017674 Ga0081539_100176743 263
292 3300009093 Ga0105240_10382110 Ga0105240_103821103 263
293 3300009177 Ga0105248_10039683 Ga0105248_100396835 263
294 3300013102 Ga0157371_10036519 Ga0157371_100365194 263
295 3300013104 Ga0157370_10095014 Ga0157370_100950144 263
296 3300013105 Ga0157369_10008596 Ga0157369_1000859612 263
297 3300013306 Ga0163162_10347525 Ga0163162_103475253 263
298 3300025292 Ga0209676_1000115 Ga0209676_1000115137 263
299 3300025292 Ga0209676_1003173 Ga0209676_10031738 263
300 3300025298 Ga0209050_1037073 Ga0209050_10370731 263
301 3300025304 Ga0209257_1000090 Ga0209257_1000090119 263
302 3300025972 Ga0207668_10004107 Ga0207668_1000410711 263
303 3300026067 Ga0207678_10561479 Ga0207678_105614791 263
304 3300026095 Ga0207676_10002708 Ga0207676_100027082 263
305 3300026118 Ga0207675_100243719 Ga0207675_1002437191 263
306 3300028379 Ga0268266_10268142 Ga0268266_102681422 263
307 3300028380 Ga0268265_10110737 Ga0268265_101107373 263
308 3300031251 Ga0265327_10001467 Ga0265327_100014677 263
309 3300031901 Ga0307406_10001617 Ga0307406_1000161712 263
310 3300031995 Ga0307409_100009208 Ga0307409_1000092085 263
311 3300032004 Ga0307414_10085657 Ga0307414_100856573 263
312 3300032004 Ga0307414_10658417 Ga0307414_106584171 263
313 3300032005 Ga0307411_10033153 Ga0307411_100331532 263
314 3300033180 Ga0307510_10002824 Ga0307510_1000282414 263
315 3300033180 Ga0307510_10152558 Ga0307510_101525583 263
316 3300046457 Ga0495590_0092828 Ga0495590_0092828_35_859 263
317 3300046506 Ga0495583_0017975 Ga0495583_0017975_642_1466 263
318 3300046522 Ga0495643_0021498 Ga0495643_0021498_343_1137 263
319 3300046539 Ga0495621_0071935 Ga0495621_0071935_181_975 263
320 3300046558 Ga0495633_0000400 Ga0495633_0000400_36485_37279 263
321 3300046616 Ga0495668_0284881 Ga0495668_0284881_36_860 263
322 3300046660 Ga0495625_0008727 Ga0495625_0008727_3119_3943 263
323 3300046694 Ga0495649_0000118 Ga0495649_0000118_56519_57313 263
324 3300048918 Ga0496115_0026179 Ga0496115_0026179_123_917 263
325 3300048919 Ga0496116_0035179 Ga0496116_0035179_875_1669 263
326 3300048925 Ga0496122_0003299 Ga0496122_0003299_15166_15960 263
327 3300048926 Ga0496123_0000968 Ga0496123_0000968_27330_28124 263
328 3300048928 Ga0496125_0001230 Ga0496125_0001230_32584_33378 263
329 3300048928 Ga0496125_0093030 Ga0496125_0093030_1167_1961 263
330 3300053087 Ga0500643_000738 Ga0500643_000738_849_1646 263
331 3300053087 Ga0500643_002144 Ga0500643_002144_9203_10027 263
332 3300053093 Ga0500651_0093292 Ga0500651_0093292_354_1148 263
333 3300053096 Ga0500641_0003231 Ga0500641_0003231_1123_1920 263
334 3300053104 Ga0500556_0002934 Ga0500556_0002934_3761_4558 263
335 3300053104 Ga0500556_0095175 Ga0500556_0095175_62_859 263
336 3300053108 Ga0500562_000621 Ga0500562_000621_6535_7332 263
337 3300053108 Ga0500562_005117 Ga0500562_005117_384_1181 263
338 3300053153 Ga0500616_0037638 Ga0500616_0037638_1639_2436 263
339 3300053730 Ga0500645_000556 Ga0500645_000556_4015_4812 263
340 3300004803 Ga0058862_12862074 Ga0058862_128620741 264
341 3300005618 Ga0068864_100138567 Ga0068864_1001385673 264
342 3300009545 Ga0105237_10149381 Ga0105237_101493814 264
343 3300021361 Ga0213872_10032970 Ga0213872_100329704 264
344 3300025254 Ga0209148_1020121 Ga0209148_10201211 264
345 3300026035 Ga0207703_10159162 Ga0207703_101591624 264
346 3300026095 Ga0207676_10105806 Ga0207676_101058064 264
347 3300028800 Ga0265338_10068152 Ga0265338_100681524 264
348 3300030521 Ga0307511_10044730 Ga0307511_100447304 264
349 3300031456 Ga0307513_10012141 Ga0307513_1001214112 264
350 3300031731 Ga0307405_10076422 Ga0307405_100764222 264
351 3300031824 Ga0307413_10188813 Ga0307413_101888133 264
352 3300032004 Ga0307414_10036540 Ga0307414_100365403 264
353 3300032004 Ga0307414_10139254 Ga0307414_101392543 264
354 3300032004 Ga0307414_10330168 Ga0307414_103301682 264
355 3300033180 Ga0307510_10029037 Ga0307510_100290376 264
356 3300035113 Ga0373936_0002568 Ga0373936_0002568_5151_5948 264
357 3300038443 Ga0395901_0925144 Ga0395901_0925144_41_838 264
358 3300039447 Ga0436361_0135680 Ga0436361_0135680_9095_9892 264
359 3300046460 Ga0495638_0159809 Ga0495638_0159809_13_810 264
360 3300047320 Ga0495672_0076163 Ga0495672_0076163_136_1002 264
361 3300003791 Ga0055530_10002063 Ga0055530_100020636 265
362 3300003794 Ga0055531_10003088 Ga0055531_1000308816 265
363 3300005262 Ga0065165_1001741 Ga0065165_100174121 265
364 3300005262 Ga0065165_1027898 Ga0065165_10278983 265
365 3300005327 Ga0070658_10048570 Ga0070658_100485704 265
366 3300005327 Ga0070658_10111645 Ga0070658_101116452 265
367 3300005331 Ga0070670_100000007 Ga0070670_100000007115 265
368 3300005336 Ga0070680_100037532 Ga0070680_1000375321 265
369 3300005336 Ga0070680_100054717 Ga0070680_1000547172 265
370 3300005339 Ga0070660_100013760 Ga0070660_1000137604 265
371 3300005339 Ga0070660_100068786 Ga0070660_1000687864 265
372 3300005347 Ga0070668_100000129 Ga0070668_10000012929 265
373 3300005355 Ga0070671_100097113 Ga0070671_1000971135 265
374 3300005366 Ga0070659_100000457 Ga0070659_10000045714 265
375 3300005366 Ga0070659_100016600 Ga0070659_1000166004 265
376 3300005367 Ga0070667_100000611 Ga0070667_1000006113 265
377 3300005436 Ga0070713_100542169 Ga0070713_1005421691 265
378 3300005458 Ga0070681_10042610 Ga0070681_100426102 265
379 3300005530 Ga0070679_100045077 Ga0070679_1000450775 265
380 3300005539 Ga0068853_100026565 Ga0068853_1000265655 265
381 3300005548 Ga0070665_100000246 Ga0070665_10000024615 265
382 3300005548 Ga0070665_100000692 Ga0070665_10000069227 265
383 3300005548 Ga0070665_100041944 Ga0070665_1000419445 265
384 3300005563 Ga0068855_100362658 Ga0068855_1003626582 265
385 3300005578 Ga0068854_100202358 Ga0068854_1002023581 265
386 3300005616 Ga0068852_100264271 Ga0068852_1002642712 265
387 3300005618 Ga0068864_100000225 Ga0068864_10000022541 265
388 3300005841 Ga0068863_100000295 Ga0068863_10000029511 265
389 3300005843 Ga0068860_100000047 Ga0068860_100000047117 265
390 3300005844 Ga0068862_100000396 Ga0068862_1000003961 265
391 3300005844 Ga0068862_100041258 Ga0068862_1000412584 265
392 3300006186 Ga0075369_10001551 Ga0075369_100015514 265
393 3300009093 Ga0105240_10002602 Ga0105240_100026023 265
394 3300009093 Ga0105240_10003899 Ga0105240_100038992 265
395 3300009093 Ga0105240_10161382 Ga0105240_101613824 265
396 3300009093 Ga0105240_10163815 Ga0105240_101638153 265
397 3300009177 Ga0105248_10000112 Ga0105248_1000011220 265
398 3300009551 Ga0105238_10009812 Ga0105238_100098125 265
399 3300010375 Ga0105239_10273124 Ga0105239_102731241 265
400 3300013104 Ga0157370_10084892 Ga0157370_100848923 265
401 3300013104 Ga0157370_10735773 Ga0157370_107357731 265
402 3300013307 Ga0157372_10017170 Ga0157372_100171703 265
403 3300021361 Ga0213872_10017319 Ga0213872_100173194 265
404 3300021377 Ga0213874_10023016 Ga0213874_100230162 265
405 3300021384 Ga0213876_10000130 Ga0213876_1000013069 265
406 3300025250 Ga0209026_1000556 Ga0209026_100055612 265
407 3300025254 Ga0209148_1012042 Ga0209148_10120421 265
408 3300025297 Ga0209758_1000404 Ga0209758_100040418 265
409 3300025298 Ga0209050_1001951 Ga0209050_100195119 265
410 3300025304 Ga0209257_1000227 Ga0209257_100022737 265
411 3300025304 Ga0209257_1000507 Ga0209257_100050734 265
412 3300025909 Ga0207705_10020966 Ga0207705_100209663 265
413 3300025909 Ga0207705_10058229 Ga0207705_100582293 265
414 3300025909 Ga0207705_10266877 Ga0207705_102668772 265
415 3300025913 Ga0207695_10001434 Ga0207695_1000143413 265
416 3300025913 Ga0207695_10008553 Ga0207695_100085533 265
417 3300025913 Ga0207695_10010460 Ga0207695_100104606 265
418 3300025913 Ga0207695_10062992 Ga0207695_100629928 265
419 3300025913 Ga0207695_10247340 Ga0207695_102473402 265
420 3300025917 Ga0207660_10112537 Ga0207660_101125373 265
421 3300025919 Ga0207657_10009221 Ga0207657_1000922113 265
422 3300025919 Ga0207657_10054397 Ga0207657_100543974 265
423 3300025919 Ga0207657_10079861 Ga0207657_100798613 265
424 3300025921 Ga0207652_10073367 Ga0207652_100733675 265
425 3300025924 Ga0207694_10009016 Ga0207694_100090163 265
426 3300025924 Ga0207694_10103279 Ga0207694_101032791 265
427 3300025925 Ga0207650_10000030 Ga0207650_10000030236 265
428 3300025931 Ga0207644_10078662 Ga0207644_100786623 265
429 3300025932 Ga0207690_10000230 Ga0207690_1000023024 265
430 3300025932 Ga0207690_10055025 Ga0207690_100550253 265
431 3300025941 Ga0207711_10000718 Ga0207711_1000071819 265
432 3300025949 Ga0207667_10363451 Ga0207667_103634512 265
433 3300025961 Ga0207712_10003727 Ga0207712_1000372714 265
434 3300025981 Ga0207640_10121830 Ga0207640_101218302 265
435 3300025986 Ga0207658_10000417 Ga0207658_1000041740 265
436 3300026041 Ga0207639_10149239 Ga0207639_101492392 265
437 3300026088 Ga0207641_10006137 Ga0207641_100061376 265
438 3300026088 Ga0207641_10499424 Ga0207641_104994242 265
439 3300026095 Ga0207676_10000227 Ga0207676_1000022734 265
440 3300026142 Ga0207698_10208457 Ga0207698_102084572 265
441 3300027462 Ga0210000_1013411 Ga0210000_10134112 265
442 3300027543 Ga0209999_1008725 Ga0209999_10087251 265
443 3300028379 Ga0268266_10000003 Ga0268266_10000003988 265
444 3300028379 Ga0268266_10138329 Ga0268266_101383293 265
445 3300028380 Ga0268265_10000661 Ga0268265_1000066140 265
446 3300028380 Ga0268265_10018691 Ga0268265_100186915 265
447 3300028380 Ga0268265_10096082 Ga0268265_100960823 265
448 3300028381 Ga0268264_10000205 Ga0268264_10000205106 265
449 3300028558 Ga0265326_10027024 Ga0265326_100270243 265
450 3300028573 Ga0265334_10035943 Ga0265334_100359432 265
451 3300028786 Ga0307517_10048553 Ga0307517_100485535 265
452 3300028786 Ga0307517_10191367 Ga0307517_101913672 265
453 3300028800 Ga0265338_10041785 Ga0265338_100417854 265
454 3300028800 Ga0265338_10186578 Ga0265338_101865783 265
455 3300028800 Ga0265338_10260139 Ga0265338_102601392 265
456 3300028800 Ga0265338_10295138 Ga0265338_102951381 265
457 3300031251 Ga0265327_10000757 Ga0265327_100007578 265
458 3300031456 Ga0307513_10002967 Ga0307513_1000296718 265
459 3300031548 Ga0307408_100556620 Ga0307408_1005566201 265
460 3300031730 Ga0307516_10000006 Ga0307516_10000006187 265
461 3300037312 Ga0395899_0000018 Ga0395899_0000018_287881_288681 265
462 3300037312 Ga0395899_0087942 Ga0395899_0087942_616_1416 265
463 3300037466 Ga0395898_0420535 Ga0395898_0420535_460_1260 265
464 3300037471 Ga0395905_0381049 Ga0395905_0381049_481_1281 265
465 3300037853 Ga0436364_0441706 Ga0436364_0441706_750_1550 265
466 3300038443 Ga0395901_0156512 Ga0395901_0156512_1323_2123 265
467 3300039437 Ga0436365_0031959 Ga0436365_0031959_93214_94026 265
468 3300039447 Ga0436361_1069972 Ga0436361_1069972_12453_13253 265
469 3300039450 Ga0436363_1657838 Ga0436363_1657838_880_1692 265
470 3300046460 Ga0495638_0000185 Ga0495638_0000185_44887_45684 265
471 3300046506 Ga0495583_0008901 Ga0495583_0008901_1430_2230 265
472 3300046512 Ga0495610_0004821 Ga0495610_0004821_2488_3285 265
473 3300046684 Ga0495669_0000007 Ga0495669_0000007_3016_3816 265
474 3300046684 Ga0495669_0013681 Ga0495669_0013681_1081_1881 265
475 3300048918 Ga0496115_0002581 Ga0496115_0002581_6611_7411 265
476 3300048918 Ga0496115_0164018 Ga0496115_0164018_18_905 265
477 3300048927 Ga0496124_0021187 Ga0496124_0021187_5104_5901 265
478 3300048928 Ga0496125_0012468 Ga0496125_0012468_4854_5651 265
479 3300048929 Ga0496126_0003738 Ga0496126_0003738_763_1560 265
480 3300049459 Ga0495678_001443 Ga0495678_001443_797_1594 265
481 3300049536 Ga0501320_014264 Ga0501320_014264_38_838 265
482 3300049570 Ga0501033_0001413 Ga0501033_0001413_19696_20496 265
483 3300049571 Ga0501034_0011389 Ga0501034_0011389_820_1620 265
484 3300049573 Ga0501037_0013314 Ga0501037_0013314_4183_4983 265
485 3300049582 Ga0501048_0137160 Ga0501048_0137160_673_1473 265
486 3300049823 Ga0501044_0000869 Ga0501044_0000869_6017_6817 265
487 3300050493 nmdc:mga0k408_50742_c1 nmdc:mga0k408_50742_c1_818_1615 265
488 3300050516 nmdc:mga0sz30_2192_c1 nmdc:mga0sz30_2192_c1_913_1710 265
489 3300053086 Ga0500578_0000015 Ga0500578_0000015_161960_162757 265
490 3300053118 Ga0500594_0000280 Ga0500594_0000280_3885_4682 265
491 3300053119 Ga0500595_026993 Ga0500595_026993_457_1257 265
492 3300053156 Ga0500622_0004863 Ga0500622_0004863_7384_8184 265
493 3300003215 JGI25153J46596_10034119 JGI25153J46596_100341191 266
494 3300003771 Ga0055526_1018273 Ga0055526_10182733 266
495 3300003773 Ga0055537_1004582 Ga0055537_10045824 266
496 3300003775 Ga0055524_1008284 Ga0055524_10082845 266
497 3300003790 Ga0055528_1004170 Ga0055528_10041706 266
498 3300003791 Ga0055530_10008853 Ga0055530_100088533 266
499 3300003794 Ga0055531_10005840 Ga0055531_100058406 266
500 3300005262 Ga0065165_1001500 Ga0065165_100150021 266
501 3300005327 Ga0070658_10093397 Ga0070658_100933974 266
502 3300005341 Ga0070691_10002769 Ga0070691_100027698 266
503 3300005347 Ga0070668_100005299 Ga0070668_10000529913 266
504 3300005347 Ga0070668_100011144 Ga0070668_1000111442 266
505 3300005347 Ga0070668_100033288 Ga0070668_1000332884 266
506 3300005353 Ga0070669_100065309 Ga0070669_1000653095 266
507 3300005355 Ga0070671_100212500 Ga0070671_1002125002 266
508 3300005366 Ga0070659_100014839 Ga0070659_1000148399 266
509 3300005367 Ga0070667_100008781 Ga0070667_10000878110 266
510 3300005367 Ga0070667_100017154 Ga0070667_1000171547 266
511 3300005367 Ga0070667_100029432 Ga0070667_1000294325 266
512 3300005458 Ga0070681_10006503 Ga0070681_1000650316 266
513 3300005530 Ga0070679_100034113 Ga0070679_1000341134 266
514 3300005539 Ga0068853_100062079 Ga0068853_1000620795 266
515 3300005539 Ga0068853_100166610 Ga0068853_1001666104 266
516 3300005548 Ga0070665_100000689 Ga0070665_10000068945 266
517 3300005548 Ga0070665_100112614 Ga0070665_1001126144 266
518 3300005563 Ga0068855_100029641 Ga0068855_1000296419 266
519 3300005564 Ga0070664_100051493 Ga0070664_1000514931 266
520 3300005617 Ga0068859_100000111 Ga0068859_10000011136 266
521 3300005617 Ga0068859_100017207 Ga0068859_1000172076 266
522 3300005618 Ga0068864_100000304 Ga0068864_10000030421 266
523 3300005618 Ga0068864_100357201 Ga0068864_1003572012 266
524 3300005719 Ga0068861_100216290 Ga0068861_1002162902 266
525 3300005841 Ga0068863_100000076 Ga0068863_10000007645 266
526 3300005841 Ga0068863_100005065 Ga0068863_10000506510 266
527 3300005842 Ga0068858_100000079 Ga0068858_10000007969 266
528 3300005842 Ga0068858_100000500 Ga0068858_10000050038 266
529 3300005843 Ga0068860_100005396 Ga0068860_10000539616 266
530 3300005844 Ga0068862_100009983 Ga0068862_1000099838 266
531 3300005844 Ga0068862_100102330 Ga0068862_1001023304 266
532 3300006042 Ga0075368_10000230 Ga0075368_1000023016 266
533 3300006048 Ga0075363_100013053 Ga0075363_1000130537 266
534 3300006051 Ga0075364_10004820 Ga0075364_1000482010 266
535 3300006178 Ga0075367_10000291 Ga0075367_1000029122 266
536 3300006195 Ga0075366_10007206 Ga0075366_100072066 266
537 3300006195 Ga0075366_10307884 Ga0075366_103078841 266
538 3300006353 Ga0075370_10069294 Ga0075370_100692943 266
539 3300006353 Ga0075370_10154055 Ga0075370_101540553 266
540 3300006881 Ga0068865_100002622 Ga0068865_1000026225 266
541 3300006931 Ga0097620_100000111 Ga0097620_10000011136 266
542 3300006931 Ga0097620_100017207 Ga0097620_1000172076 266
543 3300006946 Ga0079104_1006367 Ga0079104_10063673 266
544 3300009177 Ga0105248_10005373 Ga0105248_1000537318 266
545 3300009551 Ga0105238_10002209 Ga0105238_1000220910 266
546 3300013100 Ga0157373_10001054 Ga0157373_1000105427 266
547 3300013100 Ga0157373_10002934 Ga0157373_1000293410 266
548 3300013306 Ga0163162_10206060 Ga0163162_102060603 266
549 3300020070 Ga0206356_10431916 Ga0206356_104319163 266
550 3300025263 Ga0209565_1000192 Ga0209565_100019247 266
551 3300025273 Ga0209673_1001547 Ga0209673_100154713 266
552 3300025292 Ga0209676_1000308 Ga0209676_100030856 266
553 3300025295 Ga0209564_1001722 Ga0209564_100172218 266
554 3300025295 Ga0209564_1033076 Ga0209564_10330761 266
555 3300025297 Ga0209758_1001124 Ga0209758_100112411 266
556 3300025297 Ga0209758_1002337 Ga0209758_100233713 266
557 3300025298 Ga0209050_1000466 Ga0209050_100046644 266
558 3300025298 Ga0209050_1015944 Ga0209050_10159442 266
559 3300025299 Ga0209256_1000810 Ga0209256_100081016 266
560 3300025299 Ga0209256_1004878 Ga0209256_10048789 266
561 3300025299 Ga0209256_1053536 Ga0209256_10535361 266
562 3300025303 Ga0209051_1001718 Ga0209051_100171815 266
563 3300025304 Ga0209257_1000554 Ga0209257_100055436 266
564 3300025304 Ga0209257_1005664 Ga0209257_10056649 266
565 3300025909 Ga0207705_10191783 Ga0207705_101917833 266
566 3300025912 Ga0207707_10031921 Ga0207707_100319217 266
567 3300025913 Ga0207695_10002208 Ga0207695_1000220828 266
568 3300025921 Ga0207652_10008581 Ga0207652_100085816 266
569 3300025923 Ga0207681_10026142 Ga0207681_100261426 266
570 3300025924 Ga0207694_10061569 Ga0207694_100615695 266
571 3300025924 Ga0207694_10351773 Ga0207694_103517732 266
572 3300025925 Ga0207650_10220019 Ga0207650_102200191 266
573 3300025931 Ga0207644_10040659 Ga0207644_100406593 266
574 3300025932 Ga0207690_10008980 Ga0207690_100089803 266
575 3300025938 Ga0207704_10038218 Ga0207704_100382184 266
576 3300025941 Ga0207711_10000998 Ga0207711_100009986 266
577 3300025941 Ga0207711_10004868 Ga0207711_1000486812 266
578 3300025941 Ga0207711_10017546 Ga0207711_100175463 266
579 3300025942 Ga0207689_10246808 Ga0207689_102468082 266
580 3300025945 Ga0207679_10042321 Ga0207679_100423211 266
581 3300025949 Ga0207667_10037950 Ga0207667_100379507 266
582 3300025961 Ga0207712_10468830 Ga0207712_104688301 266
583 3300025972 Ga0207668_10000042 Ga0207668_1000004266 266
584 3300025972 Ga0207668_10025841 Ga0207668_100258418 266
585 3300025972 Ga0207668_10028006 Ga0207668_100280063 266
586 3300025986 Ga0207658_10001987 Ga0207658_1000198710 266
587 3300025986 Ga0207658_10005993 Ga0207658_100059934 266
588 3300026035 Ga0207703_10000051 Ga0207703_1000005147 266
589 3300026035 Ga0207703_10004794 Ga0207703_100047943 266
590 3300026041 Ga0207639_10056227 Ga0207639_100562275 266
591 3300026041 Ga0207639_10181729 Ga0207639_101817293 266
592 3300026088 Ga0207641_10000003 Ga0207641_1000000356 266
593 3300026088 Ga0207641_10006181 Ga0207641_100061817 266
594 3300026088 Ga0207641_10021767 Ga0207641_100217673 266
595 3300026095 Ga0207676_10001439 Ga0207676_1000143912 266
596 3300026118 Ga0207675_100013589 Ga0207675_10001358910 266
597 3300027866 Ga0209813_10000758 Ga0209813_100007588 266
598 3300028379 Ga0268266_10000705 Ga0268266_100007059 266
599 3300028379 Ga0268266_10082767 Ga0268266_100827674 266
600 3300028380 Ga0268265_10158000 Ga0268265_101580003 266
601 3300028381 Ga0268264_10009334 Ga0268264_100093349 266
602 3300028381 Ga0268264_10018682 Ga0268264_100186828 266
603 3300028786 Ga0307517_10045813 Ga0307517_100458134 266
604 3300028786 Ga0307517_10071774 Ga0307517_100717744 266
605 3300028794 Ga0307515_10024830 Ga0307515_1002483011 266
606 3300031456 Ga0307513_10000816 Ga0307513_1000081614 266
607 3300031456 Ga0307513_10523364 Ga0307513_105233641 266
608 3300033180 Ga0307510_10003236 Ga0307510_100032366 266
609 3300035089 Ga0373944_0034569 Ga0373944_0034569_574_1377 266
610 3300035695 Ga0373927_0000257 Ga0373927_0000257_39131_39934 266
611 3300037068 Ga0373925_0000083 Ga0373925_0000083_47695_48498 266
612 3300037312 Ga0395899_0000052 Ga0395899_0000052_6200_7003 266
613 3300037418 Ga0395900_0001389 Ga0395900_0001389_20646_21449 266
614 3300037466 Ga0395898_0022674 Ga0395898_0022674_4119_4922 266
615 3300037471 Ga0395905_0021064 Ga0395905_0021064_2681_3484 266
616 3300038443 Ga0395901_0000013 Ga0395901_0000013_7550_8353 266
617 3300042001 Ga0439441_020064 Ga0439441_020064_169_969 266
618 3300042004 Ga0439445_0016274 Ga0439445_0016274_32_832 266
619 3300042156 Ga0439446_0012140 Ga0439446_0012140_1504_2304 266
620 3300042436 Ga0439435_0006295 Ga0439435_0006295_321_1121 266
621 3300042438 Ga0439459_0011453 Ga0439459_0011453_381_1181 266
622 3300044901 Ga0466960_0247039 Ga0466960_0247039_29_874 266
623 3300046453 Ga0495627_001730 Ga0495627_001730_4661_5461 266
624 3300046457 Ga0495590_0001060 Ga0495590_0001060_9787_10587 266
625 3300046460 Ga0495638_0001447 Ga0495638_0001447_3830_4630 266
626 3300046460 Ga0495638_0012370 Ga0495638_0012370_2484_3284 266
627 3300046460 Ga0495638_0013285 Ga0495638_0013285_1042_1842 266
628 3300046460 Ga0495638_0013631 Ga0495638_0013631_939_1739 266
629 3300046471 Ga0495650_0000262 Ga0495650_0000262_69830_70630 266
630 3300046506 Ga0495583_0000003 Ga0495583_0000003_684148_684948 266
631 3300046507 Ga0495606_0026562 Ga0495606_0026562_2977_3777 266
632 3300046512 Ga0495610_0000524 Ga0495610_0000524_15400_16200 266
633 3300046512 Ga0495610_0004078 Ga0495610_0004078_7207_8007 266
634 3300046513 Ga0495616_0000016 Ga0495616_0000016_149050_149850 266
635 3300046515 Ga0495620_0065107 Ga0495620_0065107_539_1339 266
636 3300046515 Ga0495620_0076413 Ga0495620_0076413_24_824 266
637 3300046519 Ga0495632_0005537 Ga0495632_0005537_1327_2127 266
638 3300046520 Ga0495637_0008449 Ga0495637_0008449_1647_2447 266
639 3300046520 Ga0495637_0012197 Ga0495637_0012197_743_1543 266
640 3300046522 Ga0495643_0040463 Ga0495643_0040463_1022_1822 266
641 3300046524 Ga0495648_0000191 Ga0495648_0000191_53577_54380 266
642 3300046530 Ga0495654_0000039 Ga0495654_0000039_176823_177623 266
643 3300046530 Ga0495654_0055861 Ga0495654_0055861_771_1571 266
644 3300046542 Ga0495597_0087967 Ga0495597_0087967_401_1204 266
645 3300046543 Ga0495645_0012405 Ga0495645_0012405_447_1250 266
646 3300046616 Ga0495668_0000196 Ga0495668_0000196_46460_47263 266
647 3300046616 Ga0495668_0001487 Ga0495668_0001487_13896_14696 266
648 3300046616 Ga0495668_0005577 Ga0495668_0005577_6508_7311 266
649 3300046616 Ga0495668_0005918 Ga0495668_0005918_1258_2058 266
650 3300046660 Ga0495625_0000034 Ga0495625_0000034_37439_38239 266
651 3300046660 Ga0495625_0003282 Ga0495625_0003282_4659_5459 266
652 3300046660 Ga0495625_0024259 Ga0495625_0024259_42_842 266
653 3300046660 Ga0495625_0024485 Ga0495625_0024485_42_842 266
654 3300046660 Ga0495625_0040638 Ga0495625_0040638_443_1243 266
655 3300046691 Ga0495670_0023533 Ga0495670_0023533_801_1601 266
656 3300046692 Ga0495671_0136725 Ga0495671_0136725_27_827 266
657 3300046794 Ga0495589_0005947 Ga0495589_0005947_1346_2146 266
658 3300046810 Ga0495660_0015047 Ga0495660_0015047_680_1480 266
659 3300046810 Ga0495660_0026931 Ga0495660_0026931_1361_2161 266
660 3300046810 Ga0495660_0138168 Ga0495660_0138168_204_1004 266
661 3300047320 Ga0495672_0004263 Ga0495672_0004263_10895_11695 266
662 3300047323 Ga0495683_0066750 Ga0495683_0066750_136_936 266
663 3300047446 Ga0495679_001640 Ga0495679_001640_1975_2775 266
664 3300047469 Ga0495673_0000312 Ga0495673_0000312_54838_55638 266
665 3300047469 Ga0495673_0001133 Ga0495673_0001133_7577_8380 266
666 3300047469 Ga0495673_0002400 Ga0495673_0002400_11110_11910 266
667 3300047472 Ga0495686_0003171 Ga0495686_0003171_6246_7046 266
668 3300047472 Ga0495686_0010311 Ga0495686_0010311_5333_6133 266
669 3300047472 Ga0495686_0011050 Ga0495686_0011050_2687_3487 266
670 3300047472 Ga0495686_0051221 Ga0495686_0051221_36_836 266
671 3300048909 Ga0496106_0003130 Ga0496106_0003130_9048_9848 266
672 3300048910 Ga0496107_0002780 Ga0496107_0002780_4711_5511 266
673 3300048918 Ga0496115_0000050 Ga0496115_0000050_9448_10251 266
674 3300048918 Ga0496115_0001099 Ga0496115_0001099_3441_4241 266
675 3300048919 Ga0496116_0130351 Ga0496116_0130351_20_823 266
676 3300048920 Ga0496117_0042362 Ga0496117_0042362_2237_3040 266
677 3300048921 Ga0496118_0015436 Ga0496118_0015436_3731_4534 266
678 3300048922 Ga0496119_0013623 Ga0496119_0013623_5122_5925 266
679 3300048924 Ga0496121_0000334 Ga0496121_0000334_24736_25539 266
680 3300048924 Ga0496121_0002729 Ga0496121_0002729_4045_4845 266
681 3300050491 nmdc:mga00v17_1793_c1 nmdc:mga00v17_1793_c1_4183_4986 266
682 3300050493 nmdc:mga0k408_31131_c1 nmdc:mga0k408_31131_c1_1896_2699 266
683 3300050494 nmdc:mga06z11_1075_c1 nmdc:mga06z11_1075_c1_3541_4344 266
684 3300050495 nmdc:mga04h51_752_c1 nmdc:mga04h51_752_c1_5051_5854 266
685 3300053086 Ga0500578_0125032 Ga0500578_0125032_10_810 266
686 3300053087 Ga0500643_012764 Ga0500643_012764_1838_2641 266
687 3300053088 Ga0500644_0000058 Ga0500644_0000058_7315_8118 266
688 3300053102 Ga0500554_001570 Ga0500554_001570_787_1587 266
689 3300053103 Ga0500555_001857 Ga0500555_001857_5066_5902 266
690 3300053104 Ga0500556_0000893 Ga0500556_0000893_11159_11959 266
691 3300053104 Ga0500556_0156986 Ga0500556_0156986_79_882 266
692 3300053122 Ga0500608_001504 Ga0500608_001504_7404_8207 266
693 3300053125 Ga0500618_000014 Ga0500618_000014_7410_8210 266
694 3300053134 Ga0500658_0068421 Ga0500658_0068421_147_947 266
695 3300053136 Ga0500559_0000467 Ga0500559_0000467_23293_24093 266
696 3300053136 Ga0500559_0002837 Ga0500559_0002837_5843_6643 266
697 3300053136 Ga0500559_0187255 Ga0500559_0187255_79_882 266
698 3300053138 Ga0500564_000229 Ga0500564_000229_7303_8106 266
699 3300053142 Ga0500577_0000828 Ga0500577_0000828_4671_5471 266
700 3300053153 Ga0500616_0007680 Ga0500616_0007680_4414_5214 266
701 3300053158 Ga0500627_0010107 Ga0500627_0010107_2453_3253 266
702 3300053730 Ga0500645_003294 Ga0500645_003294_2350_3150 266
703 3300053731 Ga0500609_000324 Ga0500609_000324_1698_2498 266
704 3300059628 Ga0587122_009570 Ga0587122_009570_25_828 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22029

PhyR_sigma2

Sigma2 domain of PhyR

54

108

0.99

PF22233

PhyR_sigma-like

Response regulator PhyR, sigma-like domain

134

183

0.97

PF00072

Response_reg

Response regulator receiver domain

188

297

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o8x-assembly1.cif.gz_A "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.987 86 135
2o8x-assembly1.cif.gz_B "crystal structure of the ""-35 element"" promoter recognition domain of mycobacterium tuberculosis sigc" 0.982 86 135
3vep-assembly4.cif.gz_H crystal structure of sigd4 in complex with its negative regulator rsda 0.9687 85 139
2h27-assembly2.cif.gz_D crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna 0.9686 87 138
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9638 86 139
ID Description Score Start End Superfamily
3t0yA01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9901 1 64 1.10.1740.10
2o8xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.987 86 135 1.10.10.10
2o8xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.982 86 135 1.10.10.10
4cxfA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.978 85 139 1.10.10.10
af_P0AGB6_121_191_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9741 87 136 1.10.10.10
ID Description Score Start End GO Terms
AF-Q98FM8-F1-model_v4 Sensory transduction regulatory protein 0.9867 140 257 GO:0000160
AF-A0A528PI55-F1-model_v4 deleted 0.9836 140 244
AF-A0A530R2W7-F1-model_v4 Response regulator 0.9826 160 257 GO:0000160
AF-A0A4Q3GZW4-F1-model_v4 Response regulator 0.9662 140 257 GO:0000160
AF-A0A3D6A0W2-F1-model_v4 deleted 0.9643 146 263

Feature Viewer

pLDDT pTM Quality
83.55 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map