F476344
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 441 | 659 | 383 |
Family's Representative Sequence
| Representative Sequence | 3300006177|Ga0075362_10058785|Ga0075362_100587852 |
| Length | 430 |
| Sequence | VGRASMRRASKVAEIRGGFCVKGLAMPQAPRGHPPRTDDISHPSPKEPQMALDPDTFNLLRDTVTRFVNERLISREDEVSETNTIPADVVEEMQSLGLFGLSIPEEFGGLXLSMEEEARIVFELGRASPAFRSVAGTNIGIGSQSIVIAGTDQQKAKYLPRLASGELIGSFALTEPDTGSDAMSIRATARKMGDHYVLNGTKRYITNAPSAGLFTVMARTAQERKADSISCFLVPADTPGITVGKPDKKMGQRGALTSDVIFEDCKVPTSALLGETEGNGFRTSMKVLDKGRLHIAALCVGIADRLIDEAVKYARERKQFGQPIGQFQLVQAMLADSEAEAYAAKCMVIDASRRRDRGEIPTRQAACAKMFASEMVGRVADRAVQIFGGAGYMSEYPVERFYRDVRLFRIFEGTTQIQQLVIARDLLKAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 5 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 6 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 7 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 8 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 9 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 10 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 11 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 12 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 13 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 14 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 15 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 16 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 17 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 18 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 19 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 20 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 21 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 22 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 23 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 24 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 25 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 26 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 27 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 28 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 29 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 30 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 31 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 32 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 33 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 34 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 35 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 36 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 37 | 2941479691 | |||
| 38 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 39 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 40 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 41 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 42 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 43 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 44 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 45 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 46 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 47 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 48 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 49 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 50 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 51 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 52 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 56 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 58 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 68 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 108 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 122 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 146 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 149 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 150 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 161 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 223 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 231 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 232 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 233 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 240 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 241 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 242 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 246 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 247 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 248 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 249 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 250 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 251 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 252 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 260 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 261 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 263 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 264 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 265 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 266 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 267 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 268 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 269 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 270 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 273 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 274 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 275 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 276 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 278 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 279 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 280 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 281 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 282 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 283 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 284 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 285 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 286 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 287 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 288 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 289 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 290 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 349 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 350 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 363 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 381 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 383 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 384 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 391 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 399 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 400 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 401 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 402 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 403 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 404 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 407 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 408 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 409 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 410 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 411 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 412 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 413 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 414 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 415 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 416 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 418 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 419 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 420 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 421 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 422 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 423 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 425 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 426 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 427 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 428 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 429 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 431 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 432 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 433 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 434 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 435 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 436 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 437 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 439 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 440 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 441 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.9 |
| Metatranscriptomes | 0.71 |
| Isolates | 6.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.03 |
| Nodule | 2.27 |
| Rhizoplane | 4.12 |
| Rhizosphere | 61.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000448 | 3300001915 | Bacteria | 12506 |
| 2 | JGI24740J21852_10000149 | 3300001979 | Bacteria | 27167 |
| 3 | JGI24740J21852_10000159 | 3300001979 | Bacteria | 26704 |
| 4 | JGI25156J39149_1007314 | 3300002705 | Bacteria | 2916 |
| 5 | JGI25154J39366_1001599 | 3300002738 | Bacteria | 7719 |
| 6 | JGI25151J46595_10000228 | 3300003187 | Bacteria | 66484 |
| 7 | JGI25151J46595_10001462 | 3300003187 | Bacteria | 16012 |
| 8 | Ga0055539_1000086 | 3300003752 | Bacteria | 117621 |
| 9 | Ga0055533_1001557 | 3300003756 | Bacteria | 5972 |
| 10 | Ga0055532_1000041 | 3300003758 | Bacteria | 195749 |
| 11 | Ga0055535_1000030 | 3300003761 | Bacteria | 195749 |
| 12 | Ga0055542_1000818 | 3300003762 | Bacteria | 22571 |
| 13 | Ga0055529_1000058 | 3300003763 | Bacteria | 195735 |
| 14 | Ga0055526_1011710 | 3300003771 | Bacteria | 3915 |
| 15 | Ga0055524_1001952 | 3300003775 | Bacteria | 11083 |
| 16 | Ga0055536_1000114 | 3300003781 | Bacteria | 70007 |
| 17 | Ga0055534_1003641 | 3300003784 | Bacteria | 4775 |
| 18 | Ga0055530_10000579 | 3300003791 | Bacteria | 31675 |
| 19 | Ga0055541_1001902 | 3300003841 | Bacteria | 4332 |
| 20 | Ga0065704_10009005 | 3300005289 | Bacteria | 2001 |
| 21 | Ga0065704_10079565 | 3300005289 | Bacteria | 4130 |
| 22 | Ga0070658_10004072 | 3300005327 | Bacteria | 11984 |
| 23 | Ga0070658_10132353 | 3300005327 | Bacteria | 2079 |
| 24 | Ga0070683_100002003 | 3300005329 | Bacteria | 15985 |
| 25 | Ga0070683_100164059 | 3300005329 | Bacteria | 2108 |
| 26 | Ga0070670_100000981 | 3300005331 | Bacteria | 22370 |
| 27 | Ga0070670_100026142 | 3300005331 | Bacteria | 5025 |
| 28 | Ga0070670_100126234 | 3300005331 | Bacteria | 2208 |
| 29 | Ga0070677_10000559 | 3300005333 | Bacteria | 12697 |
| 30 | Ga0070666_10191773 | 3300005335 | Bacteria | 1436 |
| 31 | Ga0070680_100000727 | 3300005336 | Bacteria | 22930 |
| 32 | Ga0068868_100000036 | 3300005338 | Bacteria | 74490 |
| 33 | Ga0070660_100000347 | 3300005339 | Bacteria | 30909 |
| 34 | Ga0070661_100000001 | 3300005344 | Bacteria | 424830 |
| 35 | Ga0070661_100000072 | 3300005344 | Bacteria | 82584 |
| 36 | Ga0070692_10000276 | 3300005345 | Bacteria | 14447 |
| 37 | Ga0070668_100000013 | 3300005347 | Bacteria | 117451 |
| 38 | Ga0070668_100002822 | 3300005347 | Bacteria | 12787 |
| 39 | Ga0070669_100006287 | 3300005353 | Bacteria | 8563 |
| 40 | Ga0070669_100019626 | 3300005353 | Bacteria | 4828 |
| 41 | Ga0070669_100106120 | 3300005353 | Bacteria | 2126 |
| 42 | Ga0070675_100028436 | 3300005354 | Bacteria | 4500 |
| 43 | Ga0070671_100000225 | 3300005355 | Bacteria | 37597 |
| 44 | Ga0070671_100038951 | 3300005355 | Bacteria | 3945 |
| 45 | Ga0070674_100061329 | 3300005356 | Bacteria | 2624 |
| 46 | Ga0070673_100046037 | 3300005364 | Bacteria | 3386 |
| 47 | Ga0070659_100000034 | 3300005366 | Bacteria | 115416 |
| 48 | Ga0070667_100000328 | 3300005367 | Bacteria | 52935 |
| 49 | Ga0070667_100000413 | 3300005367 | Bacteria | 45721 |
| 50 | Ga0070667_100000889 | 3300005367 | Bacteria | 27637 |
| 51 | Ga0070714_100001638 | 3300005435 | Bacteria | 16290 |
| 52 | Ga0070714_100109168 | 3300005435 | Bacteria | 2447 |
| 53 | Ga0070714_100131545 | 3300005435 | Bacteria | 2237 |
| 54 | Ga0070713_100003580 | 3300005436 | Bacteria | 10265 |
| 55 | Ga0070713_100093464 | 3300005436 | Bacteria | 2591 |
| 56 | Ga0070663_100000015 | 3300005455 | Bacteria | 131905 |
| 57 | Ga0070678_100227437 | 3300005456 | Bacteria | 1553 |
| 58 | Ga0070678_100258433 | 3300005456 | Bacteria | 1463 |
| 59 | Ga0070681_10014042 | 3300005458 | Bacteria | 7971 |
| 60 | Ga0070685_10000593 | 3300005466 | Bacteria | 20043 |
| 61 | Ga0070706_100001450 | 3300005467 | Bacteria | 24950 |
| 62 | Ga0070706_100168273 | 3300005467 | Bacteria | 2046 |
| 63 | Ga0070707_100021081 | 3300005468 | Bacteria | 6155 |
| 64 | Ga0070698_100139653 | 3300005471 | Bacteria | 2375 |
| 65 | Ga0070679_100000003 | 3300005530 | Bacteria | 307836 |
| 66 | Ga0070679_100241703 | 3300005530 | Bacteria | 1763 |
| 67 | Ga0070684_100000748 | 3300005535 | Bacteria | 22485 |
| 68 | Ga0070684_100032929 | 3300005535 | Bacteria | 4422 |
| 69 | Ga0070684_100046047 | 3300005535 | Bacteria | 3779 |
| 70 | Ga0070684_100183359 | 3300005535 | Bacteria | 1903 |
| 71 | Ga0068853_100018340 | 3300005539 | Bacteria | 5791 |
| 72 | Ga0068853_100124373 | 3300005539 | Bacteria | 2303 |
| 73 | Ga0070672_100198775 | 3300005543 | Bacteria | 1676 |
| 74 | Ga0070686_100000140 | 3300005544 | Bacteria | 49544 |
| 75 | Ga0070665_100000105 | 3300005548 | Bacteria | 157734 |
| 76 | Ga0070665_100000232 | 3300005548 | Bacteria | 92207 |
| 77 | Ga0070665_100024985 | 3300005548 | Bacteria | 6023 |
| 78 | Ga0070665_100146602 | 3300005548 | Bacteria | 2363 |
| 79 | Ga0070664_100000058 | 3300005564 | Bacteria | 67966 |
| 80 | Ga0070664_100015104 | 3300005564 | Bacteria | 6306 |
| 81 | Ga0068857_100000132 | 3300005577 | Bacteria | 45188 |
| 82 | Ga0068857_100029386 | 3300005577 | Bacteria | 4850 |
| 83 | Ga0068854_100000025 | 3300005578 | Bacteria | 123547 |
| 84 | Ga0068856_100000084 | 3300005614 | Bacteria | 87749 |
| 85 | Ga0068856_100002961 | 3300005614 | Bacteria | 17414 |
| 86 | Ga0068856_100214593 | 3300005614 | Bacteria | 1940 |
| 87 | Ga0068859_100002459 | 3300005617 | Bacteria | 18856 |
| 88 | Ga0068859_100013326 | 3300005617 | Bacteria | 8248 |
| 89 | Ga0068859_100143598 | 3300005617 | Bacteria | 2460 |
| 90 | Ga0068864_100001706 | 3300005618 | Bacteria | 18043 |
| 91 | Ga0068864_100001781 | 3300005618 | Bacteria | 17686 |
| 92 | Ga0068864_100017608 | 3300005618 | Bacteria | 5956 |
| 93 | Ga0068861_100015250 | 3300005719 | Bacteria | 5411 |
| 94 | Ga0068863_100000293 | 3300005841 | Bacteria | 51737 |
| 95 | Ga0068863_100000466 | 3300005841 | Bacteria | 41328 |
| 96 | Ga0068863_100000646 | 3300005841 | Bacteria | 35340 |
| 97 | Ga0068863_100004472 | 3300005841 | Bacteria | 13781 |
| 98 | Ga0068863_100012390 | 3300005841 | Bacteria | 8233 |
| 99 | Ga0068863_100016521 | 3300005841 | Bacteria | 7080 |
| 100 | Ga0068863_100054023 | 3300005841 | Bacteria | 3807 |
| 101 | Ga0068863_100059233 | 3300005841 | Bacteria | 3623 |
| 102 | Ga0068858_100000374 | 3300005842 | Bacteria | 46767 |
| 103 | Ga0068858_100001936 | 3300005842 | Bacteria | 21104 |
| 104 | Ga0068858_100174174 | 3300005842 | Bacteria | 2030 |
| 105 | Ga0068860_100000436 | 3300005843 | Bacteria | 52935 |
| 106 | Ga0068860_100000473 | 3300005843 | Bacteria | 49993 |
| 107 | Ga0068860_100000638 | 3300005843 | Bacteria | 41210 |
| 108 | Ga0068860_100011535 | 3300005843 | Bacteria | 8710 |
| 109 | Ga0068860_100145738 | 3300005843 | Bacteria | 2278 |
| 110 | Ga0068862_100001919 | 3300005844 | Bacteria | 18891 |
| 111 | Ga0068862_100230441 | 3300005844 | Bacteria | 1680 |
| 112 | Ga0081455_10001460 | 3300005937 | Bacteria | 29253 |
| 113 | Ga0070717_10002935 | 3300006028 | Bacteria | 12108 |
| 114 | Ga0075365_10018258 | 3300006038 | Bacteria | 4310 |
| 115 | Ga0075368_10004106 | 3300006042 | Bacteria | 4901 |
| 116 | Ga0075363_100055032 | 3300006048 | Bacteria | 2130 |
| 117 | Ga0075364_10209901 | 3300006051 | Bacteria | 1320 |
| 118 | Ga0075432_10004168 | 3300006058 | Bacteria | 4926 |
| 119 | Ga0070712_100123961 | 3300006175 | Bacteria | 1948 |
| 120 | Ga0075362_10012482 | 3300006177 | Bacteria | 3377 |
| 121 | Ga0075362_10058785 | 3300006177 | Bacteria | 1735 |
| 122 | Ga0075367_10050617 | 3300006178 | Bacteria | 2453 |
| 123 | Ga0075369_10096982 | 3300006186 | Bacteria | 1320 |
| 124 | Ga0075366_10001326 | 3300006195 | Bacteria | 12359 |
| 125 | Ga0075366_10142000 | 3300006195 | Bacteria | 1452 |
| 126 | Ga0075370_10000007 | 3300006353 | Bacteria | 104910 |
| 127 | Ga0075370_10030387 | 3300006353 | Bacteria | 3014 |
| 128 | Ga0075370_10040419 | 3300006353 | Bacteria | 2630 |
| 129 | Ga0075429_100001204 | 3300006880 | Bacteria | 20973 |
| 130 | Ga0075436_100051187 | 3300006914 | Bacteria | 2850 |
| 131 | Ga0097620_100013326 | 3300006931 | Bacteria | 8248 |
| 132 | Ga0097620_100143601 | 3300006931 | Bacteria | 2460 |
| 133 | Ga0099826_10000107 | 3300006948 | Bacteria | 38416 |
| 134 | Ga0105244_10035746 | 3300009036 | Bacteria | 2608 |
| 135 | Ga0105240_10143133 | 3300009093 | Bacteria | 2857 |
| 136 | Ga0111539_10006194 | 3300009094 | Bacteria | 15435 |
| 137 | Ga0105245_10014088 | 3300009098 | Bacteria | 6967 |
| 138 | Ga0105245_10087320 | 3300009098 | Bacteria | 2863 |
| 139 | Ga0114129_10399020 | 3300009147 | Bacteria | 1813 |
| 140 | Ga0114129_10454935 | 3300009147 | Bacteria | 1678 |
| 141 | Ga0105243_10023246 | 3300009148 | Bacteria | 4718 |
| 142 | Ga0105242_10047440 | 3300009176 | Bacteria | 3488 |
| 143 | Ga0105242_10062141 | 3300009176 | Bacteria | 3073 |
| 144 | Ga0105242_10133617 | 3300009176 | Bacteria | 2145 |
| 145 | Ga0105248_10003501 | 3300009177 | Bacteria | 17418 |
| 146 | Ga0105248_10019503 | 3300009177 | Bacteria | 7505 |
| 147 | Ga0105248_10153966 | 3300009177 | Bacteria | 2594 |
| 148 | Ga0105238_10014995 | 3300009551 | Bacteria | 7846 |
| 149 | Ga0105238_10039628 | 3300009551 | Bacteria | 4777 |
| 150 | Ga0105238_10245863 | 3300009551 | Bacteria | 1767 |
| 151 | Ga0105249_10026960 | 3300009553 | Bacteria | 5182 |
| 152 | Ga0105249_10257053 | 3300009553 | Bacteria | 1734 |
| 153 | Ga0105246_10083818 | 3300011119 | Bacteria | 2279 |
| 154 | Ga0157373_10008055 | 3300013100 | Bacteria | 7831 |
| 155 | Ga0157371_10000100 | 3300013102 | Bacteria | 131924 |
| 156 | Ga0157371_10003600 | 3300013102 | Bacteria | 13958 |
| 157 | Ga0157370_10000004 | 3300013104 | Bacteria | 366426 |
| 158 | Ga0157369_10002048 | 3300013105 | Bacteria | 24329 |
| 159 | Ga0157369_10034953 | 3300013105 | Bacteria | 5511 |
| 160 | Ga0157374_10151270 | 3300013296 | Bacteria | 2256 |
| 161 | Ga0157372_10000279 | 3300013307 | Bacteria | 56725 |
| 162 | Ga0157372_10037866 | 3300013307 | Bacteria | 5322 |
| 163 | Ga0157372_10133610 | 3300013307 | Bacteria | 2856 |
| 164 | Ga0157375_10108322 | 3300013308 | Bacteria | 2873 |
| 165 | Ga0157375_10172571 | 3300013308 | Bacteria | 2310 |
| 166 | Ga0163163_10007083 | 3300014325 | Bacteria | 9859 |
| 167 | Ga0163163_10012463 | 3300014325 | Bacteria | 7747 |
| 168 | Ga0157380_10028164 | 3300014326 | Bacteria | 4280 |
| 169 | Ga0157380_10195109 | 3300014326 | Bacteria | 1791 |
| 170 | Ga0182008_10002889 | 3300014497 | Bacteria | 10629 |
| 171 | Ga0157379_10009393 | 3300014968 | Bacteria | 8522 |
| 172 | Ga0157376_10337921 | 3300014969 | Bacteria | 1437 |
| 173 | Ga0182006_1000214 | 3300015261 | Bacteria | 56285 |
| 174 | Ga0182006_1001983 | 3300015261 | Bacteria | 11554 |
| 175 | Ga0163161_10109611 | 3300017792 | Bacteria | 2063 |
| 176 | Ga0206356_10774019 | 3300020070 | Bacteria | 1712 |
| 177 | Ga0206355_1007462 | 3300020076 | Bacteria | 1905 |
| 178 | Ga0206353_11669705 | 3300020082 | Bacteria | 2196 |
| 179 | Ga0154015_1588421 | 3300020610 | Bacteria | 15443 |
| 180 | Ga0224712_10035527 | 3300022467 | Bacteria | 1840 |
| 181 | Ga0209784_100029 | 3300025224 | Bacteria | 347315 |
| 182 | Ga0209784_100853 | 3300025224 | Bacteria | 6667 |
| 183 | Ga0209784_101137 | 3300025224 | Bacteria | 4294 |
| 184 | Ga0209566_100030 | 3300025225 | Bacteria | 347329 |
| 185 | Ga0209566_100277 | 3300025225 | Bacteria | 47887 |
| 186 | Ga0209566_101363 | 3300025225 | Bacteria | 7638 |
| 187 | Ga0209674_100081 | 3300025226 | Bacteria | 201146 |
| 188 | Ga0209674_100089 | 3300025226 | Bacteria | 178751 |
| 189 | Ga0209674_100123 | 3300025226 | Bacteria | 131438 |
| 190 | Ga0209674_102250 | 3300025226 | Bacteria | 4276 |
| 191 | Ga0209672_101786 | 3300025228 | Bacteria | 6628 |
| 192 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 193 | Ga0209563_100091 | 3300025230 | Bacteria | 168320 |
| 194 | Ga0209563_100092 | 3300025230 | Bacteria | 167669 |
| 195 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 196 | Ga0209646_1000065 | 3300025246 | Bacteria | 245452 |
| 197 | Ga0209026_1009936 | 3300025250 | Bacteria | 1817 |
| 198 | Ga0209677_100030 | 3300025253 | Bacteria | 347314 |
| 199 | Ga0209148_1000113 | 3300025254 | Bacteria | 195646 |
| 200 | Ga0209148_1008463 | 3300025254 | Bacteria | 2066 |
| 201 | Ga0209759_1001532 | 3300025256 | Bacteria | 12683 |
| 202 | Ga0209759_1005701 | 3300025256 | Bacteria | 4298 |
| 203 | Ga0209565_1000659 | 3300025263 | Bacteria | 22030 |
| 204 | Ga0209455_1000106 | 3300025272 | Bacteria | 195801 |
| 205 | Ga0209675_1000092 | 3300025291 | Bacteria | 144839 |
| 206 | Ga0209675_1000903 | 3300025291 | Bacteria | 18979 |
| 207 | Ga0209675_1002733 | 3300025291 | Bacteria | 8835 |
| 208 | Ga0209676_1000378 | 3300025292 | Bacteria | 82127 |
| 209 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 210 | Ga0209025_1000125 | 3300025294 | Bacteria | 201444 |
| 211 | Ga0209025_1000222 | 3300025294 | Bacteria | 135688 |
| 212 | Ga0209025_1000837 | 3300025294 | Bacteria | 48847 |
| 213 | Ga0209025_1001562 | 3300025294 | Bacteria | 29058 |
| 214 | Ga0209025_1019959 | 3300025294 | Bacteria | 3695 |
| 215 | Ga0209564_1000489 | 3300025295 | Bacteria | 65860 |
| 216 | Ga0209564_1000655 | 3300025295 | Bacteria | 51734 |
| 217 | Ga0209564_1001585 | 3300025295 | Bacteria | 22224 |
| 218 | Ga0209758_1000924 | 3300025297 | Bacteria | 39688 |
| 219 | Ga0209758_1018355 | 3300025297 | Bacteria | 3431 |
| 220 | Ga0209050_1000049 | 3300025298 | Bacteria | 364096 |
| 221 | Ga0209256_1000335 | 3300025299 | Bacteria | 78765 |
| 222 | Ga0209256_1000362 | 3300025299 | Bacteria | 73517 |
| 223 | Ga0209051_1016277 | 3300025303 | Bacteria | 3376 |
| 224 | Ga0209257_1000692 | 3300025304 | Bacteria | 52346 |
| 225 | Ga0209257_1018524 | 3300025304 | Bacteria | 2674 |
| 226 | Ga0207697_10020398 | 3300025315 | Bacteria | 2713 |
| 227 | Ga0207682_10000576 | 3300025893 | Bacteria | 16980 |
| 228 | Ga0207688_10044607 | 3300025901 | Bacteria | 2471 |
| 229 | Ga0207680_10021518 | 3300025903 | Bacteria | 3491 |
| 230 | Ga0207643_10151267 | 3300025908 | Bacteria | 1391 |
| 231 | Ga0207705_10000120 | 3300025909 | Bacteria | 87080 |
| 232 | Ga0207684_10000750 | 3300025910 | Bacteria | 37897 |
| 233 | Ga0207684_10038811 | 3300025910 | Bacteria | 4041 |
| 234 | Ga0207707_10010643 | 3300025912 | Bacteria | 7990 |
| 235 | Ga0207707_10059512 | 3300025912 | Bacteria | 3324 |
| 236 | Ga0207695_10000535 | 3300025913 | Bacteria | 79187 |
| 237 | Ga0207695_10094525 | 3300025913 | Bacteria | 2996 |
| 238 | Ga0207693_10092657 | 3300025915 | Bacteria | 2368 |
| 239 | Ga0207660_10000078 | 3300025917 | Bacteria | 51142 |
| 240 | Ga0207657_10000839 | 3300025919 | Bacteria | 32505 |
| 241 | Ga0207657_10025901 | 3300025919 | Bacteria | 5400 |
| 242 | Ga0207649_10000011 | 3300025920 | Bacteria | 266219 |
| 243 | Ga0207649_10000222 | 3300025920 | Bacteria | 46190 |
| 244 | Ga0207652_10000004 | 3300025921 | Bacteria | 436303 |
| 245 | Ga0207652_10359735 | 3300025921 | Bacteria | 1314 |
| 246 | Ga0207646_10014781 | 3300025922 | Bacteria | 7396 |
| 247 | Ga0207646_10085402 | 3300025922 | Bacteria | 2824 |
| 248 | Ga0207681_10006820 | 3300025923 | Bacteria | 7003 |
| 249 | Ga0207681_10115709 | 3300025923 | Bacteria | 1958 |
| 250 | Ga0207694_10052642 | 3300025924 | Bacteria | 3155 |
| 251 | Ga0207694_10159781 | 3300025924 | Bacteria | 1819 |
| 252 | Ga0207650_10059019 | 3300025925 | Bacteria | 2858 |
| 253 | Ga0207687_10013831 | 3300025927 | Bacteria | 5271 |
| 254 | Ga0207687_10037929 | 3300025927 | Bacteria | 3291 |
| 255 | Ga0207700_10003514 | 3300025928 | Bacteria | 9129 |
| 256 | Ga0207700_10009309 | 3300025928 | Bacteria | 6130 |
| 257 | Ga0207664_10003232 | 3300025929 | Bacteria | 10827 |
| 258 | Ga0207664_10007189 | 3300025929 | Bacteria | 7713 |
| 259 | Ga0207644_10000398 | 3300025931 | Bacteria | 28322 |
| 260 | Ga0207690_10000005 | 3300025932 | Bacteria | 581199 |
| 261 | Ga0207686_10009583 | 3300025934 | Bacteria | 5256 |
| 262 | Ga0207709_10083363 | 3300025935 | Bacteria | 2067 |
| 263 | Ga0207691_10043621 | 3300025940 | Bacteria | 4132 |
| 264 | Ga0207711_10000552 | 3300025941 | Bacteria | 38214 |
| 265 | Ga0207711_10001339 | 3300025941 | Bacteria | 23287 |
| 266 | Ga0207711_10007657 | 3300025941 | Bacteria | 9032 |
| 267 | Ga0207711_10276342 | 3300025941 | Bacteria | 1546 |
| 268 | Ga0207661_10000743 | 3300025944 | Bacteria | 21120 |
| 269 | Ga0207661_10047497 | 3300025944 | Bacteria | 3409 |
| 270 | Ga0207661_10053941 | 3300025944 | Bacteria | 3219 |
| 271 | Ga0207679_10000038 | 3300025945 | Bacteria | 131935 |
| 272 | Ga0207679_10011528 | 3300025945 | Bacteria | 5730 |
| 273 | Ga0207679_10093210 | 3300025945 | Bacteria | 2335 |
| 274 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 275 | Ga0207651_10126486 | 3300025960 | Bacteria | 1948 |
| 276 | Ga0207712_10124398 | 3300025961 | Bacteria | 1956 |
| 277 | Ga0207668_10000022 | 3300025972 | Bacteria | 135782 |
| 278 | Ga0207668_10000132 | 3300025972 | Bacteria | 53005 |
| 279 | Ga0207640_10000096 | 3300025981 | Bacteria | 68105 |
| 280 | Ga0207658_10000021 | 3300025986 | Bacteria | 201456 |
| 281 | Ga0207658_10000269 | 3300025986 | Bacteria | 54732 |
| 282 | Ga0207658_10000646 | 3300025986 | Bacteria | 30565 |
| 283 | Ga0207658_10024951 | 3300025986 | Bacteria | 4183 |
| 284 | Ga0207658_10129407 | 3300025986 | Bacteria | 2026 |
| 285 | Ga0207677_10000044 | 3300026023 | Bacteria | 107614 |
| 286 | Ga0207677_10187761 | 3300026023 | Bacteria | 1632 |
| 287 | Ga0207703_10000309 | 3300026035 | Bacteria | 52974 |
| 288 | Ga0207703_10009731 | 3300026035 | Bacteria | 7544 |
| 289 | Ga0207703_10022814 | 3300026035 | Bacteria | 4916 |
| 290 | Ga0207639_10007774 | 3300026041 | Bacteria | 7325 |
| 291 | Ga0207678_10000021 | 3300026067 | Bacteria | 131877 |
| 292 | Ga0207678_10140873 | 3300026067 | Bacteria | 2058 |
| 293 | Ga0207702_10000203 | 3300026078 | Bacteria | 70226 |
| 294 | Ga0207702_10293593 | 3300026078 | Bacteria | 1541 |
| 295 | Ga0207641_10000040 | 3300026088 | Bacteria | 192446 |
| 296 | Ga0207641_10000098 | 3300026088 | Bacteria | 123514 |
| 297 | Ga0207641_10000303 | 3300026088 | Bacteria | 61340 |
| 298 | Ga0207641_10003348 | 3300026088 | Bacteria | 14247 |
| 299 | Ga0207641_10004850 | 3300026088 | Bacteria | 11580 |
| 300 | Ga0207641_10046616 | 3300026088 | Bacteria | 3654 |
| 301 | Ga0207676_10000538 | 3300026095 | Bacteria | 31682 |
| 302 | Ga0207676_10001168 | 3300026095 | Bacteria | 19769 |
| 303 | Ga0207676_10204598 | 3300026095 | Bacteria | 1747 |
| 304 | Ga0207674_10000875 | 3300026116 | Bacteria | 39434 |
| 305 | Ga0207674_10010466 | 3300026116 | Bacteria | 10502 |
| 306 | Ga0207675_100040137 | 3300026118 | Bacteria | 4369 |
| 307 | Ga0207683_10019848 | 3300026121 | Bacteria | 5742 |
| 308 | Ga0207683_10207938 | 3300026121 | Bacteria | 1780 |
| 309 | Ga0207698_10137939 | 3300026142 | Bacteria | 2096 |
| 310 | Ga0209970_1000216 | 3300027614 | Bacteria | 9245 |
| 311 | Ga0209282_1000164 | 3300027666 | Bacteria | 38002 |
| 312 | Ga0209813_10000538 | 3300027866 | Bacteria | 8948 |
| 313 | Ga0209974_10008422 | 3300027876 | Bacteria | 3525 |
| 314 | Ga0207428_10000092 | 3300027907 | Bacteria | 123897 |
| 315 | Ga0207428_10025530 | 3300027907 | Bacteria | 4946 |
| 316 | Ga0268266_10000055 | 3300028379 | Bacteria | 291630 |
| 317 | Ga0268266_10003472 | 3300028379 | Bacteria | 15722 |
| 318 | Ga0268266_10016499 | 3300028379 | Bacteria | 6313 |
| 319 | Ga0268266_10317852 | 3300028379 | Bacteria | 1456 |
| 320 | Ga0268265_10000536 | 3300028380 | Bacteria | 38704 |
| 321 | Ga0268265_10001938 | 3300028380 | Bacteria | 16418 |
| 322 | Ga0268264_10000224 | 3300028381 | Bacteria | 110355 |
| 323 | Ga0268264_10000448 | 3300028381 | Bacteria | 56330 |
| 324 | Ga0268264_10000670 | 3300028381 | Bacteria | 40140 |
| 325 | Ga0268264_10008180 | 3300028381 | Bacteria | 8683 |
| 326 | Ga0265337_1009722 | 3300028556 | Bacteria | 3417 |
| 327 | Ga0307517_10000160 | 3300028786 | Bacteria | 108370 |
| 328 | Ga0307515_10083866 | 3300028794 | Bacteria | 4102 |
| 329 | Ga0307512_10028196 | 3300030522 | Bacteria | 4927 |
| 330 | Ga0265332_10000023 | 3300031238 | Bacteria | 211994 |
| 331 | Ga0265320_10001604 | 3300031240 | Bacteria | 16231 |
| 332 | Ga0307513_10000012 | 3300031456 | Bacteria | 328865 |
| 333 | Ga0307513_10015291 | 3300031456 | Bacteria | 9308 |
| 334 | Ga0307513_10132955 | 3300031456 | Bacteria | 2429 |
| 335 | Ga0307509_10000317 | 3300031507 | Bacteria | 79032 |
| 336 | Ga0307408_100184728 | 3300031548 | Bacteria | 1675 |
| 337 | Ga0307508_10000332 | 3300031616 | Bacteria | 57039 |
| 338 | Ga0307508_10007527 | 3300031616 | Bacteria | 10124 |
| 339 | Ga0307508_10007605 | 3300031616 | Bacteria | 10070 |
| 340 | Ga0316575_10004304 | 3300031665 | Bacteria | 5003 |
| 341 | Ga0316579_10003150 | 3300031691 | Bacteria | 6377 |
| 342 | Ga0265314_10004285 | 3300031711 | Bacteria | 13328 |
| 343 | Ga0265314_10017039 | 3300031711 | Bacteria | 5713 |
| 344 | Ga0316578_10004181 | 3300031728 | Bacteria | 6767 |
| 345 | Ga0307516_10000780 | 3300031730 | Bacteria | 43450 |
| 346 | Ga0307516_10061200 | 3300031730 | Bacteria | 3654 |
| 347 | Ga0307516_10114153 | 3300031730 | Bacteria | 2499 |
| 348 | Ga0316577_10006191 | 3300031733 | Bacteria | 6313 |
| 349 | Ga0316577_10045703 | 3300031733 | Unclassified | 2447 |
| 350 | Ga0307406_10059244 | 3300031901 | Bacteria | 2464 |
| 351 | Ga0307412_10002104 | 3300031911 | Bacteria | 11059 |
| 352 | Ga0307409_100052099 | 3300031995 | Bacteria | 3136 |
| 353 | Ga0307416_100024842 | 3300032002 | Bacteria | 4382 |
| 354 | Ga0307416_100142383 | 3300032002 | Bacteria | 2182 |
| 355 | Ga0307415_100000216 | 3300032126 | Bacteria | 25296 |
| 356 | Ga0316583_10005971 | 3300032133 | Bacteria | 4375 |
| 357 | Ga0307507_10003609 | 3300033179 | Bacteria | 29424 |
| 358 | Ga0373943_0002887 | 3300035170 | Bacteria | 7805 |
| 359 | Ga0373943_0111234 | 3300035170 | Bacteria | 1445 |
| 360 | Ga0373946_0015907 | 3300035171 | Bacteria | 2860 |
| 361 | Ga0316574_0007755 | 3300035398 | Bacteria | 5907 |
| 362 | Ga0316574_0083477 | 3300035398 | Bacteria | 2031 |
| 363 | Ga0373931_0055251 | 3300035691 | Bacteria | 2124 |
| 364 | Ga0373927_0023557 | 3300035695 | Bacteria | 4031 |
| 365 | Ga0373947_0005518 | 3300035725 | Bacteria | 7382 |
| 366 | Ga0373937_0204671 | 3300036401 | Bacteria | 1856 |
| 367 | Ga0316582_0012322 | 3300036647 | Bacteria | 4765 |
| 368 | Ga0316582_0029496 | 3300036647 | Bacteria | 3333 |
| 369 | Ga0316584_0024929 | 3300036712 | Bacteria | 4382 |
| 370 | Ga0373925_0015618 | 3300037068 | Bacteria | 5493 |
| 371 | Ga0395899_0068146 | 3300037312 | Bacteria | 2610 |
| 372 | Ga0395900_0017809 | 3300037418 | Bacteria | 7252 |
| 373 | Ga0395898_0002667 | 3300037466 | Bacteria | 20695 |
| 374 | Ga0395898_0228097 | 3300037466 | Bacteria | 1776 |
| 375 | Ga0395905_0126226 | 3300037471 | Bacteria | 2406 |
| 376 | Ga0395905_0248951 | 3300037471 | Bacteria | 1660 |
| 377 | Ga0316581_0002782 | 3300037588 | Bacteria | 4253 |
| 378 | Ga0436364_0623951 | 3300037853 | Bacteria | 1727 |
| 379 | Ga0395901_0356252 | 3300038443 | Bacteria | 1509 |
| 380 | Ga0400489_74021 | 3300039093 | Bacteria | 99222 |
| 381 | Ga0237816_00675 | 3300039145 | Bacteria | 2879 |
| 382 | Ga0436365_1862304 | 3300039437 | Bacteria | 21258 |
| 383 | Ga0436360_0151113 | 3300039438 | Bacteria | 2522 |
| 384 | Ga0436361_0523586 | 3300039447 | Bacteria | 2239 |
| 385 | Ga0436361_1082374 | 3300039447 | Bacteria | 1356 |
| 386 | Ga0436362_0793039 | 3300039453 | Bacteria | 2761 |
| 387 | Ga0439465_0003542 | 3300041413 | Bacteria | 5088 |
| 388 | Ga0451789_0160161 | 3300041443 | Bacteria | 1657 |
| 389 | Ga0439431_0009881 | 3300041997 | Bacteria | 2160 |
| 390 | Ga0439433_0016132 | 3300041999 | Bacteria | 1652 |
| 391 | Ga0439445_0001721 | 3300042004 | Bacteria | 4814 |
| 392 | Ga0439432_013107 | 3300042006 | Bacteria | 2822 |
| 393 | Ga0439452_002901 | 3300042010 | Bacteria | 6146 |
| 394 | Ga0439462_0002353 | 3300042015 | Bacteria | 4380 |
| 395 | Ga0451577_0003119 | 3300042876 | Bacteria | 18698 |
| 396 | Ga0451577_0009675 | 3300042876 | Bacteria | 9250 |
| 397 | Ga0451577_0024476 | 3300042876 | Bacteria | 5492 |
| 398 | Ga0466972_0012085 | 3300044658 | Bacteria | 4337 |
| 399 | Ga0466977_0000017 | 3300044666 | Bacteria | 25598 |
| 400 | Ga0453683_0008099 | 3300044673 | Bacteria | 7071 |
| 401 | Ga0466961_0029656 | 3300044693 | Bacteria | 3515 |
| 402 | Ga0466963_0009063 | 3300044694 | Bacteria | 5980 |
| 403 | Ga0466963_0017004 | 3300044694 | Bacteria | 4531 |
| 404 | Ga0466963_0018728 | 3300044694 | Bacteria | 4333 |
| 405 | Ga0466963_0041835 | 3300044694 | Bacteria | 3006 |
| 406 | Ga0466963_0069549 | 3300044694 | Bacteria | 2366 |
| 407 | Ga0466963_0115902 | 3300044694 | Bacteria | 1841 |
| 408 | Ga0466964_0017280 | 3300044706 | Bacteria | 2760 |
| 409 | Ga0453684_0001067 | 3300044712 | Bacteria | 87208 |
| 410 | Ga0453684_0005158 | 3300044712 | Bacteria | 26278 |
| 411 | Ga0453684_0013899 | 3300044712 | Bacteria | 12984 |
| 412 | Ga0453684_0048167 | 3300044712 | Bacteria | 5640 |
| 413 | Ga0466967_0009491 | 3300045976 | Bacteria | 7223 |
| 414 | Ga0466967_0032996 | 3300045976 | Bacteria | 4378 |
| 415 | Ga0466967_0139468 | 3300045976 | Bacteria | 2257 |
| 416 | Ga0466967_0210765 | 3300045976 | Bacteria | 1843 |
| 417 | Ga0495617_001554 | 3300046452 | Bacteria | 9939 |
| 418 | Ga0495627_000014 | 3300046453 | Bacteria | 326114 |
| 419 | Ga0495603_0000988 | 3300046455 | Bacteria | 16389 |
| 420 | Ga0495590_0005528 | 3300046457 | Bacteria | 5002 |
| 421 | Ga0495638_0000574 | 3300046460 | Bacteria | 41469 |
| 422 | Ga0495638_0093897 | 3300046460 | Bacteria | 1803 |
| 423 | Ga0495653_0013130 | 3300046463 | Bacteria | 6753 |
| 424 | Ga0495650_0064296 | 3300046471 | Bacteria | 1460 |
| 425 | Ga0495580_0007367 | 3300046472 | Bacteria | 8848 |
| 426 | Ga0495580_0049094 | 3300046472 | Bacteria | 2986 |
| 427 | Ga0495582_0062462 | 3300046473 | Bacteria | 2058 |
| 428 | Ga0495605_0002043 | 3300046474 | Bacteria | 12726 |
| 429 | Ga0495605_0085363 | 3300046474 | Bacteria | 1471 |
| 430 | Ga0495664_0014761 | 3300046477 | Bacteria | 4433 |
| 431 | Ga0495584_0079964 | 3300046491 | Bacteria | 1644 |
| 432 | Ga0495585_0152065 | 3300046492 | Bacteria | 1206 |
| 433 | Ga0495594_0160333 | 3300046499 | Bacteria | 1278 |
| 434 | Ga0495596_0008204 | 3300046500 | Bacteria | 4657 |
| 435 | Ga0495607_0004169 | 3300046501 | Bacteria | 10749 |
| 436 | Ga0495610_0000544 | 3300046512 | Bacteria | 37703 |
| 437 | Ga0495610_0001425 | 3300046512 | Bacteria | 21154 |
| 438 | Ga0495610_0077086 | 3300046512 | Bacteria | 1540 |
| 439 | Ga0495630_0111726 | 3300046517 | Bacteria | 2070 |
| 440 | Ga0495631_0002618 | 3300046518 | Bacteria | 10048 |
| 441 | Ga0495632_0000071 | 3300046519 | Bacteria | 105606 |
| 442 | Ga0495632_0017991 | 3300046519 | Bacteria | 3886 |
| 443 | Ga0495643_0000019 | 3300046522 | Bacteria | 303627 |
| 444 | Ga0495643_0079766 | 3300046522 | Bacteria | 1706 |
| 445 | Ga0495666_0000304 | 3300046526 | Bacteria | 21414 |
| 446 | Ga0495654_0092141 | 3300046530 | Bacteria | 1405 |
| 447 | Ga0495665_0042865 | 3300046531 | Bacteria | 2407 |
| 448 | Ga0495609_0000774 | 3300046538 | Bacteria | 23950 |
| 449 | Ga0495609_0011105 | 3300046538 | Bacteria | 4300 |
| 450 | Ga0495621_0023547 | 3300046539 | Bacteria | 2049 |
| 451 | Ga0495597_0001142 | 3300046542 | Bacteria | 20021 |
| 452 | Ga0495597_0001324 | 3300046542 | Bacteria | 18105 |
| 453 | Ga0495633_0007390 | 3300046558 | Bacteria | 6326 |
| 454 | Ga0495633_0017348 | 3300046558 | Bacteria | 3684 |
| 455 | Ga0495633_0047771 | 3300046558 | Bacteria | 2022 |
| 456 | Ga0495656_0003734 | 3300046615 | Bacteria | 5170 |
| 457 | Ga0495668_0002749 | 3300046616 | Bacteria | 14061 |
| 458 | Ga0495668_0006888 | 3300046616 | Bacteria | 7365 |
| 459 | Ga0495668_0007365 | 3300046616 | Bacteria | 7048 |
| 460 | Ga0495611_0005124 | 3300046648 | Bacteria | 5616 |
| 461 | Ga0495625_0009987 | 3300046660 | Bacteria | 7895 |
| 462 | Ga0495661_0012421 | 3300046665 | Bacteria | 5749 |
| 463 | Ga0495661_0160659 | 3300046665 | Bacteria | 1206 |
| 464 | Ga0495588_0000738 | 3300046674 | Bacteria | 14916 |
| 465 | Ga0495599_0017583 | 3300046678 | Bacteria | 4445 |
| 466 | Ga0495623_0071650 | 3300046679 | Bacteria | 2156 |
| 467 | Ga0495658_0027317 | 3300046683 | Bacteria | 3070 |
| 468 | Ga0495658_0038141 | 3300046683 | Bacteria | 2660 |
| 469 | Ga0495669_0000457 | 3300046684 | Bacteria | 19129 |
| 470 | Ga0495670_0044048 | 3300046691 | Bacteria | 2228 |
| 471 | Ga0495671_0019697 | 3300046692 | Bacteria | 3562 |
| 472 | Ga0495671_0052407 | 3300046692 | Bacteria | 2028 |
| 473 | Ga0495671_0088770 | 3300046692 | Bacteria | 1514 |
| 474 | Ga0495589_0014193 | 3300046794 | Bacteria | 4105 |
| 475 | Ga0495660_0085296 | 3300046810 | Bacteria | 1650 |
| 476 | Ga0495581_0073713 | 3300047315 | Bacteria | 1976 |
| 477 | Ga0495604_0000217 | 3300047317 | Bacteria | 52754 |
| 478 | Ga0495604_0034176 | 3300047317 | Bacteria | 4023 |
| 479 | Ga0495636_0022712 | 3300047318 | Bacteria | 2538 |
| 480 | Ga0495674_0024158 | 3300047319 | Bacteria | 5591 |
| 481 | Ga0495676_0007422 | 3300047321 | Bacteria | 10060 |
| 482 | Ga0495687_000088 | 3300047443 | Bacteria | 142499 |
| 483 | Ga0495675_0045177 | 3300047444 | Bacteria | 2805 |
| 484 | Ga0495685_015806 | 3300047447 | Bacteria | 2577 |
| 485 | Ga0495681_0007224 | 3300047470 | Bacteria | 7138 |
| 486 | Ga0495686_0045107 | 3300047472 | Bacteria | 2790 |
| 487 | Ga0495686_0116773 | 3300047472 | Bacteria | 1595 |
| 488 | Ga0495602_0146940 | 3300048088 | Bacteria | 1858 |
| 489 | Ga0495602_0209775 | 3300048088 | Bacteria | 1479 |
| 490 | Ga0495615_0002368 | 3300048090 | Bacteria | 3018 |
| 491 | Ga0495615_0012211 | 3300048090 | Bacteria | 1766 |
| 492 | Ga0496100_0068457 | 3300048903 | Bacteria | 2361 |
| 493 | Ga0496101_0134058 | 3300048904 | Bacteria | 1883 |
| 494 | Ga0496102_0019796 | 3300048905 | Bacteria | 5933 |
| 495 | Ga0496102_0036013 | 3300048905 | Bacteria | 4457 |
| 496 | Ga0496102_0339008 | 3300048905 | Bacteria | 1416 |
| 497 | Ga0496104_0003494 | 3300048907 | Bacteria | 13552 |
| 498 | Ga0496104_0024889 | 3300048907 | Bacteria | 5513 |
| 499 | Ga0496104_0032875 | 3300048907 | Bacteria | 4829 |
| 500 | Ga0496105_0001303 | 3300048908 | Bacteria | 17456 |
| 501 | Ga0496108_0002007 | 3300048911 | Bacteria | 16311 |
| 502 | Ga0496108_0253004 | 3300048911 | Bacteria | 1533 |
| 503 | Ga0496109_0005264 | 3300048912 | Bacteria | 10806 |
| 504 | Ga0496110_0018031 | 3300048913 | Bacteria | 5913 |
| 505 | Ga0496110_0063217 | 3300048913 | Bacteria | 3270 |
| 506 | Ga0496110_0078107 | 3300048913 | Bacteria | 2947 |
| 507 | Ga0496111_0012102 | 3300048914 | Bacteria | 5834 |
| 508 | Ga0496112_0020625 | 3300048915 | Bacteria | 6249 |
| 509 | Ga0496112_0078711 | 3300048915 | Bacteria | 3260 |
| 510 | Ga0496112_0095315 | 3300048915 | Bacteria | 2946 |
| 511 | Ga0496112_0118720 | 3300048915 | Bacteria | 2615 |
| 512 | Ga0496112_0231596 | 3300048915 | Bacteria | 1802 |
| 513 | Ga0496113_0000822 | 3300048916 | Bacteria | 16174 |
| 514 | Ga0496113_0128734 | 3300048916 | Bacteria | 1985 |
| 515 | Ga0496114_0001735 | 3300048917 | Bacteria | 16539 |
| 516 | Ga0496114_0269482 | 3300048917 | Bacteria | 1500 |
| 517 | Ga0496115_0036684 | 3300048918 | Bacteria | 3882 |
| 518 | Ga0496116_0009863 | 3300048919 | Bacteria | 8081 |
| 519 | Ga0496116_0064990 | 3300048919 | Bacteria | 2342 |
| 520 | Ga0496117_0003650 | 3300048920 | Bacteria | 17708 |
| 521 | Ga0496117_0011109 | 3300048920 | Bacteria | 8098 |
| 522 | Ga0496118_0005735 | 3300048921 | Bacteria | 13968 |
| 523 | Ga0496118_0107692 | 3300048921 | Bacteria | 1860 |
| 524 | Ga0496119_0012959 | 3300048922 | Bacteria | 6705 |
| 525 | Ga0496119_0059160 | 3300048922 | Bacteria | 2303 |
| 526 | Ga0496120_0062689 | 3300048923 | Bacteria | 2070 |
| 527 | Ga0496121_0000130 | 3300048924 | Bacteria | 168094 |
| 528 | Ga0496121_0003287 | 3300048924 | Bacteria | 23207 |
| 529 | Ga0496121_0010155 | 3300048924 | Bacteria | 10663 |
| 530 | Ga0496121_0015854 | 3300048924 | Bacteria | 7835 |
| 531 | Ga0496121_0054278 | 3300048924 | Bacteria | 3350 |
| 532 | Ga0496122_0000497 | 3300048925 | Bacteria | 81763 |
| 533 | Ga0496122_0001804 | 3300048925 | Bacteria | 32800 |
| 534 | Ga0496122_0017319 | 3300048925 | Bacteria | 6747 |
| 535 | Ga0496123_0001884 | 3300048926 | Bacteria | 27381 |
| 536 | Ga0496123_0003744 | 3300048926 | Bacteria | 16674 |
| 537 | Ga0496123_0013777 | 3300048926 | Bacteria | 6753 |
| 538 | Ga0496123_0047399 | 3300048926 | Bacteria | 2904 |
| 539 | Ga0496124_0004245 | 3300048927 | Bacteria | 16863 |
| 540 | Ga0496124_0043872 | 3300048927 | Bacteria | 3840 |
| 541 | Ga0496124_0054741 | 3300048927 | Bacteria | 3375 |
| 542 | Ga0496125_0000166 | 3300048928 | Bacteria | 147432 |
| 543 | Ga0496125_0016464 | 3300048928 | Bacteria | 7097 |
| 544 | Ga0496125_0041883 | 3300048928 | Bacteria | 3909 |
| 545 | Ga0496125_0136526 | 3300048928 | Bacteria | 1714 |
| 546 | Ga0496125_0141908 | 3300048928 | Bacteria | 1668 |
| 547 | Ga0496125_0189022 | 3300048928 | Bacteria | 1362 |
| 548 | Ga0496126_0000090 | 3300048929 | Bacteria | 210538 |
| 549 | Ga0496126_0001188 | 3300048929 | Bacteria | 42555 |
| 550 | Ga0496126_0032209 | 3300048929 | Bacteria | 4941 |
| 551 | Ga0496126_0032887 | 3300048929 | Bacteria | 4881 |
| 552 | Ga0495678_005337 | 3300049459 | Bacteria | 7127 |
| 553 | Ga0495678_018010 | 3300049459 | Bacteria | 3185 |
| 554 | Ga0501032_0093152 | 3300049569 | Bacteria | 1998 |
| 555 | Ga0501033_0037756 | 3300049570 | Bacteria | 3614 |
| 556 | Ga0501034_0000022 | 3300049571 | Bacteria | 264441 |
| 557 | Ga0501034_0000874 | 3300049571 | Bacteria | 44331 |
| 558 | Ga0501034_0001048 | 3300049571 | Bacteria | 39365 |
| 559 | Ga0501034_0128127 | 3300049571 | Bacteria | 2523 |
| 560 | Ga0501034_0163474 | 3300049571 | Bacteria | 2195 |
| 561 | Ga0501036_0044073 | 3300049572 | Bacteria | 3778 |
| 562 | Ga0501037_0007425 | 3300049573 | Bacteria | 8014 |
| 563 | Ga0501047_0001179 | 3300049581 | Bacteria | 25916 |
| 564 | Ga0501047_0003160 | 3300049581 | Bacteria | 15617 |
| 565 | Ga0501047_0093778 | 3300049581 | Bacteria | 2881 |
| 566 | Ga0501072_0109871 | 3300049588 | Bacteria | 2194 |
| 567 | Ga0501073_0000068 | 3300049589 | Bacteria | 63524 |
| 568 | Ga0501077_0000056 | 3300049593 | Bacteria | 57478 |
| 569 | Ga0501227_000555 | 3300049665 | Bacteria | 8121 |
| 570 | Ga0501233_007858 | 3300049668 | Bacteria | 2041 |
| 571 | Ga0501238_002816 | 3300049671 | Bacteria | 2106 |
| 572 | Ga0501225_0005596 | 3300049705 | Bacteria | 3681 |
| 573 | Ga0501080_0216113 | 3300049742 | Bacteria | 1756 |
| 574 | Ga0501035_0060943 | 3300049822 | Bacteria | 3358 |
| 575 | Ga0501035_0116678 | 3300049822 | Bacteria | 2336 |
| 576 | Ga0501044_0008276 | 3300049823 | Bacteria | 11404 |
| 577 | Ga0501044_0010514 | 3300049823 | Bacteria | 10043 |
| 578 | Ga0501044_0087580 | 3300049823 | Bacteria | 3145 |
| 579 | Ga0501044_0180316 | 3300049823 | Bacteria | 2079 |
| 580 | Ga0501044_0487690 | 3300049823 | Bacteria | 1135 |
| 581 | nmdc:mga03683_38552_c1 | 3300050489 | Bacteria | 1952 |
| 582 | nmdc:mga03683_591_c1 | 3300050489 | Bacteria | 10402 |
| 583 | nmdc:mga03n38_20105_c1 | 3300050490 | Bacteria | 2666 |
| 584 | nmdc:mga00v17_139488_c1 | 3300050491 | Bacteria | 1554 |
| 585 | nmdc:mga0k408_161729_c1 | 3300050493 | Bacteria | 1334 |
| 586 | nmdc:mga0k408_353_c1 | 3300050493 | Bacteria | 25220 |
| 587 | nmdc:mga0k408_72272_c1 | 3300050493 | Bacteria | 2015 |
| 588 | nmdc:mga06z11_231_c1 | 3300050494 | Bacteria | 21729 |
| 589 | nmdc:mga04h51_485_c1 | 3300050495 | Bacteria | 9513 |
| 590 | nmdc:mga07m45_116560_c1 | 3300050496 | Bacteria | 1541 |
| 591 | nmdc:mga07m45_263_c1 | 3300050496 | Bacteria | 21293 |
| 592 | nmdc:mga07m45_2_c1 | 3300050496 | Bacteria | 451154 |
| 593 | nmdc:mga07m45_57039_c1 | 3300050496 | Bacteria | 2208 |
| 594 | nmdc:mga07m45_88_c1 | 3300050496 | Bacteria | 34971 |
| 595 | nmdc:mga05p37_360043_c1 | 3300050507 | Bacteria | 1710 |
| 596 | nmdc:mga08y16_177547_c1 | 3300050511 | Bacteria | 2211 |
| 597 | nmdc:mga08y16_46_c1 | 3300050511 | Bacteria | 112050 |
| 598 | nmdc:mga0n895_25306_c1 | 3300050512 | Bacteria | 5606 |
| 599 | nmdc:mga08x19_69278_c1 | 3300050514 | Bacteria | 2297 |
| 600 | nmdc:mga0sz30_1776_c1 | 3300050516 | Bacteria | 7657 |
| 601 | Ga0500643_006677 | 3300053087 | Bacteria | 4779 |
| 602 | Ga0500643_010806 | 3300053087 | Bacteria | 3374 |
| 603 | Ga0500643_036052 | 3300053087 | Bacteria | 1478 |
| 604 | Ga0500644_0008259 | 3300053088 | Bacteria | 2743 |
| 605 | Ga0500646_0010306 | 3300053090 | Bacteria | 2398 |
| 606 | Ga0500651_0002923 | 3300053093 | Bacteria | 9181 |
| 607 | Ga0500566_0037686 | 3300053094 | Bacteria | 2800 |
| 608 | Ga0500641_0004583 | 3300053096 | Bacteria | 4884 |
| 609 | Ga0500556_0049884 | 3300053104 | Bacteria | 1511 |
| 610 | Ga0500569_002802 | 3300053109 | Bacteria | 3479 |
| 611 | Ga0500572_002675 | 3300053111 | Bacteria | 4217 |
| 612 | Ga0500592_000770 | 3300053116 | Bacteria | 5266 |
| 613 | Ga0500594_0002724 | 3300053118 | Bacteria | 3847 |
| 614 | Ga0500594_0067983 | 3300053118 | Bacteria | 1042 |
| 615 | Ga0500608_000265 | 3300053122 | Bacteria | 20322 |
| 616 | Ga0500614_000567 | 3300053123 | Bacteria | 9542 |
| 617 | Ga0500618_000833 | 3300053125 | Bacteria | 16749 |
| 618 | Ga0500618_004394 | 3300053125 | Bacteria | 4531 |
| 619 | Ga0500618_006225 | 3300053125 | Bacteria | 3524 |
| 620 | Ga0500642_0000278 | 3300053130 | Bacteria | 19182 |
| 621 | Ga0500652_003604 | 3300053131 | Bacteria | 4702 |
| 622 | Ga0500655_000670 | 3300053133 | Bacteria | 6806 |
| 623 | Ga0500658_0000047 | 3300053134 | Bacteria | 66543 |
| 624 | Ga0500559_0000442 | 3300053136 | Bacteria | 29452 |
| 625 | Ga0500559_0002100 | 3300053136 | Bacteria | 10621 |
| 626 | Ga0500559_0005405 | 3300053136 | Bacteria | 5884 |
| 627 | Ga0500568_0002510 | 3300053139 | Bacteria | 10740 |
| 628 | Ga0500577_0004311 | 3300053142 | Bacteria | 3750 |
| 629 | Ga0500577_0007102 | 3300053142 | Bacteria | 3125 |
| 630 | Ga0500577_0102201 | 3300053142 | Bacteria | 1173 |
| 631 | Ga0500588_0000198 | 3300053146 | Bacteria | 8377 |
| 632 | Ga0500590_021126 | 3300053148 | Bacteria | 3379 |
| 633 | Ga0500604_0000031 | 3300053151 | Bacteria | 57942 |
| 634 | Ga0500604_0050890 | 3300053151 | Bacteria | 1278 |
| 635 | Ga0500616_0000108 | 3300053153 | Bacteria | 152917 |
| 636 | Ga0500616_0001465 | 3300053153 | Bacteria | 22527 |
| 637 | Ga0500616_0001953 | 3300053153 | Bacteria | 18378 |
| 638 | Ga0500616_0002610 | 3300053153 | Bacteria | 14737 |
| 639 | Ga0500616_0002923 | 3300053153 | Bacteria | 13613 |
| 640 | Ga0500619_038130 | 3300053154 | Bacteria | 1505 |
| 641 | Ga0500622_0000937 | 3300053156 | Bacteria | 24806 |
| 642 | Ga0500622_0006169 | 3300053156 | Bacteria | 7026 |
| 643 | Ga0500624_000072 | 3300053157 | Bacteria | 57950 |
| 644 | Ga0500624_000210 | 3300053157 | Bacteria | 22056 |
| 645 | Ga0500627_0000297 | 3300053158 | Bacteria | 13822 |
| 646 | Ga0500639_005154 | 3300053163 | Bacteria | 6669 |
| 647 | Ga0500636_0000144 | 3300053177 | Bacteria | 37563 |
| 648 | Ga0500636_0005061 | 3300053177 | Bacteria | 7481 |
| 649 | Ga0500636_0120981 | 3300053177 | Bacteria | 1468 |
| 650 | Ga0500567_007296 | 3300053723 | Bacteria | 5202 |
| 651 | Ga0500570_000059 | 3300053724 | Bacteria | 27832 |
| 652 | Ga0500611_001425 | 3300053727 | Bacteria | 2624 |
| 653 | Ga0500625_000003 | 3300053729 | Bacteria | 268493 |
| 654 | Ga0500645_004201 | 3300053730 | Bacteria | 5602 |
| 655 | Ga0500645_005487 | 3300053730 | Bacteria | 4658 |
| 656 | Ga0500656_003807 | 3300053732 | Bacteria | 1428 |
| 657 | Ga0500587_005434 | 3300053739 | Bacteria | 1712 |
| 658 | Ga0501082_0001742 | 3300060353 | Bacteria | 19211 |
| 659 | Ga0466962_0022700 | 3300061719 | Bacteria | 3016 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046473 | Ga0495582_0062462 | Ga0495582_0062462_586_1620 | 313 |
| 2 | 3300046460 | Ga0495638_0093897 | Ga0495638_0093897_32_1000 | 315 |
| 3 | 3300046665 | Ga0495661_0160659 | Ga0495661_0160659_20_982 | 315 |
| 4 | 3300048905 | Ga0496102_0339008 | Ga0496102_0339008_441_1403 | 315 |
| 5 | 3300053118 | Ga0500594_0067983 | Ga0500594_0067983_15_977 | 315 |
| 6 | 3300053142 | Ga0500577_0102201 | Ga0500577_0102201_187_1149 | 315 |
| 7 | 3300026121 | Ga0207683_10207938 | Ga0207683_102079382 | 317 |
| 8 | 3300046492 | Ga0495585_0152065 | Ga0495585_0152065_14_1042 | 327 |
| 9 | 3300047318 | Ga0495636_0022712 | Ga0495636_0022712_27_1055 | 327 |
| 10 | 3300044694 | Ga0466963_0018728 | Ga0466963_0018728_3312_4319 | 331 |
| 11 | 3300046491 | Ga0495584_0079964 | Ga0495584_0079964_274_1305 | 332 |
| 12 | 3300053151 | Ga0500604_0050890 | Ga0500604_0050890_240_1259 | 333 |
| 13 | 3300046517 | Ga0495630_0111726 | Ga0495630_0111726_20_1054 | 336 |
| 14 | 3300050493 | nmdc:mga0k408_72272_c1 | nmdc:mga0k408_72272_c1_542_1600 | 337 |
| 15 | 3300049823 | Ga0501044_0487690 | Ga0501044_0487690_74_1117 | 340 |
| 16 | 3300005364 | Ga0070673_100046037 | Ga0070673_1000460372 | 342 |
| 17 | 3300025960 | Ga0207651_10126486 | Ga0207651_101264862 | 342 |
| 18 | 3300031616 | Ga0307508_10007605 | Ga0307508_100076059 | 342 |
| 19 | 3300046500 | Ga0495596_0008204 | Ga0495596_0008204_3285_4448 | 343 |
| 20 | 3300053739 | Ga0500587_005434 | Ga0500587_005434_12_1154 | 343 |
| 21 | 3300005539 | Ga0068853_100124373 | Ga0068853_1001243732 | 345 |
| 22 | 3300009551 | Ga0105238_10039628 | Ga0105238_100396283 | 345 |
| 23 | 3300025949 | Ga0207667_10000002 | Ga0207667_10000002515 | 345 |
| 24 | 3300026041 | Ga0207639_10007774 | Ga0207639_100077742 | 345 |
| 25 | 3300005289 | Ga0065704_10009005 | Ga0065704_100090051 | 346 |
| 26 | 3300005327 | Ga0070658_10004072 | Ga0070658_100040722 | 346 |
| 27 | 3300005564 | Ga0070664_100015104 | Ga0070664_1000151045 | 346 |
| 28 | 3300025909 | Ga0207705_10000120 | Ga0207705_1000012033 | 346 |
| 29 | 3300025945 | Ga0207679_10093210 | Ga0207679_100932101 | 346 |
| 30 | 3300049569 | Ga0501032_0093152 | Ga0501032_0093152_742_1896 | 346 |
| 31 | 3300049572 | Ga0501036_0044073 | Ga0501036_0044073_2196_3350 | 346 |
| 32 | 3300049581 | Ga0501047_0093778 | Ga0501047_0093778_1232_2386 | 346 |
| 33 | 3300049822 | Ga0501035_0116678 | Ga0501035_0116678_196_1350 | 346 |
| 34 | 3300049823 | Ga0501044_0180316 | Ga0501044_0180316_743_1897 | 346 |
| 35 | 3300005535 | Ga0070684_100046047 | Ga0070684_1000460471 | 349 |
| 36 | 3300046512 | Ga0495610_0077086 | Ga0495610_0077086_459_1526 | 350 |
| 37 | 3300046558 | Ga0495633_0007390 | Ga0495633_0007390_30_1127 | 350 |
| 38 | 3300005548 | Ga0070665_100000232 | Ga0070665_1000002325 | 352 |
| 39 | 3300028379 | Ga0268266_10003472 | Ga0268266_1000347217 | 352 |
| 40 | 3300035691 | Ga0373931_0055251 | Ga0373931_0055251_999_2078 | 352 |
| 41 | 3300005843 | Ga0068860_100145738 | Ga0068860_1001457383 | 353 |
| 42 | 3300009176 | Ga0105242_10047440 | Ga0105242_100474404 | 353 |
| 43 | 3300009176 | Ga0105242_10062141 | Ga0105242_100621413 | 353 |
| 44 | 3300025919 | Ga0207657_10025901 | Ga0207657_100259013 | 353 |
| 45 | 3300025934 | Ga0207686_10009583 | Ga0207686_100095835 | 353 |
| 46 | iso_pu_bacteria | 2758568016 | 2758639429 | 353 |
| 47 | 3300005354 | Ga0070675_100028436 | Ga0070675_1000284364 | 354 |
| 48 | 3300050511 | nmdc:mga08y16_177547_c1 | nmdc:mga08y16_177547_c1_759_1901 | 354 |
| 49 | 3300005618 | Ga0068864_100001781 | Ga0068864_10000178118 | 355 |
| 50 | 3300005842 | Ga0068858_100001936 | Ga0068858_10000193621 | 355 |
| 51 | 3300009177 | Ga0105248_10019503 | Ga0105248_100195034 | 355 |
| 52 | 3300025315 | Ga0207697_10020398 | Ga0207697_100203983 | 355 |
| 53 | 3300025941 | Ga0207711_10007657 | Ga0207711_100076575 | 355 |
| 54 | 3300026035 | Ga0207703_10009731 | Ga0207703_100097314 | 355 |
| 55 | 3300026095 | Ga0207676_10001168 | Ga0207676_100011686 | 355 |
| 56 | 3300017792 | Ga0163161_10109611 | Ga0163161_101096112 | 356 |
| 57 | 3300035398 | Ga0316574_0083477 | Ga0316574_0083477_900_1991 | 357 |
| 58 | 3300048928 | Ga0496125_0141908 | Ga0496125_0141908_35_1108 | 357 |
| 59 | iso_pu_bacteria | 2885318864 | 2885320801 | 357 |
| 60 | 3300005338 | Ga0068868_100000036 | Ga0068868_10000003685 | 358 |
| 61 | 3300005339 | Ga0070660_100000347 | Ga0070660_10000034736 | 358 |
| 62 | 3300005366 | Ga0070659_100000034 | Ga0070659_100000034104 | 358 |
| 63 | 3300025919 | Ga0207657_10000839 | Ga0207657_1000083911 | 358 |
| 64 | 3300025932 | Ga0207690_10000005 | Ga0207690_10000005312 | 358 |
| 65 | 3300026023 | Ga0207677_10000044 | Ga0207677_1000004452 | 358 |
| 66 | 3300048911 | Ga0496108_0253004 | Ga0496108_0253004_282_1412 | 360 |
| 67 | 3300048088 | Ga0495602_0146940 | Ga0495602_0146940_751_1842 | 362 |
| 68 | 3300048088 | Ga0495602_0209775 | Ga0495602_0209775_372_1463 | 362 |
| 69 | 3300005548 | Ga0070665_100000105 | Ga0070665_10000010532 | 363 |
| 70 | 3300028379 | Ga0268266_10000055 | Ga0268266_10000055235 | 363 |
| 71 | 3300005333 | Ga0070677_10000559 | Ga0070677_100005595 | 364 |
| 72 | 3300009098 | Ga0105245_10014088 | Ga0105245_100140885 | 364 |
| 73 | 3300025893 | Ga0207682_10000576 | Ga0207682_1000057611 | 364 |
| 74 | 3300053139 | Ga0500568_0002510 | Ga0500568_0002510_1349_2491 | 364 |
| 75 | 3300053153 | Ga0500616_0001465 | Ga0500616_0001465_244_1386 | 364 |
| 76 | 3300046683 | Ga0495658_0038141 | Ga0495658_0038141_13_1134 | 365 |
| 77 | 3300006058 | Ga0075432_10004168 | Ga0075432_100041681 | 366 |
| 78 | 3300006353 | Ga0075370_10030387 | Ga0075370_100303872 | 366 |
| 79 | 3300027907 | Ga0207428_10025530 | Ga0207428_100255304 | 366 |
| 80 | 3300048905 | Ga0496102_0036013 | Ga0496102_0036013_1678_2829 | 366 |
| 81 | 3300048917 | Ga0496114_0269482 | Ga0496114_0269482_336_1487 | 366 |
| 82 | 3300048920 | Ga0496117_0003650 | Ga0496117_0003650_3608_4759 | 366 |
| 83 | 3300048921 | Ga0496118_0005735 | Ga0496118_0005735_1912_3063 | 366 |
| 84 | 3300048929 | Ga0496126_0001188 | Ga0496126_0001188_30879_32030 | 366 |
| 85 | 3300050496 | nmdc:mga07m45_57039_c1 | nmdc:mga07m45_57039_c1_814_1965 | 366 |
| 86 | 3300014325 | Ga0163163_10007083 | Ga0163163_100070833 | 367 |
| 87 | 3300035170 | Ga0373943_0111234 | Ga0373943_0111234_84_1307 | 367 |
| 88 | 3300037853 | Ga0436364_0623951 | Ga0436364_0623951_171_1334 | 367 |
| 89 | 3300048903 | Ga0496100_0068457 | Ga0496100_0068457_796_2019 | 367 |
| 90 | 3300048907 | Ga0496104_0003494 | Ga0496104_0003494_3060_4283 | 367 |
| 91 | 3300048911 | Ga0496108_0002007 | Ga0496108_0002007_2139_3362 | 367 |
| 92 | 3300048912 | Ga0496109_0005264 | Ga0496109_0005264_6404_7627 | 367 |
| 93 | 3300048913 | Ga0496110_0018031 | Ga0496110_0018031_343_1566 | 367 |
| 94 | 3300048913 | Ga0496110_0063217 | Ga0496110_0063217_1707_2930 | 367 |
| 95 | 3300048914 | Ga0496111_0012102 | Ga0496111_0012102_2584_3807 | 367 |
| 96 | 3300048915 | Ga0496112_0095315 | Ga0496112_0095315_1161_2384 | 367 |
| 97 | 3300048916 | Ga0496113_0000822 | Ga0496113_0000822_3494_4717 | 367 |
| 98 | 3300048918 | Ga0496115_0036684 | Ga0496115_0036684_1564_2787 | 367 |
| 99 | 3300053727 | Ga0500611_001425 | Ga0500611_001425_1344_2564 | 367 |
| 100 | 3300006914 | Ga0075436_100051187 | Ga0075436_1000511872 | 368 |
| 101 | 3300009147 | Ga0114129_10454935 | Ga0114129_104549352 | 368 |
| 102 | 3300046522 | Ga0495643_0000019 | Ga0495643_0000019_100565_101716 | 368 |
| 103 | 3300046558 | Ga0495633_0017348 | Ga0495633_0017348_1617_2768 | 368 |
| 104 | 3300050507 | nmdc:mga05p37_360043_c1 | nmdc:mga05p37_360043_c1_453_1607 | 368 |
| 105 | 3300050514 | nmdc:mga08x19_69278_c1 | nmdc:mga08x19_69278_c1_1064_2218 | 368 |
| 106 | 3300053090 | Ga0500646_0010306 | Ga0500646_0010306_822_1964 | 368 |
| 107 | 3300053151 | Ga0500604_0000031 | Ga0500604_0000031_19555_20697 | 368 |
| 108 | 3300039447 | Ga0436361_0523586 | Ga0436361_0523586_540_1691 | 370 |
| 109 | 3300046674 | Ga0495588_0000738 | Ga0495588_0000738_12780_13940 | 370 |
| 110 | 3300046692 | Ga0495671_0019697 | Ga0495671_0019697_2214_3374 | 370 |
| 111 | 3300047470 | Ga0495681_0007224 | Ga0495681_0007224_327_1487 | 370 |
| 112 | 3300050493 | nmdc:mga0k408_353_c1 | nmdc:mga0k408_353_c1_10484_11605 | 370 |
| 113 | 3300050496 | nmdc:mga07m45_88_c1 | nmdc:mga07m45_88_c1_8277_9398 | 370 |
| 114 | 3300053111 | Ga0500572_002675 | Ga0500572_002675_1242_2402 | 370 |
| 115 | 3300053177 | Ga0500636_0000144 | Ga0500636_0000144_2673_3833 | 370 |
| 116 | iso_pu_bacteria | 2508501039 | 2508678058 | 372 |
| 117 | 3300046455 | Ga0495603_0000988 | Ga0495603_0000988_11830_13038 | 373 |
| 118 | 3300046499 | Ga0495594_0160333 | Ga0495594_0160333_56_1264 | 373 |
| 119 | 3300046794 | Ga0495589_0014193 | Ga0495589_0014193_2177_3385 | 373 |
| 120 | 3300047321 | Ga0495676_0007422 | Ga0495676_0007422_1131_2339 | 373 |
| 121 | 3300047447 | Ga0495685_015806 | Ga0495685_015806_384_1592 | 373 |
| 122 | iso_pu_bacteria | 2816332139 | 2816506841 | 373 |
| 123 | 3300005329 | Ga0070683_100002003 | Ga0070683_1000020036 | 375 |
| 124 | 3300005329 | Ga0070683_100164059 | Ga0070683_1001640592 | 375 |
| 125 | 3300005435 | Ga0070714_100131545 | Ga0070714_1001315452 | 375 |
| 126 | 3300005436 | Ga0070713_100093464 | Ga0070713_1000934641 | 375 |
| 127 | 3300005530 | Ga0070679_100241703 | Ga0070679_1002417032 | 375 |
| 128 | 3300005535 | Ga0070684_100000748 | Ga0070684_10000074818 | 375 |
| 129 | 3300005535 | Ga0070684_100032929 | Ga0070684_1000329294 | 375 |
| 130 | 3300005577 | Ga0068857_100000132 | Ga0068857_10000013214 | 375 |
| 131 | 3300005614 | Ga0068856_100002961 | Ga0068856_1000029613 | 375 |
| 132 | 3300009551 | Ga0105238_10245863 | Ga0105238_102458632 | 375 |
| 133 | 3300013105 | Ga0157369_10002048 | Ga0157369_100020489 | 375 |
| 134 | 3300022467 | Ga0224712_10035527 | Ga0224712_100355273 | 375 |
| 135 | 3300025912 | Ga0207707_10059512 | Ga0207707_100595124 | 375 |
| 136 | 3300025921 | Ga0207652_10359735 | Ga0207652_103597351 | 375 |
| 137 | 3300025924 | Ga0207694_10159781 | Ga0207694_101597812 | 375 |
| 138 | 3300025928 | Ga0207700_10009309 | Ga0207700_100093091 | 375 |
| 139 | 3300025929 | Ga0207664_10007189 | Ga0207664_100071898 | 375 |
| 140 | 3300025944 | Ga0207661_10000743 | Ga0207661_100007436 | 375 |
| 141 | 3300025944 | Ga0207661_10053941 | Ga0207661_100539412 | 375 |
| 142 | 3300025945 | Ga0207679_10011528 | Ga0207679_100115283 | 375 |
| 143 | 3300026116 | Ga0207674_10000875 | Ga0207674_1000087536 | 375 |
| 144 | 3300044694 | Ga0466963_0041835 | Ga0466963_0041835_1386_2525 | 375 |
| 145 | 3300044694 | Ga0466963_0069549 | Ga0466963_0069549_918_2060 | 375 |
| 146 | 3300044694 | Ga0466963_0115902 | Ga0466963_0115902_614_1756 | 375 |
| 147 | 3300044706 | Ga0466964_0017280 | Ga0466964_0017280_1445_2581 | 375 |
| 148 | 3300045976 | Ga0466967_0009491 | Ga0466967_0009491_4507_5646 | 375 |
| 149 | 3300045976 | Ga0466967_0032996 | Ga0466967_0032996_2706_3842 | 375 |
| 150 | 3300048907 | Ga0496104_0032875 | Ga0496104_0032875_2446_3588 | 375 |
| 151 | 3300048915 | Ga0496112_0020625 | Ga0496112_0020625_4079_5221 | 375 |
| 152 | 3300048915 | Ga0496112_0078711 | Ga0496112_0078711_375_1511 | 375 |
| 153 | 3300048917 | Ga0496114_0001735 | Ga0496114_0001735_3280_4506 | 375 |
| 154 | 3300049571 | Ga0501034_0128127 | Ga0501034_0128127_471_1625 | 375 |
| 155 | 3300060353 | Ga0501082_0001742 | Ga0501082_0001742_7283_8431 | 375 |
| 156 | 3300061719 | Ga0466962_0022700 | Ga0466962_0022700_664_1803 | 375 |
| 157 | iso_pu_bacteria | 2599185292 | 2599904135 | 375 |
| 158 | iso_pu_bacteria | 2643221569 | 2643861332 | 375 |
| 159 | iso_pu_bacteria | 2643221594 | 2643983119 | 375 |
| 160 | iso_pu_bacteria | 2643221621 | 2644120538 | 375 |
| 161 | iso_pu_bacteria | 2808606395 | 2809032890 | 375 |
| 162 | iso_pu_bacteria | 2855730933 | 2855733015 | 375 |
| 163 | iso_pu_bacteria | 2855767633 | 2855771767 | 375 |
| 164 | iso_pu_bacteria | 2856314179 | 2856318166 | 375 |
| 165 | iso_pu_bacteria | 2857537821 | 2857537824 | 375 |
| 166 | iso_pu_bacteria | 2858950400 | 2858956241 | 375 |
| 167 | iso_pu_bacteria | 2881412998 | 2881415823 | 375 |
| 168 | iso_pu_bacteria | 2891633521 | 2891636798 | 375 |
| 169 | iso_pu_bacteria | 2906414383 | 2906418203 | 375 |
| 170 | iso_pu_bacteria | 2941479691 | 2941482888 | 375 |
| 171 | iso_pu_bacteria | 2961170736 | 2961175848 | 375 |
| 172 | iso_pu_bacteria | 2970503327 | 2970508513 | 375 |
| 173 | iso_pu_bacteria | 2979808191 | 2979811838 | 375 |
| 174 | iso_pu_bacteria | 2989349275 | 2989352632 | 375 |
| 175 | 3300005289 | Ga0065704_10079565 | Ga0065704_100795652 | 376 |
| 176 | 3300005327 | Ga0070658_10132353 | Ga0070658_101323533 | 376 |
| 177 | 3300005356 | Ga0070674_100061329 | Ga0070674_1000613292 | 376 |
| 178 | 3300005435 | Ga0070714_100001638 | Ga0070714_1000016387 | 376 |
| 179 | 3300005467 | Ga0070706_100001450 | Ga0070706_10000145013 | 376 |
| 180 | 3300005467 | Ga0070706_100168273 | Ga0070706_1001682733 | 376 |
| 181 | 3300005468 | Ga0070707_100021081 | Ga0070707_1000210815 | 376 |
| 182 | 3300005471 | Ga0070698_100139653 | Ga0070698_1001396532 | 376 |
| 183 | 3300005617 | Ga0068859_100002459 | Ga0068859_10000245911 | 376 |
| 184 | 3300005843 | Ga0068860_100011535 | Ga0068860_1000115354 | 376 |
| 185 | 3300006038 | Ga0075365_10018258 | Ga0075365_100182583 | 376 |
| 186 | 3300006048 | Ga0075363_100055032 | Ga0075363_1000550322 | 376 |
| 187 | 3300006051 | Ga0075364_10209901 | Ga0075364_102099012 | 376 |
| 188 | 3300006175 | Ga0070712_100123961 | Ga0070712_1001239611 | 376 |
| 189 | 3300006177 | Ga0075362_10012482 | Ga0075362_100124822 | 376 |
| 190 | 3300006178 | Ga0075367_10050617 | Ga0075367_100506171 | 376 |
| 191 | 3300006186 | Ga0075369_10096982 | Ga0075369_100969822 | 376 |
| 192 | 3300006195 | Ga0075366_10142000 | Ga0075366_101420001 | 376 |
| 193 | 3300006353 | Ga0075370_10000007 | Ga0075370_1000000759 | 376 |
| 194 | 3300006353 | Ga0075370_10040419 | Ga0075370_100404193 | 376 |
| 195 | 3300009098 | Ga0105245_10087320 | Ga0105245_100873202 | 376 |
| 196 | 3300009147 | Ga0114129_10399020 | Ga0114129_103990201 | 376 |
| 197 | 3300009148 | Ga0105243_10023246 | Ga0105243_100232463 | 376 |
| 198 | 3300009176 | Ga0105242_10133617 | Ga0105242_101336173 | 376 |
| 199 | 3300009177 | Ga0105248_10153966 | Ga0105248_101539663 | 376 |
| 200 | 3300011119 | Ga0105246_10083818 | Ga0105246_100838182 | 376 |
| 201 | 3300013296 | Ga0157374_10151270 | Ga0157374_101512702 | 376 |
| 202 | 3300013307 | Ga0157372_10133610 | Ga0157372_101336102 | 376 |
| 203 | 3300013308 | Ga0157375_10172571 | Ga0157375_101725712 | 376 |
| 204 | 3300014326 | Ga0157380_10028164 | Ga0157380_100281642 | 376 |
| 205 | 3300025901 | Ga0207688_10044607 | Ga0207688_100446072 | 376 |
| 206 | 3300025908 | Ga0207643_10151267 | Ga0207643_101512671 | 376 |
| 207 | 3300025910 | Ga0207684_10000750 | Ga0207684_1000075024 | 376 |
| 208 | 3300025910 | Ga0207684_10038811 | Ga0207684_100388111 | 376 |
| 209 | 3300025915 | Ga0207693_10092657 | Ga0207693_100926573 | 376 |
| 210 | 3300025922 | Ga0207646_10014781 | Ga0207646_100147815 | 376 |
| 211 | 3300025922 | Ga0207646_10085402 | Ga0207646_100854022 | 376 |
| 212 | 3300025927 | Ga0207687_10037929 | Ga0207687_100379292 | 376 |
| 213 | 3300025929 | Ga0207664_10003232 | Ga0207664_100032324 | 376 |
| 214 | 3300025935 | Ga0207709_10083363 | Ga0207709_100833632 | 376 |
| 215 | 3300025941 | Ga0207711_10276342 | Ga0207711_102763422 | 376 |
| 216 | 3300025944 | Ga0207661_10047497 | Ga0207661_100474972 | 376 |
| 217 | 3300026023 | Ga0207677_10187761 | Ga0207677_101877612 | 376 |
| 218 | 3300026067 | Ga0207678_10140873 | Ga0207678_101408731 | 376 |
| 219 | 3300026095 | Ga0207676_10204598 | Ga0207676_102045982 | 376 |
| 220 | 3300026121 | Ga0207683_10019848 | Ga0207683_100198483 | 376 |
| 221 | 3300027614 | Ga0209970_1000216 | Ga0209970_10002165 | 376 |
| 222 | 3300027866 | Ga0209813_10000538 | Ga0209813_100005387 | 376 |
| 223 | 3300027876 | Ga0209974_10008422 | Ga0209974_100084222 | 376 |
| 224 | 3300028381 | Ga0268264_10008180 | Ga0268264_100081805 | 376 |
| 225 | 3300031616 | Ga0307508_10007527 | Ga0307508_100075273 | 376 |
| 226 | 3300035170 | Ga0373943_0002887 | Ga0373943_0002887_2735_3904 | 376 |
| 227 | 3300035171 | Ga0373946_0015907 | Ga0373946_0015907_761_1930 | 376 |
| 228 | 3300035695 | Ga0373927_0023557 | Ga0373927_0023557_1593_2762 | 376 |
| 229 | 3300035725 | Ga0373947_0005518 | Ga0373947_0005518_4358_5527 | 376 |
| 230 | 3300036401 | Ga0373937_0204671 | Ga0373937_0204671_52_1197 | 376 |
| 231 | 3300037068 | Ga0373925_0015618 | Ga0373925_0015618_3904_5073 | 376 |
| 232 | 3300046519 | Ga0495632_0000071 | Ga0495632_0000071_25471_26610 | 376 |
| 233 | 3300046530 | Ga0495654_0092141 | Ga0495654_0092141_208_1377 | 376 |
| 234 | 3300046542 | Ga0495597_0001142 | Ga0495597_0001142_11260_12429 | 376 |
| 235 | 3300046558 | Ga0495633_0047771 | Ga0495633_0047771_313_1482 | 376 |
| 236 | 3300046616 | Ga0495668_0007365 | Ga0495668_0007365_2057_3226 | 376 |
| 237 | 3300046665 | Ga0495661_0012421 | Ga0495661_0012421_1457_2596 | 376 |
| 238 | 3300046683 | Ga0495658_0027317 | Ga0495658_0027317_1314_2534 | 376 |
| 239 | 3300046684 | Ga0495669_0000457 | Ga0495669_0000457_14078_15247 | 376 |
| 240 | 3300046810 | Ga0495660_0085296 | Ga0495660_0085296_231_1400 | 376 |
| 241 | 3300047315 | Ga0495581_0073713 | Ga0495581_0073713_23_1243 | 376 |
| 242 | 3300047443 | Ga0495687_000088 | Ga0495687_000088_125523_126668 | 376 |
| 243 | 3300047472 | Ga0495686_0116773 | Ga0495686_0116773_246_1415 | 376 |
| 244 | 3300048090 | Ga0495615_0002368 | Ga0495615_0002368_130_1299 | 376 |
| 245 | 3300048904 | Ga0496101_0134058 | Ga0496101_0134058_140_1360 | 376 |
| 246 | 3300048913 | Ga0496110_0078107 | Ga0496110_0078107_1177_2397 | 376 |
| 247 | 3300048915 | Ga0496112_0118720 | Ga0496112_0118720_1403_2548 | 376 |
| 248 | 3300048929 | Ga0496126_0000090 | Ga0496126_0000090_189215_190369 | 376 |
| 249 | 3300048929 | Ga0496126_0032887 | Ga0496126_0032887_1892_3043 | 376 |
| 250 | 3300050489 | nmdc:mga03683_591_c1 | nmdc:mga03683_591_c1_4740_5915 | 376 |
| 251 | 3300050490 | nmdc:mga03n38_20105_c1 | nmdc:mga03n38_20105_c1_875_2050 | 376 |
| 252 | 3300050491 | nmdc:mga00v17_139488_c1 | nmdc:mga00v17_139488_c1_63_1238 | 376 |
| 253 | 3300050493 | nmdc:mga0k408_161729_c1 | nmdc:mga0k408_161729_c1_20_1189 | 376 |
| 254 | 3300050494 | nmdc:mga06z11_231_c1 | nmdc:mga06z11_231_c1_19045_20220 | 376 |
| 255 | 3300050495 | nmdc:mga04h51_485_c1 | nmdc:mga04h51_485_c1_2501_3676 | 376 |
| 256 | 3300050496 | nmdc:mga07m45_116560_c1 | nmdc:mga07m45_116560_c1_76_1251 | 376 |
| 257 | 3300050496 | nmdc:mga07m45_263_c1 | nmdc:mga07m45_263_c1_14845_16020 | 376 |
| 258 | 3300050496 | nmdc:mga07m45_2_c1 | nmdc:mga07m45_2_c1_349462_350631 | 376 |
| 259 | 3300050516 | nmdc:mga0sz30_1776_c1 | nmdc:mga0sz30_1776_c1_83_1258 | 376 |
| 260 | 3300053087 | Ga0500643_006677 | Ga0500643_006677_2356_3522 | 376 |
| 261 | 3300053093 | Ga0500651_0002923 | Ga0500651_0002923_3851_5020 | 376 |
| 262 | 3300053094 | Ga0500566_0037686 | Ga0500566_0037686_443_1612 | 376 |
| 263 | 3300053096 | Ga0500641_0004583 | Ga0500641_0004583_3388_4557 | 376 |
| 264 | 3300053104 | Ga0500556_0049884 | Ga0500556_0049884_286_1455 | 376 |
| 265 | 3300053109 | Ga0500569_002802 | Ga0500569_002802_1856_3025 | 376 |
| 266 | 3300053122 | Ga0500608_000265 | Ga0500608_000265_18655_19824 | 376 |
| 267 | 3300053123 | Ga0500614_000567 | Ga0500614_000567_4491_5660 | 376 |
| 268 | 3300053125 | Ga0500618_004394 | Ga0500618_004394_2183_3352 | 376 |
| 269 | 3300053130 | Ga0500642_0000278 | Ga0500642_0000278_3924_5093 | 376 |
| 270 | 3300053131 | Ga0500652_003604 | Ga0500652_003604_3193_4362 | 376 |
| 271 | 3300053133 | Ga0500655_000670 | Ga0500655_000670_3909_5078 | 376 |
| 272 | 3300053136 | Ga0500559_0005405 | Ga0500559_0005405_2047_3216 | 376 |
| 273 | 3300053142 | Ga0500577_0004311 | Ga0500577_0004311_1428_2597 | 376 |
| 274 | 3300053148 | Ga0500590_021126 | Ga0500590_021126_1979_3148 | 376 |
| 275 | 3300053154 | Ga0500619_038130 | Ga0500619_038130_103_1272 | 376 |
| 276 | 3300053156 | Ga0500622_0006169 | Ga0500622_0006169_1947_3116 | 376 |
| 277 | 3300053157 | Ga0500624_000072 | Ga0500624_000072_5356_6522 | 376 |
| 278 | 3300053163 | Ga0500639_005154 | Ga0500639_005154_1643_2812 | 376 |
| 279 | 3300053177 | Ga0500636_0005061 | Ga0500636_0005061_1144_2310 | 376 |
| 280 | 3300053177 | Ga0500636_0120981 | Ga0500636_0120981_156_1325 | 376 |
| 281 | 3300053723 | Ga0500567_007296 | Ga0500567_007296_3225_4394 | 376 |
| 282 | 3300053724 | Ga0500570_000059 | Ga0500570_000059_12750_13919 | 376 |
| 283 | 3300053729 | Ga0500625_000003 | Ga0500625_000003_194327_195496 | 376 |
| 284 | 3300053730 | Ga0500645_004201 | Ga0500645_004201_293_1462 | 376 |
| 285 | 3300053730 | Ga0500645_005487 | Ga0500645_005487_3080_4255 | 376 |
| 286 | 3300053732 | Ga0500656_003807 | Ga0500656_003807_121_1290 | 376 |
| 287 | iso_pu_bacteria | 2534681786 | 2535487023 | 376 |
| 288 | iso_pu_bacteria | 2739367664 | 2739651477 | 376 |
| 289 | iso_pu_bacteria | 2739367865 | 2740029950 | 376 |
| 290 | iso_pu_bacteria | 2751185800 | 2753357145 | 376 |
| 291 | iso_pu_bacteria | 2818991463 | 2819694293 | 376 |
| 292 | iso_pu_bacteria | 2915650412 | 2915654387 | 376 |
| 293 | iso_pu_bacteria | 2989776772 | 2989781214 | 376 |
| 294 | 3300005331 | Ga0070670_100126234 | Ga0070670_1001262342 | 377 |
| 295 | 3300005336 | Ga0070680_100000727 | Ga0070680_10000072716 | 377 |
| 296 | 3300005344 | Ga0070661_100000001 | Ga0070661_100000001342 | 377 |
| 297 | 3300005345 | Ga0070692_10000276 | Ga0070692_1000027615 | 377 |
| 298 | 3300005353 | Ga0070669_100106120 | Ga0070669_1001061202 | 377 |
| 299 | 3300005435 | Ga0070714_100109168 | Ga0070714_1001091682 | 377 |
| 300 | 3300005436 | Ga0070713_100003580 | Ga0070713_1000035805 | 377 |
| 301 | 3300005456 | Ga0070678_100227437 | Ga0070678_1002274372 | 377 |
| 302 | 3300005458 | Ga0070681_10014042 | Ga0070681_100140425 | 377 |
| 303 | 3300005530 | Ga0070679_100000003 | Ga0070679_100000003153 | 377 |
| 304 | 3300005535 | Ga0070684_100183359 | Ga0070684_1001833592 | 377 |
| 305 | 3300005539 | Ga0068853_100018340 | Ga0068853_1000183405 | 377 |
| 306 | 3300005544 | Ga0070686_100000140 | Ga0070686_10000014052 | 377 |
| 307 | 3300005614 | Ga0068856_100214593 | Ga0068856_1002145932 | 377 |
| 308 | 3300005841 | Ga0068863_100059233 | Ga0068863_1000592333 | 377 |
| 309 | 3300005937 | Ga0081455_10001460 | Ga0081455_100014604 | 377 |
| 310 | 3300006028 | Ga0070717_10002935 | Ga0070717_100029357 | 377 |
| 311 | 3300013307 | Ga0157372_10037866 | Ga0157372_100378665 | 377 |
| 312 | 3300020070 | Ga0206356_10774019 | Ga0206356_107740191 | 377 |
| 313 | 3300025291 | Ga0209675_1002733 | Ga0209675_10027336 | 377 |
| 314 | 3300025912 | Ga0207707_10010643 | Ga0207707_100106434 | 377 |
| 315 | 3300025917 | Ga0207660_10000078 | Ga0207660_100000789 | 377 |
| 316 | 3300025920 | Ga0207649_10000011 | Ga0207649_10000011156 | 377 |
| 317 | 3300025921 | Ga0207652_10000004 | Ga0207652_10000004152 | 377 |
| 318 | 3300025923 | Ga0207681_10115709 | Ga0207681_101157093 | 377 |
| 319 | 3300025927 | Ga0207687_10013831 | Ga0207687_100138314 | 377 |
| 320 | 3300025928 | Ga0207700_10003514 | Ga0207700_100035143 | 377 |
| 321 | 3300026078 | Ga0207702_10293593 | Ga0207702_102935932 | 377 |
| 322 | 3300026088 | Ga0207641_10046616 | Ga0207641_100466163 | 377 |
| 323 | 3300031456 | Ga0307513_10015291 | Ga0307513_100152917 | 377 |
| 324 | 3300031665 | Ga0316575_10004304 | Ga0316575_100043043 | 377 |
| 325 | 3300031691 | Ga0316579_10003150 | Ga0316579_100031502 | 377 |
| 326 | 3300031728 | Ga0316578_10004181 | Ga0316578_100041813 | 377 |
| 327 | 3300031733 | Ga0316577_10006191 | Ga0316577_100061913 | 377 |
| 328 | 3300031901 | Ga0307406_10059244 | Ga0307406_100592443 | 377 |
| 329 | 3300031995 | Ga0307409_100052099 | Ga0307409_1000520993 | 377 |
| 330 | 3300032002 | Ga0307416_100024842 | Ga0307416_1000248423 | 377 |
| 331 | 3300032126 | Ga0307415_100000216 | Ga0307415_10000021615 | 377 |
| 332 | 3300032133 | Ga0316583_10005971 | Ga0316583_100059713 | 377 |
| 333 | 3300035398 | Ga0316574_0007755 | Ga0316574_0007755_1531_2691 | 377 |
| 334 | 3300036647 | Ga0316582_0012322 | Ga0316582_0012322_2087_3247 | 377 |
| 335 | 3300036647 | Ga0316582_0029496 | Ga0316582_0029496_1529_2689 | 377 |
| 336 | 3300036712 | Ga0316584_0024929 | Ga0316584_0024929_2361_3521 | 377 |
| 337 | 3300037466 | Ga0395898_0002667 | Ga0395898_0002667_19049_20206 | 377 |
| 338 | 3300037466 | Ga0395898_0228097 | Ga0395898_0228097_106_1251 | 377 |
| 339 | 3300037588 | Ga0316581_0002782 | Ga0316581_0002782_1460_2620 | 377 |
| 340 | 3300039145 | Ga0237816_00675 | Ga0237816_00675_797_1939 | 377 |
| 341 | 3300039437 | Ga0436365_1862304 | Ga0436365_1862304_19827_20969 | 377 |
| 342 | 3300041443 | Ga0451789_0160161 | Ga0451789_0160161_80_1237 | 377 |
| 343 | 3300045976 | Ga0466967_0210765 | Ga0466967_0210765_484_1716 | 377 |
| 344 | 3300046471 | Ga0495650_0064296 | Ga0495650_0064296_234_1391 | 377 |
| 345 | 3300046616 | Ga0495668_0002749 | Ga0495668_0002749_2099_3250 | 377 |
| 346 | 3300046616 | Ga0495668_0006888 | Ga0495668_0006888_4842_5993 | 377 |
| 347 | 3300046691 | Ga0495670_0044048 | Ga0495670_0044048_893_2044 | 377 |
| 348 | 3300046692 | Ga0495671_0088770 | Ga0495671_0088770_266_1408 | 377 |
| 349 | 3300048915 | Ga0496112_0231596 | Ga0496112_0231596_434_1579 | 377 |
| 350 | 3300049459 | Ga0495678_018010 | Ga0495678_018010_1382_2533 | 377 |
| 351 | 3300049742 | Ga0501080_0216113 | Ga0501080_0216113_398_1549 | 377 |
| 352 | 3300050512 | nmdc:mga0n895_25306_c1 | nmdc:mga0n895_25306_c1_2399_3541 | 377 |
| 353 | 3300053087 | Ga0500643_010806 | Ga0500643_010806_531_1676 | 377 |
| 354 | 3300053087 | Ga0500643_036052 | Ga0500643_036052_121_1266 | 377 |
| 355 | 3300053116 | Ga0500592_000770 | Ga0500592_000770_1716_2867 | 377 |
| 356 | 3300053146 | Ga0500588_0000198 | Ga0500588_0000198_2862_4028 | 377 |
| 357 | 3300053153 | Ga0500616_0002610 | Ga0500616_0002610_12556_13788 | 377 |
| 358 | 3300053153 | Ga0500616_0002923 | Ga0500616_0002923_9956_11191 | 377 |
| 359 | 3300053158 | Ga0500627_0000297 | Ga0500627_0000297_10587_11738 | 377 |
| 360 | iso_pu_bacteria | 2828305725 | 2828307547 | 377 |
| 361 | 3300003791 | Ga0055530_10000579 | Ga0055530_100005795 | 378 |
| 362 | 3300005331 | Ga0070670_100000981 | Ga0070670_10000098110 | 378 |
| 363 | 3300005331 | Ga0070670_100026142 | Ga0070670_1000261422 | 378 |
| 364 | 3300005335 | Ga0070666_10191773 | Ga0070666_101917731 | 378 |
| 365 | 3300005347 | Ga0070668_100000013 | Ga0070668_100000013102 | 378 |
| 366 | 3300005347 | Ga0070668_100002822 | Ga0070668_1000028222 | 378 |
| 367 | 3300005353 | Ga0070669_100006287 | Ga0070669_1000062876 | 378 |
| 368 | 3300005353 | Ga0070669_100019626 | Ga0070669_1000196264 | 378 |
| 369 | 3300005355 | Ga0070671_100000225 | Ga0070671_10000022526 | 378 |
| 370 | 3300005355 | Ga0070671_100038951 | Ga0070671_1000389512 | 378 |
| 371 | 3300005367 | Ga0070667_100000328 | Ga0070667_10000032810 | 378 |
| 372 | 3300005367 | Ga0070667_100000413 | Ga0070667_10000041312 | 378 |
| 373 | 3300005367 | Ga0070667_100000889 | Ga0070667_1000008894 | 378 |
| 374 | 3300005466 | Ga0070685_10000593 | Ga0070685_1000059312 | 378 |
| 375 | 3300005548 | Ga0070665_100024985 | Ga0070665_1000249853 | 378 |
| 376 | 3300005617 | Ga0068859_100013326 | Ga0068859_1000133263 | 378 |
| 377 | 3300005617 | Ga0068859_100143598 | Ga0068859_1001435982 | 378 |
| 378 | 3300005618 | Ga0068864_100001706 | Ga0068864_1000017067 | 378 |
| 379 | 3300005618 | Ga0068864_100017608 | Ga0068864_1000176081 | 378 |
| 380 | 3300005719 | Ga0068861_100015250 | Ga0068861_1000152504 | 378 |
| 381 | 3300005841 | Ga0068863_100000293 | Ga0068863_10000029312 | 378 |
| 382 | 3300005841 | Ga0068863_100000466 | Ga0068863_10000046641 | 378 |
| 383 | 3300005841 | Ga0068863_100000646 | Ga0068863_1000006468 | 378 |
| 384 | 3300005841 | Ga0068863_100004472 | Ga0068863_10000447210 | 378 |
| 385 | 3300005841 | Ga0068863_100012390 | Ga0068863_1000123905 | 378 |
| 386 | 3300005841 | Ga0068863_100016521 | Ga0068863_1000165215 | 378 |
| 387 | 3300005841 | Ga0068863_100054023 | Ga0068863_1000540233 | 378 |
| 388 | 3300005842 | Ga0068858_100000374 | Ga0068858_1000003744 | 378 |
| 389 | 3300005842 | Ga0068858_100174174 | Ga0068858_1001741741 | 378 |
| 390 | 3300005843 | Ga0068860_100000436 | Ga0068860_10000043610 | 378 |
| 391 | 3300005843 | Ga0068860_100000473 | Ga0068860_1000004734 | 378 |
| 392 | 3300005843 | Ga0068860_100000638 | Ga0068860_10000063821 | 378 |
| 393 | 3300005844 | Ga0068862_100001919 | Ga0068862_1000019198 | 378 |
| 394 | 3300006931 | Ga0097620_100013326 | Ga0097620_1000133263 | 378 |
| 395 | 3300006931 | Ga0097620_100143601 | Ga0097620_1001436012 | 378 |
| 396 | 3300009177 | Ga0105248_10003501 | Ga0105248_1000350110 | 378 |
| 397 | 3300009551 | Ga0105238_10014995 | Ga0105238_100149952 | 378 |
| 398 | 3300009553 | Ga0105249_10026960 | Ga0105249_100269603 | 378 |
| 399 | 3300009553 | Ga0105249_10257053 | Ga0105249_102570532 | 378 |
| 400 | 3300014325 | Ga0163163_10012463 | Ga0163163_100124638 | 378 |
| 401 | 3300014497 | Ga0182008_10002889 | Ga0182008_100028892 | 378 |
| 402 | 3300014968 | Ga0157379_10009393 | Ga0157379_100093936 | 378 |
| 403 | 3300015261 | Ga0182006_1000214 | Ga0182006_100021421 | 378 |
| 404 | 3300025297 | Ga0209758_1000924 | Ga0209758_100092427 | 378 |
| 405 | 3300025298 | Ga0209050_1000049 | Ga0209050_100004914 | 378 |
| 406 | 3300025304 | Ga0209257_1000692 | Ga0209257_100069218 | 378 |
| 407 | 3300025304 | Ga0209257_1018524 | Ga0209257_10185243 | 378 |
| 408 | 3300025903 | Ga0207680_10021518 | Ga0207680_100215183 | 378 |
| 409 | 3300025913 | Ga0207695_10094525 | Ga0207695_100945253 | 378 |
| 410 | 3300025923 | Ga0207681_10006820 | Ga0207681_100068203 | 378 |
| 411 | 3300025924 | Ga0207694_10052642 | Ga0207694_100526425 | 378 |
| 412 | 3300025925 | Ga0207650_10059019 | Ga0207650_100590192 | 378 |
| 413 | 3300025931 | Ga0207644_10000398 | Ga0207644_1000039818 | 378 |
| 414 | 3300025941 | Ga0207711_10000552 | Ga0207711_1000055215 | 378 |
| 415 | 3300025941 | Ga0207711_10001339 | Ga0207711_1000133925 | 378 |
| 416 | 3300025961 | Ga0207712_10124398 | Ga0207712_101243982 | 378 |
| 417 | 3300025972 | Ga0207668_10000022 | Ga0207668_100000226 | 378 |
| 418 | 3300025972 | Ga0207668_10000132 | Ga0207668_1000013237 | 378 |
| 419 | 3300025986 | Ga0207658_10000021 | Ga0207658_10000021164 | 378 |
| 420 | 3300025986 | Ga0207658_10000269 | Ga0207658_1000026938 | 378 |
| 421 | 3300025986 | Ga0207658_10000646 | Ga0207658_1000064624 | 378 |
| 422 | 3300025986 | Ga0207658_10024951 | Ga0207658_100249512 | 378 |
| 423 | 3300026035 | Ga0207703_10000309 | Ga0207703_1000030937 | 378 |
| 424 | 3300026035 | Ga0207703_10022814 | Ga0207703_100228142 | 378 |
| 425 | 3300026088 | Ga0207641_10000040 | Ga0207641_10000040162 | 378 |
| 426 | 3300026088 | Ga0207641_10000098 | Ga0207641_1000009863 | 378 |
| 427 | 3300026088 | Ga0207641_10000303 | Ga0207641_100003038 | 378 |
| 428 | 3300026088 | Ga0207641_10003348 | Ga0207641_1000334810 | 378 |
| 429 | 3300026088 | Ga0207641_10004850 | Ga0207641_100048508 | 378 |
| 430 | 3300026095 | Ga0207676_10000538 | Ga0207676_100005387 | 378 |
| 431 | 3300026118 | Ga0207675_100040137 | Ga0207675_1000401373 | 378 |
| 432 | 3300028379 | Ga0268266_10016499 | Ga0268266_100164994 | 378 |
| 433 | 3300028380 | Ga0268265_10000536 | Ga0268265_1000053632 | 378 |
| 434 | 3300028380 | Ga0268265_10001938 | Ga0268265_100019384 | 378 |
| 435 | 3300028381 | Ga0268264_10000224 | Ga0268264_1000022455 | 378 |
| 436 | 3300028381 | Ga0268264_10000448 | Ga0268264_1000044810 | 378 |
| 437 | 3300028381 | Ga0268264_10000670 | Ga0268264_1000067033 | 378 |
| 438 | 3300031548 | Ga0307408_100184728 | Ga0307408_1001847282 | 378 |
| 439 | 3300031730 | Ga0307516_10000780 | Ga0307516_1000078016 | 378 |
| 440 | 3300038443 | Ga0395901_0356252 | Ga0395901_0356252_345_1493 | 378 |
| 441 | 3300039093 | Ga0400489_74021 | Ga0400489_74021_66426_67574 | 378 |
| 442 | 3300041413 | Ga0439465_0003542 | Ga0439465_0003542_2566_3729 | 378 |
| 443 | 3300041997 | Ga0439431_0009881 | Ga0439431_0009881_425_1588 | 378 |
| 444 | 3300041999 | Ga0439433_0016132 | Ga0439433_0016132_152_1315 | 378 |
| 445 | 3300042004 | Ga0439445_0001721 | Ga0439445_0001721_1359_2522 | 378 |
| 446 | 3300042006 | Ga0439432_013107 | Ga0439432_013107_1107_2270 | 378 |
| 447 | 3300042010 | Ga0439452_002901 | Ga0439452_002901_990_2153 | 378 |
| 448 | 3300042015 | Ga0439462_0002353 | Ga0439462_0002353_1631_2794 | 378 |
| 449 | 3300042876 | Ga0451577_0009675 | Ga0451577_0009675_4392_5549 | 378 |
| 450 | 3300044712 | Ga0453684_0001067 | Ga0453684_0001067_54681_55838 | 378 |
| 451 | 3300044712 | Ga0453684_0005158 | Ga0453684_0005158_1689_2846 | 378 |
| 452 | 3300044712 | Ga0453684_0013899 | Ga0453684_0013899_6874_8031 | 378 |
| 453 | 3300046474 | Ga0495605_0085363 | Ga0495605_0085363_196_1347 | 378 |
| 454 | 3300046518 | Ga0495631_0002618 | Ga0495631_0002618_6789_7940 | 378 |
| 455 | 3300046519 | Ga0495632_0017991 | Ga0495632_0017991_2095_3246 | 378 |
| 456 | 3300046648 | Ga0495611_0005124 | Ga0495611_0005124_327_1475 | 378 |
| 457 | 3300046660 | Ga0495625_0009987 | Ga0495625_0009987_3759_4910 | 378 |
| 458 | 3300047317 | Ga0495604_0000217 | Ga0495604_0000217_3367_4518 | 378 |
| 459 | 3300047472 | Ga0495686_0045107 | Ga0495686_0045107_422_1573 | 378 |
| 460 | 3300048905 | Ga0496102_0019796 | Ga0496102_0019796_253_1401 | 378 |
| 461 | 3300048907 | Ga0496104_0024889 | Ga0496104_0024889_3388_4578 | 378 |
| 462 | 3300048908 | Ga0496105_0001303 | Ga0496105_0001303_8715_9905 | 378 |
| 463 | 3300048920 | Ga0496117_0011109 | Ga0496117_0011109_4805_5995 | 378 |
| 464 | 3300048922 | Ga0496119_0012959 | Ga0496119_0012959_2095_3285 | 378 |
| 465 | 3300048922 | Ga0496119_0059160 | Ga0496119_0059160_581_1729 | 378 |
| 466 | 3300048924 | Ga0496121_0000130 | Ga0496121_0000130_67813_68961 | 378 |
| 467 | 3300048924 | Ga0496121_0010155 | Ga0496121_0010155_6516_7706 | 378 |
| 468 | 3300048924 | Ga0496121_0054278 | Ga0496121_0054278_234_1424 | 378 |
| 469 | 3300048927 | Ga0496124_0004245 | Ga0496124_0004245_11595_12785 | 378 |
| 470 | 3300049459 | Ga0495678_005337 | Ga0495678_005337_3142_4293 | 378 |
| 471 | 3300049573 | Ga0501037_0007425 | Ga0501037_0007425_2295_3455 | 378 |
| 472 | 3300049581 | Ga0501047_0003160 | Ga0501047_0003160_10180_11328 | 378 |
| 473 | 3300049588 | Ga0501072_0109871 | Ga0501072_0109871_493_1653 | 378 |
| 474 | 3300049589 | Ga0501073_0000068 | Ga0501073_0000068_1177_2337 | 378 |
| 475 | 3300049593 | Ga0501077_0000056 | Ga0501077_0000056_35554_36714 | 378 |
| 476 | 3300049671 | Ga0501238_002816 | Ga0501238_002816_383_1531 | 378 |
| 477 | 3300049823 | Ga0501044_0087580 | Ga0501044_0087580_187_1347 | 378 |
| 478 | 3300053118 | Ga0500594_0002724 | Ga0500594_0002724_2192_3343 | 378 |
| 479 | 3300053125 | Ga0500618_000833 | Ga0500618_000833_6640_7791 | 378 |
| 480 | 3300053125 | Ga0500618_006225 | Ga0500618_006225_1470_2621 | 378 |
| 481 | 3300053134 | Ga0500658_0000047 | Ga0500658_0000047_29118_30266 | 378 |
| 482 | 3300053136 | Ga0500559_0000442 | Ga0500559_0000442_11592_12743 | 378 |
| 483 | iso_pu_bacteria | 2558860112 | 2558911688 | 378 |
| 484 | iso_pu_bacteria | 2675902999 | 2676202151 | 378 |
| 485 | 3300003187 | JGI25151J46595_10000228 | JGI25151J46595_1000022829 | 379 |
| 486 | 3300005844 | Ga0068862_100230441 | Ga0068862_1002304411 | 379 |
| 487 | 3300006042 | Ga0075368_10004106 | Ga0075368_100041064 | 379 |
| 488 | 3300006177 | Ga0075362_10058785 | Ga0075362_100587852 | 379 |
| 489 | 3300006195 | Ga0075366_10001326 | Ga0075366_100013262 | 379 |
| 490 | 3300009036 | Ga0105244_10035746 | Ga0105244_100357463 | 379 |
| 491 | 3300009094 | Ga0111539_10006194 | Ga0111539_100061943 | 379 |
| 492 | 3300013102 | Ga0157371_10003600 | Ga0157371_100036003 | 379 |
| 493 | 3300014326 | Ga0157380_10195109 | Ga0157380_101951092 | 379 |
| 494 | 3300020082 | Ga0206353_11669705 | Ga0206353_116697052 | 379 |
| 495 | 3300025294 | Ga0209025_1000019 | Ga0209025_1000019308 | 379 |
| 496 | 3300026142 | Ga0207698_10137939 | Ga0207698_101379392 | 379 |
| 497 | 3300027907 | Ga0207428_10000092 | Ga0207428_1000009235 | 379 |
| 498 | 3300028556 | Ga0265337_1009722 | Ga0265337_10097223 | 379 |
| 499 | 3300028794 | Ga0307515_10083866 | Ga0307515_100838661 | 379 |
| 500 | 3300031240 | Ga0265320_10001604 | Ga0265320_100016048 | 379 |
| 501 | 3300031456 | Ga0307513_10000012 | Ga0307513_10000012281 | 379 |
| 502 | 3300031456 | Ga0307513_10132955 | Ga0307513_101329552 | 379 |
| 503 | 3300031711 | Ga0265314_10004285 | Ga0265314_1000428511 | 379 |
| 504 | 3300031711 | Ga0265314_10017039 | Ga0265314_100170392 | 379 |
| 505 | 3300031733 | Ga0316577_10045703 | Ga0316577_100457032 | 379 |
| 506 | 3300031911 | Ga0307412_10002104 | Ga0307412_100021042 | 379 |
| 507 | 3300032002 | Ga0307416_100142383 | Ga0307416_1001423832 | 379 |
| 508 | 3300037471 | Ga0395905_0126226 | Ga0395905_0126226_156_1397 | 379 |
| 509 | 3300044694 | Ga0466963_0009063 | Ga0466963_0009063_2415_3575 | 379 |
| 510 | 3300044694 | Ga0466963_0017004 | Ga0466963_0017004_2939_4111 | 379 |
| 511 | 3300045976 | Ga0466967_0139468 | Ga0466967_0139468_877_2037 | 379 |
| 512 | 3300046452 | Ga0495617_001554 | Ga0495617_001554_4924_6078 | 379 |
| 513 | 3300046453 | Ga0495627_000014 | Ga0495627_000014_129557_130711 | 379 |
| 514 | 3300046460 | Ga0495638_0000574 | Ga0495638_0000574_2977_4131 | 379 |
| 515 | 3300046501 | Ga0495607_0004169 | Ga0495607_0004169_4985_6139 | 379 |
| 516 | 3300046512 | Ga0495610_0001425 | Ga0495610_0001425_7702_8853 | 379 |
| 517 | 3300046522 | Ga0495643_0079766 | Ga0495643_0079766_529_1689 | 379 |
| 518 | 3300046538 | Ga0495609_0011105 | Ga0495609_0011105_2458_3624 | 379 |
| 519 | 3300046542 | Ga0495597_0001324 | Ga0495597_0001324_15210_16376 | 379 |
| 520 | 3300046692 | Ga0495671_0052407 | Ga0495671_0052407_571_1818 | 379 |
| 521 | 3300048916 | Ga0496113_0128734 | Ga0496113_0128734_437_1603 | 379 |
| 522 | 3300048919 | Ga0496116_0009863 | Ga0496116_0009863_4960_6108 | 379 |
| 523 | 3300048919 | Ga0496116_0064990 | Ga0496116_0064990_728_1876 | 379 |
| 524 | 3300048921 | Ga0496118_0107692 | Ga0496118_0107692_613_1761 | 379 |
| 525 | 3300048923 | Ga0496120_0062689 | Ga0496120_0062689_865_2013 | 379 |
| 526 | 3300048924 | Ga0496121_0003287 | Ga0496121_0003287_11804_12952 | 379 |
| 527 | 3300048924 | Ga0496121_0015854 | Ga0496121_0015854_4583_5734 | 379 |
| 528 | 3300048925 | Ga0496122_0000497 | Ga0496122_0000497_29937_31085 | 379 |
| 529 | 3300048925 | Ga0496122_0017319 | Ga0496122_0017319_4882_6030 | 379 |
| 530 | 3300048926 | Ga0496123_0001884 | Ga0496123_0001884_9101_10249 | 379 |
| 531 | 3300048926 | Ga0496123_0013777 | Ga0496123_0013777_3140_4288 | 379 |
| 532 | 3300048927 | Ga0496124_0043872 | Ga0496124_0043872_51_1199 | 379 |
| 533 | 3300048927 | Ga0496124_0054741 | Ga0496124_0054741_1793_2941 | 379 |
| 534 | 3300048928 | Ga0496125_0000166 | Ga0496125_0000166_56925_58073 | 379 |
| 535 | 3300048928 | Ga0496125_0016464 | Ga0496125_0016464_3953_5101 | 379 |
| 536 | 3300048928 | Ga0496125_0136526 | Ga0496125_0136526_147_1328 | 379 |
| 537 | 3300048928 | Ga0496125_0189022 | Ga0496125_0189022_63_1211 | 379 |
| 538 | 3300048929 | Ga0496126_0032209 | Ga0496126_0032209_2122_3270 | 379 |
| 539 | 3300049570 | Ga0501033_0037756 | Ga0501033_0037756_755_1906 | 379 |
| 540 | 3300049571 | Ga0501034_0000874 | Ga0501034_0000874_17205_18362 | 379 |
| 541 | 3300049571 | Ga0501034_0001048 | Ga0501034_0001048_12258_13421 | 379 |
| 542 | 3300049571 | Ga0501034_0163474 | Ga0501034_0163474_459_1610 | 379 |
| 543 | 3300049581 | Ga0501047_0001179 | Ga0501047_0001179_24070_25221 | 379 |
| 544 | 3300049822 | Ga0501035_0060943 | Ga0501035_0060943_1424_2575 | 379 |
| 545 | 3300049823 | Ga0501044_0008276 | Ga0501044_0008276_4174_5325 | 379 |
| 546 | 3300049823 | Ga0501044_0010514 | Ga0501044_0010514_969_2108 | 379 |
| 547 | 3300050489 | nmdc:mga03683_38552_c1 | nmdc:mga03683_38552_c1_346_1491 | 379 |
| 548 | 3300050511 | nmdc:mga08y16_46_c1 | nmdc:mga08y16_46_c1_70283_71428 | 379 |
| 549 | 3300053088 | Ga0500644_0008259 | Ga0500644_0008259_66_1220 | 379 |
| 550 | 3300053136 | Ga0500559_0002100 | Ga0500559_0002100_6175_7329 | 379 |
| 551 | 3300053142 | Ga0500577_0007102 | Ga0500577_0007102_143_1282 | 379 |
| 552 | 3300053153 | Ga0500616_0000108 | Ga0500616_0000108_22126_23280 | 379 |
| 553 | 3300053153 | Ga0500616_0001953 | Ga0500616_0001953_1788_2927 | 379 |
| 554 | 3300053156 | Ga0500622_0000937 | Ga0500622_0000937_835_1989 | 379 |
| 555 | 3300053157 | Ga0500624_000210 | Ga0500624_000210_3611_4771 | 379 |
| 556 | 3300048926 | Ga0496123_0047399 | Ga0496123_0047399_1207_2349 | 380 |
| 557 | iso_pu_bacteria | 2513237150 | 2513954612 | 381 |
| 558 | iso_pu_bacteria | 2513237165 | 2514043503 | 381 |
| 559 | iso_pu_bacteria | 2596583598 | 2597031435 | 381 |
| 560 | iso_pu_bacteria | 2599185178 | 2599445216 | 381 |
| 561 | iso_pu_bacteria | 2791355137 | 2792833517 | 381 |
| 562 | iso_pu_bacteria | 2834641062 | 2834643682 | 381 |
| 563 | iso_pu_bacteria | 2885266251 | 2885270335 | 381 |
| 564 | iso_pu_bacteria | 2900577576 | 2900580497 | 381 |
| 565 | iso_pu_bacteria | 2901300506 | 2901311801 | 381 |
| 566 | iso_pu_bacteria | 2928058823 | 2928063790 | 381 |
| 567 | iso_pu_bacteria | 644736347 | 644752294 | 381 |
| 568 | iso_pu_bacteria | 8003400568 | 8003405068 | 381 |
| 569 | iso_pu_bacteria | 8048746797 | 8048749669 | 381 |
| 570 | 3300001915 | JGI24741J21665_1000448 | JGI24741J21665_10004488 | 385 |
| 571 | 3300001979 | JGI24740J21852_10000149 | JGI24740J21852_100001494 | 385 |
| 572 | 3300001979 | JGI24740J21852_10000159 | JGI24740J21852_100001596 | 385 |
| 573 | 3300002705 | JGI25156J39149_1007314 | JGI25156J39149_10073143 | 385 |
| 574 | 3300002738 | JGI25154J39366_1001599 | JGI25154J39366_10015994 | 385 |
| 575 | 3300003187 | JGI25151J46595_10001462 | JGI25151J46595_1000146212 | 385 |
| 576 | 3300003752 | Ga0055539_1000086 | Ga0055539_1000086101 | 385 |
| 577 | 3300003756 | Ga0055533_1001557 | Ga0055533_10015574 | 385 |
| 578 | 3300003758 | Ga0055532_1000041 | Ga0055532_100004154 | 385 |
| 579 | 3300003761 | Ga0055535_1000030 | Ga0055535_1000030123 | 385 |
| 580 | 3300003762 | Ga0055542_1000818 | Ga0055542_10008184 | 385 |
| 581 | 3300003763 | Ga0055529_1000058 | Ga0055529_100005854 | 385 |
| 582 | 3300003771 | Ga0055526_1011710 | Ga0055526_10117104 | 385 |
| 583 | 3300003775 | Ga0055524_1001952 | Ga0055524_10019522 | 385 |
| 584 | 3300003781 | Ga0055536_1000114 | Ga0055536_100011440 | 385 |
| 585 | 3300003784 | Ga0055534_1003641 | Ga0055534_10036414 | 385 |
| 586 | 3300003841 | Ga0055541_1001902 | Ga0055541_10019024 | 385 |
| 587 | 3300005344 | Ga0070661_100000072 | Ga0070661_10000007255 | 385 |
| 588 | 3300005455 | Ga0070663_100000015 | Ga0070663_10000001565 | 385 |
| 589 | 3300005456 | Ga0070678_100258433 | Ga0070678_1002584332 | 385 |
| 590 | 3300005543 | Ga0070672_100198775 | Ga0070672_1001987752 | 385 |
| 591 | 3300005548 | Ga0070665_100146602 | Ga0070665_1001466022 | 385 |
| 592 | 3300005564 | Ga0070664_100000058 | Ga0070664_1000000588 | 385 |
| 593 | 3300005577 | Ga0068857_100029386 | Ga0068857_1000293863 | 385 |
| 594 | 3300005578 | Ga0068854_100000025 | Ga0068854_10000002557 | 385 |
| 595 | 3300005614 | Ga0068856_100000084 | Ga0068856_10000008456 | 385 |
| 596 | 3300006880 | Ga0075429_100001204 | Ga0075429_10000120419 | 385 |
| 597 | 3300006948 | Ga0099826_10000107 | Ga0099826_1000010713 | 385 |
| 598 | 3300009093 | Ga0105240_10143133 | Ga0105240_101431332 | 385 |
| 599 | 3300013100 | Ga0157373_10008055 | Ga0157373_100080554 | 385 |
| 600 | 3300013102 | Ga0157371_10000100 | Ga0157371_1000010056 | 385 |
| 601 | 3300013104 | Ga0157370_10000004 | Ga0157370_1000000457 | 385 |
| 602 | 3300013105 | Ga0157369_10034953 | Ga0157369_100349534 | 385 |
| 603 | 3300013307 | Ga0157372_10000279 | Ga0157372_1000027931 | 385 |
| 604 | 3300013308 | Ga0157375_10108322 | Ga0157375_101083222 | 385 |
| 605 | 3300014969 | Ga0157376_10337921 | Ga0157376_103379212 | 385 |
| 606 | 3300015261 | Ga0182006_1001983 | Ga0182006_10019833 | 385 |
| 607 | 3300020076 | Ga0206355_1007462 | Ga0206355_10074621 | 385 |
| 608 | 3300020610 | Ga0154015_1588421 | Ga0154015_15884215 | 385 |
| 609 | 3300025224 | Ga0209784_100029 | Ga0209784_100029281 | 385 |
| 610 | 3300025224 | Ga0209784_100853 | Ga0209784_1008534 | 385 |
| 611 | 3300025224 | Ga0209784_101137 | Ga0209784_1011374 | 385 |
| 612 | 3300025225 | Ga0209566_100030 | Ga0209566_10003057 | 385 |
| 613 | 3300025225 | Ga0209566_100277 | Ga0209566_10027729 | 385 |
| 614 | 3300025225 | Ga0209566_101363 | Ga0209566_1013634 | 385 |
| 615 | 3300025226 | Ga0209674_100081 | Ga0209674_10008169 | 385 |
| 616 | 3300025226 | Ga0209674_100089 | Ga0209674_10008937 | 385 |
| 617 | 3300025226 | Ga0209674_100123 | Ga0209674_10012362 | 385 |
| 618 | 3300025226 | Ga0209674_102250 | Ga0209674_1022504 | 385 |
| 619 | 3300025228 | Ga0209672_101786 | Ga0209672_1017863 | 385 |
| 620 | 3300025229 | Ga0209147_100008 | Ga0209147_100008667 | 385 |
| 621 | 3300025230 | Ga0209563_100091 | Ga0209563_10009123 | 385 |
| 622 | 3300025230 | Ga0209563_100092 | Ga0209563_100092128 | 385 |
| 623 | 3300025242 | Ga0209258_100013 | Ga0209258_100013667 | 385 |
| 624 | 3300025246 | Ga0209646_1000065 | Ga0209646_1000065107 | 385 |
| 625 | 3300025250 | Ga0209026_1009936 | Ga0209026_10099362 | 385 |
| 626 | 3300025253 | Ga0209677_100030 | Ga0209677_10003057 | 385 |
| 627 | 3300025254 | Ga0209148_1000113 | Ga0209148_1000113118 | 385 |
| 628 | 3300025254 | Ga0209148_1008463 | Ga0209148_10084632 | 385 |
| 629 | 3300025256 | Ga0209759_1001532 | Ga0209759_10015323 | 385 |
| 630 | 3300025256 | Ga0209759_1005701 | Ga0209759_10057012 | 385 |
| 631 | 3300025263 | Ga0209565_1000659 | Ga0209565_10006595 | 385 |
| 632 | 3300025272 | Ga0209455_1000106 | Ga0209455_100010656 | 385 |
| 633 | 3300025291 | Ga0209675_1000092 | Ga0209675_100009238 | 385 |
| 634 | 3300025291 | Ga0209675_1000903 | Ga0209675_100090310 | 385 |
| 635 | 3300025292 | Ga0209676_1000378 | Ga0209676_100037840 | 385 |
| 636 | 3300025294 | Ga0209025_1000125 | Ga0209025_1000125156 | 385 |
| 637 | 3300025294 | Ga0209025_1000222 | Ga0209025_100022284 | 385 |
| 638 | 3300025294 | Ga0209025_1000837 | Ga0209025_100083741 | 385 |
| 639 | 3300025294 | Ga0209025_1001562 | Ga0209025_10015629 | 385 |
| 640 | 3300025294 | Ga0209025_1019959 | Ga0209025_10199591 | 385 |
| 641 | 3300025295 | Ga0209564_1000489 | Ga0209564_100048946 | 385 |
| 642 | 3300025295 | Ga0209564_1000655 | Ga0209564_100065517 | 385 |
| 643 | 3300025295 | Ga0209564_1001585 | Ga0209564_100158513 | 385 |
| 644 | 3300025297 | Ga0209758_1018355 | Ga0209758_10183552 | 385 |
| 645 | 3300025299 | Ga0209256_1000335 | Ga0209256_100033533 | 385 |
| 646 | 3300025299 | Ga0209256_1000362 | Ga0209256_100036261 | 385 |
| 647 | 3300025303 | Ga0209051_1016277 | Ga0209051_10162772 | 385 |
| 648 | 3300025913 | Ga0207695_10000535 | Ga0207695_1000053531 | 385 |
| 649 | 3300025920 | Ga0207649_10000222 | Ga0207649_1000022217 | 385 |
| 650 | 3300025940 | Ga0207691_10043621 | Ga0207691_100436213 | 385 |
| 651 | 3300025945 | Ga0207679_10000038 | Ga0207679_1000003864 | 385 |
| 652 | 3300025981 | Ga0207640_10000096 | Ga0207640_1000009621 | 385 |
| 653 | 3300025986 | Ga0207658_10129407 | Ga0207658_101294072 | 385 |
| 654 | 3300026067 | Ga0207678_10000021 | Ga0207678_1000002163 | 385 |
| 655 | 3300026078 | Ga0207702_10000203 | Ga0207702_1000020343 | 385 |
| 656 | 3300026116 | Ga0207674_10010466 | Ga0207674_100104663 | 385 |
| 657 | 3300027666 | Ga0209282_1000164 | Ga0209282_100016413 | 385 |
| 658 | 3300028379 | Ga0268266_10317852 | Ga0268266_103178522 | 385 |
| 659 | 3300028786 | Ga0307517_10000160 | Ga0307517_1000016024 | 385 |
| 660 | 3300030522 | Ga0307512_10028196 | Ga0307512_100281963 | 385 |
| 661 | 3300031238 | Ga0265332_10000023 | Ga0265332_10000023201 | 385 |
| 662 | 3300031507 | Ga0307509_10000317 | Ga0307509_1000031742 | 385 |
| 663 | 3300031616 | Ga0307508_10000332 | Ga0307508_1000033225 | 385 |
| 664 | 3300031730 | Ga0307516_10061200 | Ga0307516_100612002 | 385 |
| 665 | 3300031730 | Ga0307516_10114153 | Ga0307516_101141533 | 385 |
| 666 | 3300033179 | Ga0307507_10003609 | Ga0307507_100036098 | 385 |
| 667 | 3300037312 | Ga0395899_0068146 | Ga0395899_0068146_576_1733 | 385 |
| 668 | 3300037418 | Ga0395900_0017809 | Ga0395900_0017809_3625_4782 | 385 |
| 669 | 3300037471 | Ga0395905_0248951 | Ga0395905_0248951_66_1226 | 385 |
| 670 | 3300039438 | Ga0436360_0151113 | Ga0436360_0151113_873_2033 | 385 |
| 671 | 3300039447 | Ga0436361_1082374 | Ga0436361_1082374_60_1220 | 385 |
| 672 | 3300039453 | Ga0436362_0793039 | Ga0436362_0793039_1174_2334 | 385 |
| 673 | 3300042876 | Ga0451577_0003119 | Ga0451577_0003119_3015_4175 | 385 |
| 674 | 3300042876 | Ga0451577_0024476 | Ga0451577_0024476_3924_5096 | 385 |
| 675 | 3300044658 | Ga0466972_0012085 | Ga0466972_0012085_162_1334 | 385 |
| 676 | 3300044666 | Ga0466977_0000017 | Ga0466977_0000017_22968_24137 | 385 |
| 677 | 3300044673 | Ga0453683_0008099 | Ga0453683_0008099_1390_2550 | 385 |
| 678 | 3300044693 | Ga0466961_0029656 | Ga0466961_0029656_27_1193 | 385 |
| 679 | 3300044712 | Ga0453684_0048167 | Ga0453684_0048167_4394_5554 | 385 |
| 680 | 3300046457 | Ga0495590_0005528 | Ga0495590_0005528_3450_4610 | 385 |
| 681 | 3300046463 | Ga0495653_0013130 | Ga0495653_0013130_983_2143 | 385 |
| 682 | 3300046472 | Ga0495580_0007367 | Ga0495580_0007367_7395_8555 | 385 |
| 683 | 3300046472 | Ga0495580_0049094 | Ga0495580_0049094_259_1422 | 385 |
| 684 | 3300046474 | Ga0495605_0002043 | Ga0495605_0002043_7831_8988 | 385 |
| 685 | 3300046477 | Ga0495664_0014761 | Ga0495664_0014761_1412_2584 | 385 |
| 686 | 3300046512 | Ga0495610_0000544 | Ga0495610_0000544_10811_11968 | 385 |
| 687 | 3300046526 | Ga0495666_0000304 | Ga0495666_0000304_386_1546 | 385 |
| 688 | 3300046531 | Ga0495665_0042865 | Ga0495665_0042865_285_1445 | 385 |
| 689 | 3300046538 | Ga0495609_0000774 | Ga0495609_0000774_4598_5755 | 385 |
| 690 | 3300046539 | Ga0495621_0023547 | Ga0495621_0023547_707_1867 | 385 |
| 691 | 3300046615 | Ga0495656_0003734 | Ga0495656_0003734_1478_2638 | 385 |
| 692 | 3300046678 | Ga0495599_0017583 | Ga0495599_0017583_1930_3090 | 385 |
| 693 | 3300046679 | Ga0495623_0071650 | Ga0495623_0071650_517_1677 | 385 |
| 694 | 3300047317 | Ga0495604_0034176 | Ga0495604_0034176_2696_3856 | 385 |
| 695 | 3300047319 | Ga0495674_0024158 | Ga0495674_0024158_2198_3370 | 385 |
| 696 | 3300047444 | Ga0495675_0045177 | Ga0495675_0045177_886_2046 | 385 |
| 697 | 3300048090 | Ga0495615_0012211 | Ga0495615_0012211_256_1416 | 385 |
| 698 | 3300048925 | Ga0496122_0001804 | Ga0496122_0001804_5804_6961 | 385 |
| 699 | 3300048926 | Ga0496123_0003744 | Ga0496123_0003744_11958_13115 | 385 |
| 700 | 3300048928 | Ga0496125_0041883 | Ga0496125_0041883_1236_2393 | 385 |
| 701 | 3300049571 | Ga0501034_0000022 | Ga0501034_0000022_199883_201040 | 385 |
| 702 | 3300049665 | Ga0501227_000555 | Ga0501227_000555_1564_2730 | 385 |
| 703 | 3300049668 | Ga0501233_007858 | Ga0501233_007858_865_2031 | 385 |
| 704 | 3300049705 | Ga0501225_0005596 | Ga0501225_0005596_313_1479 | 385 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5lnx-assembly2.cif.gz_E | crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. | 0.9647 | 10 | 383 |
| 5lnx-assembly1.cif.gz_B | crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. | 0.9634 | 7 | 383 |
| 5lnx-assembly1.cif.gz_C | crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. | 0.9627 | 12 | 383 |
| 2vig-assembly1.cif.gz_B | crystal structure of human short-chain acyl coa dehydrogenase | 0.9604 | 4 | 384 |
| 5lnx-assembly2.cif.gz_H | crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. | 0.96 | 4 | 383 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3pfdC03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9795 | 231 | 382 | 1.20.140.10 |
| af_Q9D7B6_155_263_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9736 | 121 | 230 | 2.40.110.10 |
| 3pfdB03 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.972 | 231 | 382 | 1.20.140.10 |
| af_M0RAD8_170_241_2.40.110.10 | Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 | 0.9704 | 119 | 185 | 2.40.110.10 |
| af_P9WQG1_243_389_1.20.140.10 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 | 0.9689 | 235 | 384 | 1.20.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N3CQG8-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9782 | 2 | 308 |
GO:0003995
GO:0050660 |
| AF-A0A176QGM5-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9745 | 3 | 384 |
GO:0003995
GO:0050660 |
| AF-A0A437CAG7-F1-model_v4 | Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.5) (2-methyl branched chain acyl-CoA dehydrogenase) (2-methylbutyryl-coenzyme A dehydrogenase) | 0.9727 | 118 | 289 |
GO:0003995
GO:0005739 GO:0006631 |
| AF-A0A2N0QJJ7-F1-model_v4 | Acyl-CoA dehydrogenase NM domain-like protein | 0.972 | 63 | 306 |
GO:0003995
GO:0050660 |
| AF-A0A528IP61-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9715 | 63 | 359 |
GO:0003995
GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar