F476344

General Info

Members Datasets Scaffolds Average Seq Length
704 441 659 383

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10058785|Ga0075362_100587852
Length 430
Sequence VGRASMRRASKVAEIRGGFCVKGLAMPQAPRGHPPRTDDISHPSPKEPQMALDPDTFNLLRDTVTRFVNERLISREDEVSETNTIPADVVEEMQSLGLFGLSIPEEFGGLXLSMEEEARIVFELGRASPAFRSVAGTNIGIGSQSIVIAGTDQQKAKYLPRLASGELIGSFALTEPDTGSDAMSIRATARKMGDHYVLNGTKRYITNAPSAGLFTVMARTAQERKADSISCFLVPADTPGITVGKPDKKMGQRGALTSDVIFEDCKVPTSALLGETEGNGFRTSMKVLDKGRLHIAALCVGIADRLIDEAVKYARERKQFGQPIGQFQLVQAMLADSEAEAYAAKCMVIDASRRRDRGEIPTRQAACAKMFASEMVGRVADRAVQIFGGAGYMSEYPVERFYRDVRLFRIFEGTTQIQQLVIARDLLKAV

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2534681786 Brucella suis 92/29 Isolate Unclassified
5 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
6 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
7 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
8 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
9 2643221569 Achromobacter sp. Root565 Isolate Unclassified
10 2643221594 Achromobacter sp. Root170 Isolate Unclassified
11 2643221621 Achromobacter sp. Root83 Isolate Unclassified
12 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
13 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
14 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
15 2751185800 Brucella pituitosa AA2 Isolate Unclassified
16 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
17 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
18 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
19 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
20 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
21 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
22 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
23 2855730933 Achromobacter sp. HZ28 Isolate Nodule
24 2855767633 Achromobacter sp. HZ34 Isolate Nodule
25 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
26 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
27 2858950400 Achromobacter sp. K91 Isolate Unclassified
28 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
29 2885266251 Ralstonia sp. SET104 Isolate Nodule
30 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
31 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
32 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
33 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
34 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
35 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
36 2928058823 Ralstonia sp. 1138 Isolate Unclassified
37 2941479691
38 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
39 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
40 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
41 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
42 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
43 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
44 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
45 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
46 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
49 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
50 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
51 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
52 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
53 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
54 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
55 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
56 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
57 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
60 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
74 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
75 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
76 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
80 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
86 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
87 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
122 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
134 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
135 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
136 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
137 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
146 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
147 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
149 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
160 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
161 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
164 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
223 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
230 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
231 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
232 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
233 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
234 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
239 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
240 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
241 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
242 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
247 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
248 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
249 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
250 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
251 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
252 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
253 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
254 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
260 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
267 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
268 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
269 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
270 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
273 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
274 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
275 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
276 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
277 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
278 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
279 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
280 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
281 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
282 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
283 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
286 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
287 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
288 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
289 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
298 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
299 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
300 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
301 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
308 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
314 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
315 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
316 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
317 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
325 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
326 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
327 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
328 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
329 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
332 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
333 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
337 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
342 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
343 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
344 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
345 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
346 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
347 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
348 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
349 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
350 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
366 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
367 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
371 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
378 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
381 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
382 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
383 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
384 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
385 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
387 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
399 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
400 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
401 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
402 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
403 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
404 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
405 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
406 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
407 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
408 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
409 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
410 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
411 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
412 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
413 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
414 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
415 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
416 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
417 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
418 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
419 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
420 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
421 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
422 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
423 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
424 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
425 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
426 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
427 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
428 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
429 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
430 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
431 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
432 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
433 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
434 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
435 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
436 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
439 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
440 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
441 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.9
Metatranscriptomes 0.71
Isolates 6.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.03
Nodule 2.27
Rhizoplane 4.12
Rhizosphere 61.93
Stem 0
Stem Tuber 0
Unclassified 11.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000448 3300001915 Bacteria 12506
2 JGI24740J21852_10000149 3300001979 Bacteria 27167
3 JGI24740J21852_10000159 3300001979 Bacteria 26704
4 JGI25156J39149_1007314 3300002705 Bacteria 2916
5 JGI25154J39366_1001599 3300002738 Bacteria 7719
6 JGI25151J46595_10000228 3300003187 Bacteria 66484
7 JGI25151J46595_10001462 3300003187 Bacteria 16012
8 Ga0055539_1000086 3300003752 Bacteria 117621
9 Ga0055533_1001557 3300003756 Bacteria 5972
10 Ga0055532_1000041 3300003758 Bacteria 195749
11 Ga0055535_1000030 3300003761 Bacteria 195749
12 Ga0055542_1000818 3300003762 Bacteria 22571
13 Ga0055529_1000058 3300003763 Bacteria 195735
14 Ga0055526_1011710 3300003771 Bacteria 3915
15 Ga0055524_1001952 3300003775 Bacteria 11083
16 Ga0055536_1000114 3300003781 Bacteria 70007
17 Ga0055534_1003641 3300003784 Bacteria 4775
18 Ga0055530_10000579 3300003791 Bacteria 31675
19 Ga0055541_1001902 3300003841 Bacteria 4332
20 Ga0065704_10009005 3300005289 Bacteria 2001
21 Ga0065704_10079565 3300005289 Bacteria 4130
22 Ga0070658_10004072 3300005327 Bacteria 11984
23 Ga0070658_10132353 3300005327 Bacteria 2079
24 Ga0070683_100002003 3300005329 Bacteria 15985
25 Ga0070683_100164059 3300005329 Bacteria 2108
26 Ga0070670_100000981 3300005331 Bacteria 22370
27 Ga0070670_100026142 3300005331 Bacteria 5025
28 Ga0070670_100126234 3300005331 Bacteria 2208
29 Ga0070677_10000559 3300005333 Bacteria 12697
30 Ga0070666_10191773 3300005335 Bacteria 1436
31 Ga0070680_100000727 3300005336 Bacteria 22930
32 Ga0068868_100000036 3300005338 Bacteria 74490
33 Ga0070660_100000347 3300005339 Bacteria 30909
34 Ga0070661_100000001 3300005344 Bacteria 424830
35 Ga0070661_100000072 3300005344 Bacteria 82584
36 Ga0070692_10000276 3300005345 Bacteria 14447
37 Ga0070668_100000013 3300005347 Bacteria 117451
38 Ga0070668_100002822 3300005347 Bacteria 12787
39 Ga0070669_100006287 3300005353 Bacteria 8563
40 Ga0070669_100019626 3300005353 Bacteria 4828
41 Ga0070669_100106120 3300005353 Bacteria 2126
42 Ga0070675_100028436 3300005354 Bacteria 4500
43 Ga0070671_100000225 3300005355 Bacteria 37597
44 Ga0070671_100038951 3300005355 Bacteria 3945
45 Ga0070674_100061329 3300005356 Bacteria 2624
46 Ga0070673_100046037 3300005364 Bacteria 3386
47 Ga0070659_100000034 3300005366 Bacteria 115416
48 Ga0070667_100000328 3300005367 Bacteria 52935
49 Ga0070667_100000413 3300005367 Bacteria 45721
50 Ga0070667_100000889 3300005367 Bacteria 27637
51 Ga0070714_100001638 3300005435 Bacteria 16290
52 Ga0070714_100109168 3300005435 Bacteria 2447
53 Ga0070714_100131545 3300005435 Bacteria 2237
54 Ga0070713_100003580 3300005436 Bacteria 10265
55 Ga0070713_100093464 3300005436 Bacteria 2591
56 Ga0070663_100000015 3300005455 Bacteria 131905
57 Ga0070678_100227437 3300005456 Bacteria 1553
58 Ga0070678_100258433 3300005456 Bacteria 1463
59 Ga0070681_10014042 3300005458 Bacteria 7971
60 Ga0070685_10000593 3300005466 Bacteria 20043
61 Ga0070706_100001450 3300005467 Bacteria 24950
62 Ga0070706_100168273 3300005467 Bacteria 2046
63 Ga0070707_100021081 3300005468 Bacteria 6155
64 Ga0070698_100139653 3300005471 Bacteria 2375
65 Ga0070679_100000003 3300005530 Bacteria 307836
66 Ga0070679_100241703 3300005530 Bacteria 1763
67 Ga0070684_100000748 3300005535 Bacteria 22485
68 Ga0070684_100032929 3300005535 Bacteria 4422
69 Ga0070684_100046047 3300005535 Bacteria 3779
70 Ga0070684_100183359 3300005535 Bacteria 1903
71 Ga0068853_100018340 3300005539 Bacteria 5791
72 Ga0068853_100124373 3300005539 Bacteria 2303
73 Ga0070672_100198775 3300005543 Bacteria 1676
74 Ga0070686_100000140 3300005544 Bacteria 49544
75 Ga0070665_100000105 3300005548 Bacteria 157734
76 Ga0070665_100000232 3300005548 Bacteria 92207
77 Ga0070665_100024985 3300005548 Bacteria 6023
78 Ga0070665_100146602 3300005548 Bacteria 2363
79 Ga0070664_100000058 3300005564 Bacteria 67966
80 Ga0070664_100015104 3300005564 Bacteria 6306
81 Ga0068857_100000132 3300005577 Bacteria 45188
82 Ga0068857_100029386 3300005577 Bacteria 4850
83 Ga0068854_100000025 3300005578 Bacteria 123547
84 Ga0068856_100000084 3300005614 Bacteria 87749
85 Ga0068856_100002961 3300005614 Bacteria 17414
86 Ga0068856_100214593 3300005614 Bacteria 1940
87 Ga0068859_100002459 3300005617 Bacteria 18856
88 Ga0068859_100013326 3300005617 Bacteria 8248
89 Ga0068859_100143598 3300005617 Bacteria 2460
90 Ga0068864_100001706 3300005618 Bacteria 18043
91 Ga0068864_100001781 3300005618 Bacteria 17686
92 Ga0068864_100017608 3300005618 Bacteria 5956
93 Ga0068861_100015250 3300005719 Bacteria 5411
94 Ga0068863_100000293 3300005841 Bacteria 51737
95 Ga0068863_100000466 3300005841 Bacteria 41328
96 Ga0068863_100000646 3300005841 Bacteria 35340
97 Ga0068863_100004472 3300005841 Bacteria 13781
98 Ga0068863_100012390 3300005841 Bacteria 8233
99 Ga0068863_100016521 3300005841 Bacteria 7080
100 Ga0068863_100054023 3300005841 Bacteria 3807
101 Ga0068863_100059233 3300005841 Bacteria 3623
102 Ga0068858_100000374 3300005842 Bacteria 46767
103 Ga0068858_100001936 3300005842 Bacteria 21104
104 Ga0068858_100174174 3300005842 Bacteria 2030
105 Ga0068860_100000436 3300005843 Bacteria 52935
106 Ga0068860_100000473 3300005843 Bacteria 49993
107 Ga0068860_100000638 3300005843 Bacteria 41210
108 Ga0068860_100011535 3300005843 Bacteria 8710
109 Ga0068860_100145738 3300005843 Bacteria 2278
110 Ga0068862_100001919 3300005844 Bacteria 18891
111 Ga0068862_100230441 3300005844 Bacteria 1680
112 Ga0081455_10001460 3300005937 Bacteria 29253
113 Ga0070717_10002935 3300006028 Bacteria 12108
114 Ga0075365_10018258 3300006038 Bacteria 4310
115 Ga0075368_10004106 3300006042 Bacteria 4901
116 Ga0075363_100055032 3300006048 Bacteria 2130
117 Ga0075364_10209901 3300006051 Bacteria 1320
118 Ga0075432_10004168 3300006058 Bacteria 4926
119 Ga0070712_100123961 3300006175 Bacteria 1948
120 Ga0075362_10012482 3300006177 Bacteria 3377
121 Ga0075362_10058785 3300006177 Bacteria 1735
122 Ga0075367_10050617 3300006178 Bacteria 2453
123 Ga0075369_10096982 3300006186 Bacteria 1320
124 Ga0075366_10001326 3300006195 Bacteria 12359
125 Ga0075366_10142000 3300006195 Bacteria 1452
126 Ga0075370_10000007 3300006353 Bacteria 104910
127 Ga0075370_10030387 3300006353 Bacteria 3014
128 Ga0075370_10040419 3300006353 Bacteria 2630
129 Ga0075429_100001204 3300006880 Bacteria 20973
130 Ga0075436_100051187 3300006914 Bacteria 2850
131 Ga0097620_100013326 3300006931 Bacteria 8248
132 Ga0097620_100143601 3300006931 Bacteria 2460
133 Ga0099826_10000107 3300006948 Bacteria 38416
134 Ga0105244_10035746 3300009036 Bacteria 2608
135 Ga0105240_10143133 3300009093 Bacteria 2857
136 Ga0111539_10006194 3300009094 Bacteria 15435
137 Ga0105245_10014088 3300009098 Bacteria 6967
138 Ga0105245_10087320 3300009098 Bacteria 2863
139 Ga0114129_10399020 3300009147 Bacteria 1813
140 Ga0114129_10454935 3300009147 Bacteria 1678
141 Ga0105243_10023246 3300009148 Bacteria 4718
142 Ga0105242_10047440 3300009176 Bacteria 3488
143 Ga0105242_10062141 3300009176 Bacteria 3073
144 Ga0105242_10133617 3300009176 Bacteria 2145
145 Ga0105248_10003501 3300009177 Bacteria 17418
146 Ga0105248_10019503 3300009177 Bacteria 7505
147 Ga0105248_10153966 3300009177 Bacteria 2594
148 Ga0105238_10014995 3300009551 Bacteria 7846
149 Ga0105238_10039628 3300009551 Bacteria 4777
150 Ga0105238_10245863 3300009551 Bacteria 1767
151 Ga0105249_10026960 3300009553 Bacteria 5182
152 Ga0105249_10257053 3300009553 Bacteria 1734
153 Ga0105246_10083818 3300011119 Bacteria 2279
154 Ga0157373_10008055 3300013100 Bacteria 7831
155 Ga0157371_10000100 3300013102 Bacteria 131924
156 Ga0157371_10003600 3300013102 Bacteria 13958
157 Ga0157370_10000004 3300013104 Bacteria 366426
158 Ga0157369_10002048 3300013105 Bacteria 24329
159 Ga0157369_10034953 3300013105 Bacteria 5511
160 Ga0157374_10151270 3300013296 Bacteria 2256
161 Ga0157372_10000279 3300013307 Bacteria 56725
162 Ga0157372_10037866 3300013307 Bacteria 5322
163 Ga0157372_10133610 3300013307 Bacteria 2856
164 Ga0157375_10108322 3300013308 Bacteria 2873
165 Ga0157375_10172571 3300013308 Bacteria 2310
166 Ga0163163_10007083 3300014325 Bacteria 9859
167 Ga0163163_10012463 3300014325 Bacteria 7747
168 Ga0157380_10028164 3300014326 Bacteria 4280
169 Ga0157380_10195109 3300014326 Bacteria 1791
170 Ga0182008_10002889 3300014497 Bacteria 10629
171 Ga0157379_10009393 3300014968 Bacteria 8522
172 Ga0157376_10337921 3300014969 Bacteria 1437
173 Ga0182006_1000214 3300015261 Bacteria 56285
174 Ga0182006_1001983 3300015261 Bacteria 11554
175 Ga0163161_10109611 3300017792 Bacteria 2063
176 Ga0206356_10774019 3300020070 Bacteria 1712
177 Ga0206355_1007462 3300020076 Bacteria 1905
178 Ga0206353_11669705 3300020082 Bacteria 2196
179 Ga0154015_1588421 3300020610 Bacteria 15443
180 Ga0224712_10035527 3300022467 Bacteria 1840
181 Ga0209784_100029 3300025224 Bacteria 347315
182 Ga0209784_100853 3300025224 Bacteria 6667
183 Ga0209784_101137 3300025224 Bacteria 4294
184 Ga0209566_100030 3300025225 Bacteria 347329
185 Ga0209566_100277 3300025225 Bacteria 47887
186 Ga0209566_101363 3300025225 Bacteria 7638
187 Ga0209674_100081 3300025226 Bacteria 201146
188 Ga0209674_100089 3300025226 Bacteria 178751
189 Ga0209674_100123 3300025226 Bacteria 131438
190 Ga0209674_102250 3300025226 Bacteria 4276
191 Ga0209672_101786 3300025228 Bacteria 6628
192 Ga0209147_100008 3300025229 Bacteria 777096
193 Ga0209563_100091 3300025230 Bacteria 168320
194 Ga0209563_100092 3300025230 Bacteria 167669
195 Ga0209258_100013 3300025242 Bacteria 777096
196 Ga0209646_1000065 3300025246 Bacteria 245452
197 Ga0209026_1009936 3300025250 Bacteria 1817
198 Ga0209677_100030 3300025253 Bacteria 347314
199 Ga0209148_1000113 3300025254 Bacteria 195646
200 Ga0209148_1008463 3300025254 Bacteria 2066
201 Ga0209759_1001532 3300025256 Bacteria 12683
202 Ga0209759_1005701 3300025256 Bacteria 4298
203 Ga0209565_1000659 3300025263 Bacteria 22030
204 Ga0209455_1000106 3300025272 Bacteria 195801
205 Ga0209675_1000092 3300025291 Bacteria 144839
206 Ga0209675_1000903 3300025291 Bacteria 18979
207 Ga0209675_1002733 3300025291 Bacteria 8835
208 Ga0209676_1000378 3300025292 Bacteria 82127
209 Ga0209025_1000019 3300025294 Bacteria 631548
210 Ga0209025_1000125 3300025294 Bacteria 201444
211 Ga0209025_1000222 3300025294 Bacteria 135688
212 Ga0209025_1000837 3300025294 Bacteria 48847
213 Ga0209025_1001562 3300025294 Bacteria 29058
214 Ga0209025_1019959 3300025294 Bacteria 3695
215 Ga0209564_1000489 3300025295 Bacteria 65860
216 Ga0209564_1000655 3300025295 Bacteria 51734
217 Ga0209564_1001585 3300025295 Bacteria 22224
218 Ga0209758_1000924 3300025297 Bacteria 39688
219 Ga0209758_1018355 3300025297 Bacteria 3431
220 Ga0209050_1000049 3300025298 Bacteria 364096
221 Ga0209256_1000335 3300025299 Bacteria 78765
222 Ga0209256_1000362 3300025299 Bacteria 73517
223 Ga0209051_1016277 3300025303 Bacteria 3376
224 Ga0209257_1000692 3300025304 Bacteria 52346
225 Ga0209257_1018524 3300025304 Bacteria 2674
226 Ga0207697_10020398 3300025315 Bacteria 2713
227 Ga0207682_10000576 3300025893 Bacteria 16980
228 Ga0207688_10044607 3300025901 Bacteria 2471
229 Ga0207680_10021518 3300025903 Bacteria 3491
230 Ga0207643_10151267 3300025908 Bacteria 1391
231 Ga0207705_10000120 3300025909 Bacteria 87080
232 Ga0207684_10000750 3300025910 Bacteria 37897
233 Ga0207684_10038811 3300025910 Bacteria 4041
234 Ga0207707_10010643 3300025912 Bacteria 7990
235 Ga0207707_10059512 3300025912 Bacteria 3324
236 Ga0207695_10000535 3300025913 Bacteria 79187
237 Ga0207695_10094525 3300025913 Bacteria 2996
238 Ga0207693_10092657 3300025915 Bacteria 2368
239 Ga0207660_10000078 3300025917 Bacteria 51142
240 Ga0207657_10000839 3300025919 Bacteria 32505
241 Ga0207657_10025901 3300025919 Bacteria 5400
242 Ga0207649_10000011 3300025920 Bacteria 266219
243 Ga0207649_10000222 3300025920 Bacteria 46190
244 Ga0207652_10000004 3300025921 Bacteria 436303
245 Ga0207652_10359735 3300025921 Bacteria 1314
246 Ga0207646_10014781 3300025922 Bacteria 7396
247 Ga0207646_10085402 3300025922 Bacteria 2824
248 Ga0207681_10006820 3300025923 Bacteria 7003
249 Ga0207681_10115709 3300025923 Bacteria 1958
250 Ga0207694_10052642 3300025924 Bacteria 3155
251 Ga0207694_10159781 3300025924 Bacteria 1819
252 Ga0207650_10059019 3300025925 Bacteria 2858
253 Ga0207687_10013831 3300025927 Bacteria 5271
254 Ga0207687_10037929 3300025927 Bacteria 3291
255 Ga0207700_10003514 3300025928 Bacteria 9129
256 Ga0207700_10009309 3300025928 Bacteria 6130
257 Ga0207664_10003232 3300025929 Bacteria 10827
258 Ga0207664_10007189 3300025929 Bacteria 7713
259 Ga0207644_10000398 3300025931 Bacteria 28322
260 Ga0207690_10000005 3300025932 Bacteria 581199
261 Ga0207686_10009583 3300025934 Bacteria 5256
262 Ga0207709_10083363 3300025935 Bacteria 2067
263 Ga0207691_10043621 3300025940 Bacteria 4132
264 Ga0207711_10000552 3300025941 Bacteria 38214
265 Ga0207711_10001339 3300025941 Bacteria 23287
266 Ga0207711_10007657 3300025941 Bacteria 9032
267 Ga0207711_10276342 3300025941 Bacteria 1546
268 Ga0207661_10000743 3300025944 Bacteria 21120
269 Ga0207661_10047497 3300025944 Bacteria 3409
270 Ga0207661_10053941 3300025944 Bacteria 3219
271 Ga0207679_10000038 3300025945 Bacteria 131935
272 Ga0207679_10011528 3300025945 Bacteria 5730
273 Ga0207679_10093210 3300025945 Bacteria 2335
274 Ga0207667_10000002 3300025949 Bacteria 895662
275 Ga0207651_10126486 3300025960 Bacteria 1948
276 Ga0207712_10124398 3300025961 Bacteria 1956
277 Ga0207668_10000022 3300025972 Bacteria 135782
278 Ga0207668_10000132 3300025972 Bacteria 53005
279 Ga0207640_10000096 3300025981 Bacteria 68105
280 Ga0207658_10000021 3300025986 Bacteria 201456
281 Ga0207658_10000269 3300025986 Bacteria 54732
282 Ga0207658_10000646 3300025986 Bacteria 30565
283 Ga0207658_10024951 3300025986 Bacteria 4183
284 Ga0207658_10129407 3300025986 Bacteria 2026
285 Ga0207677_10000044 3300026023 Bacteria 107614
286 Ga0207677_10187761 3300026023 Bacteria 1632
287 Ga0207703_10000309 3300026035 Bacteria 52974
288 Ga0207703_10009731 3300026035 Bacteria 7544
289 Ga0207703_10022814 3300026035 Bacteria 4916
290 Ga0207639_10007774 3300026041 Bacteria 7325
291 Ga0207678_10000021 3300026067 Bacteria 131877
292 Ga0207678_10140873 3300026067 Bacteria 2058
293 Ga0207702_10000203 3300026078 Bacteria 70226
294 Ga0207702_10293593 3300026078 Bacteria 1541
295 Ga0207641_10000040 3300026088 Bacteria 192446
296 Ga0207641_10000098 3300026088 Bacteria 123514
297 Ga0207641_10000303 3300026088 Bacteria 61340
298 Ga0207641_10003348 3300026088 Bacteria 14247
299 Ga0207641_10004850 3300026088 Bacteria 11580
300 Ga0207641_10046616 3300026088 Bacteria 3654
301 Ga0207676_10000538 3300026095 Bacteria 31682
302 Ga0207676_10001168 3300026095 Bacteria 19769
303 Ga0207676_10204598 3300026095 Bacteria 1747
304 Ga0207674_10000875 3300026116 Bacteria 39434
305 Ga0207674_10010466 3300026116 Bacteria 10502
306 Ga0207675_100040137 3300026118 Bacteria 4369
307 Ga0207683_10019848 3300026121 Bacteria 5742
308 Ga0207683_10207938 3300026121 Bacteria 1780
309 Ga0207698_10137939 3300026142 Bacteria 2096
310 Ga0209970_1000216 3300027614 Bacteria 9245
311 Ga0209282_1000164 3300027666 Bacteria 38002
312 Ga0209813_10000538 3300027866 Bacteria 8948
313 Ga0209974_10008422 3300027876 Bacteria 3525
314 Ga0207428_10000092 3300027907 Bacteria 123897
315 Ga0207428_10025530 3300027907 Bacteria 4946
316 Ga0268266_10000055 3300028379 Bacteria 291630
317 Ga0268266_10003472 3300028379 Bacteria 15722
318 Ga0268266_10016499 3300028379 Bacteria 6313
319 Ga0268266_10317852 3300028379 Bacteria 1456
320 Ga0268265_10000536 3300028380 Bacteria 38704
321 Ga0268265_10001938 3300028380 Bacteria 16418
322 Ga0268264_10000224 3300028381 Bacteria 110355
323 Ga0268264_10000448 3300028381 Bacteria 56330
324 Ga0268264_10000670 3300028381 Bacteria 40140
325 Ga0268264_10008180 3300028381 Bacteria 8683
326 Ga0265337_1009722 3300028556 Bacteria 3417
327 Ga0307517_10000160 3300028786 Bacteria 108370
328 Ga0307515_10083866 3300028794 Bacteria 4102
329 Ga0307512_10028196 3300030522 Bacteria 4927
330 Ga0265332_10000023 3300031238 Bacteria 211994
331 Ga0265320_10001604 3300031240 Bacteria 16231
332 Ga0307513_10000012 3300031456 Bacteria 328865
333 Ga0307513_10015291 3300031456 Bacteria 9308
334 Ga0307513_10132955 3300031456 Bacteria 2429
335 Ga0307509_10000317 3300031507 Bacteria 79032
336 Ga0307408_100184728 3300031548 Bacteria 1675
337 Ga0307508_10000332 3300031616 Bacteria 57039
338 Ga0307508_10007527 3300031616 Bacteria 10124
339 Ga0307508_10007605 3300031616 Bacteria 10070
340 Ga0316575_10004304 3300031665 Bacteria 5003
341 Ga0316579_10003150 3300031691 Bacteria 6377
342 Ga0265314_10004285 3300031711 Bacteria 13328
343 Ga0265314_10017039 3300031711 Bacteria 5713
344 Ga0316578_10004181 3300031728 Bacteria 6767
345 Ga0307516_10000780 3300031730 Bacteria 43450
346 Ga0307516_10061200 3300031730 Bacteria 3654
347 Ga0307516_10114153 3300031730 Bacteria 2499
348 Ga0316577_10006191 3300031733 Bacteria 6313
349 Ga0316577_10045703 3300031733 Unclassified 2447
350 Ga0307406_10059244 3300031901 Bacteria 2464
351 Ga0307412_10002104 3300031911 Bacteria 11059
352 Ga0307409_100052099 3300031995 Bacteria 3136
353 Ga0307416_100024842 3300032002 Bacteria 4382
354 Ga0307416_100142383 3300032002 Bacteria 2182
355 Ga0307415_100000216 3300032126 Bacteria 25296
356 Ga0316583_10005971 3300032133 Bacteria 4375
357 Ga0307507_10003609 3300033179 Bacteria 29424
358 Ga0373943_0002887 3300035170 Bacteria 7805
359 Ga0373943_0111234 3300035170 Bacteria 1445
360 Ga0373946_0015907 3300035171 Bacteria 2860
361 Ga0316574_0007755 3300035398 Bacteria 5907
362 Ga0316574_0083477 3300035398 Bacteria 2031
363 Ga0373931_0055251 3300035691 Bacteria 2124
364 Ga0373927_0023557 3300035695 Bacteria 4031
365 Ga0373947_0005518 3300035725 Bacteria 7382
366 Ga0373937_0204671 3300036401 Bacteria 1856
367 Ga0316582_0012322 3300036647 Bacteria 4765
368 Ga0316582_0029496 3300036647 Bacteria 3333
369 Ga0316584_0024929 3300036712 Bacteria 4382
370 Ga0373925_0015618 3300037068 Bacteria 5493
371 Ga0395899_0068146 3300037312 Bacteria 2610
372 Ga0395900_0017809 3300037418 Bacteria 7252
373 Ga0395898_0002667 3300037466 Bacteria 20695
374 Ga0395898_0228097 3300037466 Bacteria 1776
375 Ga0395905_0126226 3300037471 Bacteria 2406
376 Ga0395905_0248951 3300037471 Bacteria 1660
377 Ga0316581_0002782 3300037588 Bacteria 4253
378 Ga0436364_0623951 3300037853 Bacteria 1727
379 Ga0395901_0356252 3300038443 Bacteria 1509
380 Ga0400489_74021 3300039093 Bacteria 99222
381 Ga0237816_00675 3300039145 Bacteria 2879
382 Ga0436365_1862304 3300039437 Bacteria 21258
383 Ga0436360_0151113 3300039438 Bacteria 2522
384 Ga0436361_0523586 3300039447 Bacteria 2239
385 Ga0436361_1082374 3300039447 Bacteria 1356
386 Ga0436362_0793039 3300039453 Bacteria 2761
387 Ga0439465_0003542 3300041413 Bacteria 5088
388 Ga0451789_0160161 3300041443 Bacteria 1657
389 Ga0439431_0009881 3300041997 Bacteria 2160
390 Ga0439433_0016132 3300041999 Bacteria 1652
391 Ga0439445_0001721 3300042004 Bacteria 4814
392 Ga0439432_013107 3300042006 Bacteria 2822
393 Ga0439452_002901 3300042010 Bacteria 6146
394 Ga0439462_0002353 3300042015 Bacteria 4380
395 Ga0451577_0003119 3300042876 Bacteria 18698
396 Ga0451577_0009675 3300042876 Bacteria 9250
397 Ga0451577_0024476 3300042876 Bacteria 5492
398 Ga0466972_0012085 3300044658 Bacteria 4337
399 Ga0466977_0000017 3300044666 Bacteria 25598
400 Ga0453683_0008099 3300044673 Bacteria 7071
401 Ga0466961_0029656 3300044693 Bacteria 3515
402 Ga0466963_0009063 3300044694 Bacteria 5980
403 Ga0466963_0017004 3300044694 Bacteria 4531
404 Ga0466963_0018728 3300044694 Bacteria 4333
405 Ga0466963_0041835 3300044694 Bacteria 3006
406 Ga0466963_0069549 3300044694 Bacteria 2366
407 Ga0466963_0115902 3300044694 Bacteria 1841
408 Ga0466964_0017280 3300044706 Bacteria 2760
409 Ga0453684_0001067 3300044712 Bacteria 87208
410 Ga0453684_0005158 3300044712 Bacteria 26278
411 Ga0453684_0013899 3300044712 Bacteria 12984
412 Ga0453684_0048167 3300044712 Bacteria 5640
413 Ga0466967_0009491 3300045976 Bacteria 7223
414 Ga0466967_0032996 3300045976 Bacteria 4378
415 Ga0466967_0139468 3300045976 Bacteria 2257
416 Ga0466967_0210765 3300045976 Bacteria 1843
417 Ga0495617_001554 3300046452 Bacteria 9939
418 Ga0495627_000014 3300046453 Bacteria 326114
419 Ga0495603_0000988 3300046455 Bacteria 16389
420 Ga0495590_0005528 3300046457 Bacteria 5002
421 Ga0495638_0000574 3300046460 Bacteria 41469
422 Ga0495638_0093897 3300046460 Bacteria 1803
423 Ga0495653_0013130 3300046463 Bacteria 6753
424 Ga0495650_0064296 3300046471 Bacteria 1460
425 Ga0495580_0007367 3300046472 Bacteria 8848
426 Ga0495580_0049094 3300046472 Bacteria 2986
427 Ga0495582_0062462 3300046473 Bacteria 2058
428 Ga0495605_0002043 3300046474 Bacteria 12726
429 Ga0495605_0085363 3300046474 Bacteria 1471
430 Ga0495664_0014761 3300046477 Bacteria 4433
431 Ga0495584_0079964 3300046491 Bacteria 1644
432 Ga0495585_0152065 3300046492 Bacteria 1206
433 Ga0495594_0160333 3300046499 Bacteria 1278
434 Ga0495596_0008204 3300046500 Bacteria 4657
435 Ga0495607_0004169 3300046501 Bacteria 10749
436 Ga0495610_0000544 3300046512 Bacteria 37703
437 Ga0495610_0001425 3300046512 Bacteria 21154
438 Ga0495610_0077086 3300046512 Bacteria 1540
439 Ga0495630_0111726 3300046517 Bacteria 2070
440 Ga0495631_0002618 3300046518 Bacteria 10048
441 Ga0495632_0000071 3300046519 Bacteria 105606
442 Ga0495632_0017991 3300046519 Bacteria 3886
443 Ga0495643_0000019 3300046522 Bacteria 303627
444 Ga0495643_0079766 3300046522 Bacteria 1706
445 Ga0495666_0000304 3300046526 Bacteria 21414
446 Ga0495654_0092141 3300046530 Bacteria 1405
447 Ga0495665_0042865 3300046531 Bacteria 2407
448 Ga0495609_0000774 3300046538 Bacteria 23950
449 Ga0495609_0011105 3300046538 Bacteria 4300
450 Ga0495621_0023547 3300046539 Bacteria 2049
451 Ga0495597_0001142 3300046542 Bacteria 20021
452 Ga0495597_0001324 3300046542 Bacteria 18105
453 Ga0495633_0007390 3300046558 Bacteria 6326
454 Ga0495633_0017348 3300046558 Bacteria 3684
455 Ga0495633_0047771 3300046558 Bacteria 2022
456 Ga0495656_0003734 3300046615 Bacteria 5170
457 Ga0495668_0002749 3300046616 Bacteria 14061
458 Ga0495668_0006888 3300046616 Bacteria 7365
459 Ga0495668_0007365 3300046616 Bacteria 7048
460 Ga0495611_0005124 3300046648 Bacteria 5616
461 Ga0495625_0009987 3300046660 Bacteria 7895
462 Ga0495661_0012421 3300046665 Bacteria 5749
463 Ga0495661_0160659 3300046665 Bacteria 1206
464 Ga0495588_0000738 3300046674 Bacteria 14916
465 Ga0495599_0017583 3300046678 Bacteria 4445
466 Ga0495623_0071650 3300046679 Bacteria 2156
467 Ga0495658_0027317 3300046683 Bacteria 3070
468 Ga0495658_0038141 3300046683 Bacteria 2660
469 Ga0495669_0000457 3300046684 Bacteria 19129
470 Ga0495670_0044048 3300046691 Bacteria 2228
471 Ga0495671_0019697 3300046692 Bacteria 3562
472 Ga0495671_0052407 3300046692 Bacteria 2028
473 Ga0495671_0088770 3300046692 Bacteria 1514
474 Ga0495589_0014193 3300046794 Bacteria 4105
475 Ga0495660_0085296 3300046810 Bacteria 1650
476 Ga0495581_0073713 3300047315 Bacteria 1976
477 Ga0495604_0000217 3300047317 Bacteria 52754
478 Ga0495604_0034176 3300047317 Bacteria 4023
479 Ga0495636_0022712 3300047318 Bacteria 2538
480 Ga0495674_0024158 3300047319 Bacteria 5591
481 Ga0495676_0007422 3300047321 Bacteria 10060
482 Ga0495687_000088 3300047443 Bacteria 142499
483 Ga0495675_0045177 3300047444 Bacteria 2805
484 Ga0495685_015806 3300047447 Bacteria 2577
485 Ga0495681_0007224 3300047470 Bacteria 7138
486 Ga0495686_0045107 3300047472 Bacteria 2790
487 Ga0495686_0116773 3300047472 Bacteria 1595
488 Ga0495602_0146940 3300048088 Bacteria 1858
489 Ga0495602_0209775 3300048088 Bacteria 1479
490 Ga0495615_0002368 3300048090 Bacteria 3018
491 Ga0495615_0012211 3300048090 Bacteria 1766
492 Ga0496100_0068457 3300048903 Bacteria 2361
493 Ga0496101_0134058 3300048904 Bacteria 1883
494 Ga0496102_0019796 3300048905 Bacteria 5933
495 Ga0496102_0036013 3300048905 Bacteria 4457
496 Ga0496102_0339008 3300048905 Bacteria 1416
497 Ga0496104_0003494 3300048907 Bacteria 13552
498 Ga0496104_0024889 3300048907 Bacteria 5513
499 Ga0496104_0032875 3300048907 Bacteria 4829
500 Ga0496105_0001303 3300048908 Bacteria 17456
501 Ga0496108_0002007 3300048911 Bacteria 16311
502 Ga0496108_0253004 3300048911 Bacteria 1533
503 Ga0496109_0005264 3300048912 Bacteria 10806
504 Ga0496110_0018031 3300048913 Bacteria 5913
505 Ga0496110_0063217 3300048913 Bacteria 3270
506 Ga0496110_0078107 3300048913 Bacteria 2947
507 Ga0496111_0012102 3300048914 Bacteria 5834
508 Ga0496112_0020625 3300048915 Bacteria 6249
509 Ga0496112_0078711 3300048915 Bacteria 3260
510 Ga0496112_0095315 3300048915 Bacteria 2946
511 Ga0496112_0118720 3300048915 Bacteria 2615
512 Ga0496112_0231596 3300048915 Bacteria 1802
513 Ga0496113_0000822 3300048916 Bacteria 16174
514 Ga0496113_0128734 3300048916 Bacteria 1985
515 Ga0496114_0001735 3300048917 Bacteria 16539
516 Ga0496114_0269482 3300048917 Bacteria 1500
517 Ga0496115_0036684 3300048918 Bacteria 3882
518 Ga0496116_0009863 3300048919 Bacteria 8081
519 Ga0496116_0064990 3300048919 Bacteria 2342
520 Ga0496117_0003650 3300048920 Bacteria 17708
521 Ga0496117_0011109 3300048920 Bacteria 8098
522 Ga0496118_0005735 3300048921 Bacteria 13968
523 Ga0496118_0107692 3300048921 Bacteria 1860
524 Ga0496119_0012959 3300048922 Bacteria 6705
525 Ga0496119_0059160 3300048922 Bacteria 2303
526 Ga0496120_0062689 3300048923 Bacteria 2070
527 Ga0496121_0000130 3300048924 Bacteria 168094
528 Ga0496121_0003287 3300048924 Bacteria 23207
529 Ga0496121_0010155 3300048924 Bacteria 10663
530 Ga0496121_0015854 3300048924 Bacteria 7835
531 Ga0496121_0054278 3300048924 Bacteria 3350
532 Ga0496122_0000497 3300048925 Bacteria 81763
533 Ga0496122_0001804 3300048925 Bacteria 32800
534 Ga0496122_0017319 3300048925 Bacteria 6747
535 Ga0496123_0001884 3300048926 Bacteria 27381
536 Ga0496123_0003744 3300048926 Bacteria 16674
537 Ga0496123_0013777 3300048926 Bacteria 6753
538 Ga0496123_0047399 3300048926 Bacteria 2904
539 Ga0496124_0004245 3300048927 Bacteria 16863
540 Ga0496124_0043872 3300048927 Bacteria 3840
541 Ga0496124_0054741 3300048927 Bacteria 3375
542 Ga0496125_0000166 3300048928 Bacteria 147432
543 Ga0496125_0016464 3300048928 Bacteria 7097
544 Ga0496125_0041883 3300048928 Bacteria 3909
545 Ga0496125_0136526 3300048928 Bacteria 1714
546 Ga0496125_0141908 3300048928 Bacteria 1668
547 Ga0496125_0189022 3300048928 Bacteria 1362
548 Ga0496126_0000090 3300048929 Bacteria 210538
549 Ga0496126_0001188 3300048929 Bacteria 42555
550 Ga0496126_0032209 3300048929 Bacteria 4941
551 Ga0496126_0032887 3300048929 Bacteria 4881
552 Ga0495678_005337 3300049459 Bacteria 7127
553 Ga0495678_018010 3300049459 Bacteria 3185
554 Ga0501032_0093152 3300049569 Bacteria 1998
555 Ga0501033_0037756 3300049570 Bacteria 3614
556 Ga0501034_0000022 3300049571 Bacteria 264441
557 Ga0501034_0000874 3300049571 Bacteria 44331
558 Ga0501034_0001048 3300049571 Bacteria 39365
559 Ga0501034_0128127 3300049571 Bacteria 2523
560 Ga0501034_0163474 3300049571 Bacteria 2195
561 Ga0501036_0044073 3300049572 Bacteria 3778
562 Ga0501037_0007425 3300049573 Bacteria 8014
563 Ga0501047_0001179 3300049581 Bacteria 25916
564 Ga0501047_0003160 3300049581 Bacteria 15617
565 Ga0501047_0093778 3300049581 Bacteria 2881
566 Ga0501072_0109871 3300049588 Bacteria 2194
567 Ga0501073_0000068 3300049589 Bacteria 63524
568 Ga0501077_0000056 3300049593 Bacteria 57478
569 Ga0501227_000555 3300049665 Bacteria 8121
570 Ga0501233_007858 3300049668 Bacteria 2041
571 Ga0501238_002816 3300049671 Bacteria 2106
572 Ga0501225_0005596 3300049705 Bacteria 3681
573 Ga0501080_0216113 3300049742 Bacteria 1756
574 Ga0501035_0060943 3300049822 Bacteria 3358
575 Ga0501035_0116678 3300049822 Bacteria 2336
576 Ga0501044_0008276 3300049823 Bacteria 11404
577 Ga0501044_0010514 3300049823 Bacteria 10043
578 Ga0501044_0087580 3300049823 Bacteria 3145
579 Ga0501044_0180316 3300049823 Bacteria 2079
580 Ga0501044_0487690 3300049823 Bacteria 1135
581 nmdc:mga03683_38552_c1 3300050489 Bacteria 1952
582 nmdc:mga03683_591_c1 3300050489 Bacteria 10402
583 nmdc:mga03n38_20105_c1 3300050490 Bacteria 2666
584 nmdc:mga00v17_139488_c1 3300050491 Bacteria 1554
585 nmdc:mga0k408_161729_c1 3300050493 Bacteria 1334
586 nmdc:mga0k408_353_c1 3300050493 Bacteria 25220
587 nmdc:mga0k408_72272_c1 3300050493 Bacteria 2015
588 nmdc:mga06z11_231_c1 3300050494 Bacteria 21729
589 nmdc:mga04h51_485_c1 3300050495 Bacteria 9513
590 nmdc:mga07m45_116560_c1 3300050496 Bacteria 1541
591 nmdc:mga07m45_263_c1 3300050496 Bacteria 21293
592 nmdc:mga07m45_2_c1 3300050496 Bacteria 451154
593 nmdc:mga07m45_57039_c1 3300050496 Bacteria 2208
594 nmdc:mga07m45_88_c1 3300050496 Bacteria 34971
595 nmdc:mga05p37_360043_c1 3300050507 Bacteria 1710
596 nmdc:mga08y16_177547_c1 3300050511 Bacteria 2211
597 nmdc:mga08y16_46_c1 3300050511 Bacteria 112050
598 nmdc:mga0n895_25306_c1 3300050512 Bacteria 5606
599 nmdc:mga08x19_69278_c1 3300050514 Bacteria 2297
600 nmdc:mga0sz30_1776_c1 3300050516 Bacteria 7657
601 Ga0500643_006677 3300053087 Bacteria 4779
602 Ga0500643_010806 3300053087 Bacteria 3374
603 Ga0500643_036052 3300053087 Bacteria 1478
604 Ga0500644_0008259 3300053088 Bacteria 2743
605 Ga0500646_0010306 3300053090 Bacteria 2398
606 Ga0500651_0002923 3300053093 Bacteria 9181
607 Ga0500566_0037686 3300053094 Bacteria 2800
608 Ga0500641_0004583 3300053096 Bacteria 4884
609 Ga0500556_0049884 3300053104 Bacteria 1511
610 Ga0500569_002802 3300053109 Bacteria 3479
611 Ga0500572_002675 3300053111 Bacteria 4217
612 Ga0500592_000770 3300053116 Bacteria 5266
613 Ga0500594_0002724 3300053118 Bacteria 3847
614 Ga0500594_0067983 3300053118 Bacteria 1042
615 Ga0500608_000265 3300053122 Bacteria 20322
616 Ga0500614_000567 3300053123 Bacteria 9542
617 Ga0500618_000833 3300053125 Bacteria 16749
618 Ga0500618_004394 3300053125 Bacteria 4531
619 Ga0500618_006225 3300053125 Bacteria 3524
620 Ga0500642_0000278 3300053130 Bacteria 19182
621 Ga0500652_003604 3300053131 Bacteria 4702
622 Ga0500655_000670 3300053133 Bacteria 6806
623 Ga0500658_0000047 3300053134 Bacteria 66543
624 Ga0500559_0000442 3300053136 Bacteria 29452
625 Ga0500559_0002100 3300053136 Bacteria 10621
626 Ga0500559_0005405 3300053136 Bacteria 5884
627 Ga0500568_0002510 3300053139 Bacteria 10740
628 Ga0500577_0004311 3300053142 Bacteria 3750
629 Ga0500577_0007102 3300053142 Bacteria 3125
630 Ga0500577_0102201 3300053142 Bacteria 1173
631 Ga0500588_0000198 3300053146 Bacteria 8377
632 Ga0500590_021126 3300053148 Bacteria 3379
633 Ga0500604_0000031 3300053151 Bacteria 57942
634 Ga0500604_0050890 3300053151 Bacteria 1278
635 Ga0500616_0000108 3300053153 Bacteria 152917
636 Ga0500616_0001465 3300053153 Bacteria 22527
637 Ga0500616_0001953 3300053153 Bacteria 18378
638 Ga0500616_0002610 3300053153 Bacteria 14737
639 Ga0500616_0002923 3300053153 Bacteria 13613
640 Ga0500619_038130 3300053154 Bacteria 1505
641 Ga0500622_0000937 3300053156 Bacteria 24806
642 Ga0500622_0006169 3300053156 Bacteria 7026
643 Ga0500624_000072 3300053157 Bacteria 57950
644 Ga0500624_000210 3300053157 Bacteria 22056
645 Ga0500627_0000297 3300053158 Bacteria 13822
646 Ga0500639_005154 3300053163 Bacteria 6669
647 Ga0500636_0000144 3300053177 Bacteria 37563
648 Ga0500636_0005061 3300053177 Bacteria 7481
649 Ga0500636_0120981 3300053177 Bacteria 1468
650 Ga0500567_007296 3300053723 Bacteria 5202
651 Ga0500570_000059 3300053724 Bacteria 27832
652 Ga0500611_001425 3300053727 Bacteria 2624
653 Ga0500625_000003 3300053729 Bacteria 268493
654 Ga0500645_004201 3300053730 Bacteria 5602
655 Ga0500645_005487 3300053730 Bacteria 4658
656 Ga0500656_003807 3300053732 Bacteria 1428
657 Ga0500587_005434 3300053739 Bacteria 1712
658 Ga0501082_0001742 3300060353 Bacteria 19211
659 Ga0466962_0022700 3300061719 Bacteria 3016

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046473 Ga0495582_0062462 Ga0495582_0062462_586_1620 313
2 3300046460 Ga0495638_0093897 Ga0495638_0093897_32_1000 315
3 3300046665 Ga0495661_0160659 Ga0495661_0160659_20_982 315
4 3300048905 Ga0496102_0339008 Ga0496102_0339008_441_1403 315
5 3300053118 Ga0500594_0067983 Ga0500594_0067983_15_977 315
6 3300053142 Ga0500577_0102201 Ga0500577_0102201_187_1149 315
7 3300026121 Ga0207683_10207938 Ga0207683_102079382 317
8 3300046492 Ga0495585_0152065 Ga0495585_0152065_14_1042 327
9 3300047318 Ga0495636_0022712 Ga0495636_0022712_27_1055 327
10 3300044694 Ga0466963_0018728 Ga0466963_0018728_3312_4319 331
11 3300046491 Ga0495584_0079964 Ga0495584_0079964_274_1305 332
12 3300053151 Ga0500604_0050890 Ga0500604_0050890_240_1259 333
13 3300046517 Ga0495630_0111726 Ga0495630_0111726_20_1054 336
14 3300050493 nmdc:mga0k408_72272_c1 nmdc:mga0k408_72272_c1_542_1600 337
15 3300049823 Ga0501044_0487690 Ga0501044_0487690_74_1117 340
16 3300005364 Ga0070673_100046037 Ga0070673_1000460372 342
17 3300025960 Ga0207651_10126486 Ga0207651_101264862 342
18 3300031616 Ga0307508_10007605 Ga0307508_100076059 342
19 3300046500 Ga0495596_0008204 Ga0495596_0008204_3285_4448 343
20 3300053739 Ga0500587_005434 Ga0500587_005434_12_1154 343
21 3300005539 Ga0068853_100124373 Ga0068853_1001243732 345
22 3300009551 Ga0105238_10039628 Ga0105238_100396283 345
23 3300025949 Ga0207667_10000002 Ga0207667_10000002515 345
24 3300026041 Ga0207639_10007774 Ga0207639_100077742 345
25 3300005289 Ga0065704_10009005 Ga0065704_100090051 346
26 3300005327 Ga0070658_10004072 Ga0070658_100040722 346
27 3300005564 Ga0070664_100015104 Ga0070664_1000151045 346
28 3300025909 Ga0207705_10000120 Ga0207705_1000012033 346
29 3300025945 Ga0207679_10093210 Ga0207679_100932101 346
30 3300049569 Ga0501032_0093152 Ga0501032_0093152_742_1896 346
31 3300049572 Ga0501036_0044073 Ga0501036_0044073_2196_3350 346
32 3300049581 Ga0501047_0093778 Ga0501047_0093778_1232_2386 346
33 3300049822 Ga0501035_0116678 Ga0501035_0116678_196_1350 346
34 3300049823 Ga0501044_0180316 Ga0501044_0180316_743_1897 346
35 3300005535 Ga0070684_100046047 Ga0070684_1000460471 349
36 3300046512 Ga0495610_0077086 Ga0495610_0077086_459_1526 350
37 3300046558 Ga0495633_0007390 Ga0495633_0007390_30_1127 350
38 3300005548 Ga0070665_100000232 Ga0070665_1000002325 352
39 3300028379 Ga0268266_10003472 Ga0268266_1000347217 352
40 3300035691 Ga0373931_0055251 Ga0373931_0055251_999_2078 352
41 3300005843 Ga0068860_100145738 Ga0068860_1001457383 353
42 3300009176 Ga0105242_10047440 Ga0105242_100474404 353
43 3300009176 Ga0105242_10062141 Ga0105242_100621413 353
44 3300025919 Ga0207657_10025901 Ga0207657_100259013 353
45 3300025934 Ga0207686_10009583 Ga0207686_100095835 353
46 iso_pu_bacteria 2758568016 2758639429 353
47 3300005354 Ga0070675_100028436 Ga0070675_1000284364 354
48 3300050511 nmdc:mga08y16_177547_c1 nmdc:mga08y16_177547_c1_759_1901 354
49 3300005618 Ga0068864_100001781 Ga0068864_10000178118 355
50 3300005842 Ga0068858_100001936 Ga0068858_10000193621 355
51 3300009177 Ga0105248_10019503 Ga0105248_100195034 355
52 3300025315 Ga0207697_10020398 Ga0207697_100203983 355
53 3300025941 Ga0207711_10007657 Ga0207711_100076575 355
54 3300026035 Ga0207703_10009731 Ga0207703_100097314 355
55 3300026095 Ga0207676_10001168 Ga0207676_100011686 355
56 3300017792 Ga0163161_10109611 Ga0163161_101096112 356
57 3300035398 Ga0316574_0083477 Ga0316574_0083477_900_1991 357
58 3300048928 Ga0496125_0141908 Ga0496125_0141908_35_1108 357
59 iso_pu_bacteria 2885318864 2885320801 357
60 3300005338 Ga0068868_100000036 Ga0068868_10000003685 358
61 3300005339 Ga0070660_100000347 Ga0070660_10000034736 358
62 3300005366 Ga0070659_100000034 Ga0070659_100000034104 358
63 3300025919 Ga0207657_10000839 Ga0207657_1000083911 358
64 3300025932 Ga0207690_10000005 Ga0207690_10000005312 358
65 3300026023 Ga0207677_10000044 Ga0207677_1000004452 358
66 3300048911 Ga0496108_0253004 Ga0496108_0253004_282_1412 360
67 3300048088 Ga0495602_0146940 Ga0495602_0146940_751_1842 362
68 3300048088 Ga0495602_0209775 Ga0495602_0209775_372_1463 362
69 3300005548 Ga0070665_100000105 Ga0070665_10000010532 363
70 3300028379 Ga0268266_10000055 Ga0268266_10000055235 363
71 3300005333 Ga0070677_10000559 Ga0070677_100005595 364
72 3300009098 Ga0105245_10014088 Ga0105245_100140885 364
73 3300025893 Ga0207682_10000576 Ga0207682_1000057611 364
74 3300053139 Ga0500568_0002510 Ga0500568_0002510_1349_2491 364
75 3300053153 Ga0500616_0001465 Ga0500616_0001465_244_1386 364
76 3300046683 Ga0495658_0038141 Ga0495658_0038141_13_1134 365
77 3300006058 Ga0075432_10004168 Ga0075432_100041681 366
78 3300006353 Ga0075370_10030387 Ga0075370_100303872 366
79 3300027907 Ga0207428_10025530 Ga0207428_100255304 366
80 3300048905 Ga0496102_0036013 Ga0496102_0036013_1678_2829 366
81 3300048917 Ga0496114_0269482 Ga0496114_0269482_336_1487 366
82 3300048920 Ga0496117_0003650 Ga0496117_0003650_3608_4759 366
83 3300048921 Ga0496118_0005735 Ga0496118_0005735_1912_3063 366
84 3300048929 Ga0496126_0001188 Ga0496126_0001188_30879_32030 366
85 3300050496 nmdc:mga07m45_57039_c1 nmdc:mga07m45_57039_c1_814_1965 366
86 3300014325 Ga0163163_10007083 Ga0163163_100070833 367
87 3300035170 Ga0373943_0111234 Ga0373943_0111234_84_1307 367
88 3300037853 Ga0436364_0623951 Ga0436364_0623951_171_1334 367
89 3300048903 Ga0496100_0068457 Ga0496100_0068457_796_2019 367
90 3300048907 Ga0496104_0003494 Ga0496104_0003494_3060_4283 367
91 3300048911 Ga0496108_0002007 Ga0496108_0002007_2139_3362 367
92 3300048912 Ga0496109_0005264 Ga0496109_0005264_6404_7627 367
93 3300048913 Ga0496110_0018031 Ga0496110_0018031_343_1566 367
94 3300048913 Ga0496110_0063217 Ga0496110_0063217_1707_2930 367
95 3300048914 Ga0496111_0012102 Ga0496111_0012102_2584_3807 367
96 3300048915 Ga0496112_0095315 Ga0496112_0095315_1161_2384 367
97 3300048916 Ga0496113_0000822 Ga0496113_0000822_3494_4717 367
98 3300048918 Ga0496115_0036684 Ga0496115_0036684_1564_2787 367
99 3300053727 Ga0500611_001425 Ga0500611_001425_1344_2564 367
100 3300006914 Ga0075436_100051187 Ga0075436_1000511872 368
101 3300009147 Ga0114129_10454935 Ga0114129_104549352 368
102 3300046522 Ga0495643_0000019 Ga0495643_0000019_100565_101716 368
103 3300046558 Ga0495633_0017348 Ga0495633_0017348_1617_2768 368
104 3300050507 nmdc:mga05p37_360043_c1 nmdc:mga05p37_360043_c1_453_1607 368
105 3300050514 nmdc:mga08x19_69278_c1 nmdc:mga08x19_69278_c1_1064_2218 368
106 3300053090 Ga0500646_0010306 Ga0500646_0010306_822_1964 368
107 3300053151 Ga0500604_0000031 Ga0500604_0000031_19555_20697 368
108 3300039447 Ga0436361_0523586 Ga0436361_0523586_540_1691 370
109 3300046674 Ga0495588_0000738 Ga0495588_0000738_12780_13940 370
110 3300046692 Ga0495671_0019697 Ga0495671_0019697_2214_3374 370
111 3300047470 Ga0495681_0007224 Ga0495681_0007224_327_1487 370
112 3300050493 nmdc:mga0k408_353_c1 nmdc:mga0k408_353_c1_10484_11605 370
113 3300050496 nmdc:mga07m45_88_c1 nmdc:mga07m45_88_c1_8277_9398 370
114 3300053111 Ga0500572_002675 Ga0500572_002675_1242_2402 370
115 3300053177 Ga0500636_0000144 Ga0500636_0000144_2673_3833 370
116 iso_pu_bacteria 2508501039 2508678058 372
117 3300046455 Ga0495603_0000988 Ga0495603_0000988_11830_13038 373
118 3300046499 Ga0495594_0160333 Ga0495594_0160333_56_1264 373
119 3300046794 Ga0495589_0014193 Ga0495589_0014193_2177_3385 373
120 3300047321 Ga0495676_0007422 Ga0495676_0007422_1131_2339 373
121 3300047447 Ga0495685_015806 Ga0495685_015806_384_1592 373
122 iso_pu_bacteria 2816332139 2816506841 373
123 3300005329 Ga0070683_100002003 Ga0070683_1000020036 375
124 3300005329 Ga0070683_100164059 Ga0070683_1001640592 375
125 3300005435 Ga0070714_100131545 Ga0070714_1001315452 375
126 3300005436 Ga0070713_100093464 Ga0070713_1000934641 375
127 3300005530 Ga0070679_100241703 Ga0070679_1002417032 375
128 3300005535 Ga0070684_100000748 Ga0070684_10000074818 375
129 3300005535 Ga0070684_100032929 Ga0070684_1000329294 375
130 3300005577 Ga0068857_100000132 Ga0068857_10000013214 375
131 3300005614 Ga0068856_100002961 Ga0068856_1000029613 375
132 3300009551 Ga0105238_10245863 Ga0105238_102458632 375
133 3300013105 Ga0157369_10002048 Ga0157369_100020489 375
134 3300022467 Ga0224712_10035527 Ga0224712_100355273 375
135 3300025912 Ga0207707_10059512 Ga0207707_100595124 375
136 3300025921 Ga0207652_10359735 Ga0207652_103597351 375
137 3300025924 Ga0207694_10159781 Ga0207694_101597812 375
138 3300025928 Ga0207700_10009309 Ga0207700_100093091 375
139 3300025929 Ga0207664_10007189 Ga0207664_100071898 375
140 3300025944 Ga0207661_10000743 Ga0207661_100007436 375
141 3300025944 Ga0207661_10053941 Ga0207661_100539412 375
142 3300025945 Ga0207679_10011528 Ga0207679_100115283 375
143 3300026116 Ga0207674_10000875 Ga0207674_1000087536 375
144 3300044694 Ga0466963_0041835 Ga0466963_0041835_1386_2525 375
145 3300044694 Ga0466963_0069549 Ga0466963_0069549_918_2060 375
146 3300044694 Ga0466963_0115902 Ga0466963_0115902_614_1756 375
147 3300044706 Ga0466964_0017280 Ga0466964_0017280_1445_2581 375
148 3300045976 Ga0466967_0009491 Ga0466967_0009491_4507_5646 375
149 3300045976 Ga0466967_0032996 Ga0466967_0032996_2706_3842 375
150 3300048907 Ga0496104_0032875 Ga0496104_0032875_2446_3588 375
151 3300048915 Ga0496112_0020625 Ga0496112_0020625_4079_5221 375
152 3300048915 Ga0496112_0078711 Ga0496112_0078711_375_1511 375
153 3300048917 Ga0496114_0001735 Ga0496114_0001735_3280_4506 375
154 3300049571 Ga0501034_0128127 Ga0501034_0128127_471_1625 375
155 3300060353 Ga0501082_0001742 Ga0501082_0001742_7283_8431 375
156 3300061719 Ga0466962_0022700 Ga0466962_0022700_664_1803 375
157 iso_pu_bacteria 2599185292 2599904135 375
158 iso_pu_bacteria 2643221569 2643861332 375
159 iso_pu_bacteria 2643221594 2643983119 375
160 iso_pu_bacteria 2643221621 2644120538 375
161 iso_pu_bacteria 2808606395 2809032890 375
162 iso_pu_bacteria 2855730933 2855733015 375
163 iso_pu_bacteria 2855767633 2855771767 375
164 iso_pu_bacteria 2856314179 2856318166 375
165 iso_pu_bacteria 2857537821 2857537824 375
166 iso_pu_bacteria 2858950400 2858956241 375
167 iso_pu_bacteria 2881412998 2881415823 375
168 iso_pu_bacteria 2891633521 2891636798 375
169 iso_pu_bacteria 2906414383 2906418203 375
170 iso_pu_bacteria 2941479691 2941482888 375
171 iso_pu_bacteria 2961170736 2961175848 375
172 iso_pu_bacteria 2970503327 2970508513 375
173 iso_pu_bacteria 2979808191 2979811838 375
174 iso_pu_bacteria 2989349275 2989352632 375
175 3300005289 Ga0065704_10079565 Ga0065704_100795652 376
176 3300005327 Ga0070658_10132353 Ga0070658_101323533 376
177 3300005356 Ga0070674_100061329 Ga0070674_1000613292 376
178 3300005435 Ga0070714_100001638 Ga0070714_1000016387 376
179 3300005467 Ga0070706_100001450 Ga0070706_10000145013 376
180 3300005467 Ga0070706_100168273 Ga0070706_1001682733 376
181 3300005468 Ga0070707_100021081 Ga0070707_1000210815 376
182 3300005471 Ga0070698_100139653 Ga0070698_1001396532 376
183 3300005617 Ga0068859_100002459 Ga0068859_10000245911 376
184 3300005843 Ga0068860_100011535 Ga0068860_1000115354 376
185 3300006038 Ga0075365_10018258 Ga0075365_100182583 376
186 3300006048 Ga0075363_100055032 Ga0075363_1000550322 376
187 3300006051 Ga0075364_10209901 Ga0075364_102099012 376
188 3300006175 Ga0070712_100123961 Ga0070712_1001239611 376
189 3300006177 Ga0075362_10012482 Ga0075362_100124822 376
190 3300006178 Ga0075367_10050617 Ga0075367_100506171 376
191 3300006186 Ga0075369_10096982 Ga0075369_100969822 376
192 3300006195 Ga0075366_10142000 Ga0075366_101420001 376
193 3300006353 Ga0075370_10000007 Ga0075370_1000000759 376
194 3300006353 Ga0075370_10040419 Ga0075370_100404193 376
195 3300009098 Ga0105245_10087320 Ga0105245_100873202 376
196 3300009147 Ga0114129_10399020 Ga0114129_103990201 376
197 3300009148 Ga0105243_10023246 Ga0105243_100232463 376
198 3300009176 Ga0105242_10133617 Ga0105242_101336173 376
199 3300009177 Ga0105248_10153966 Ga0105248_101539663 376
200 3300011119 Ga0105246_10083818 Ga0105246_100838182 376
201 3300013296 Ga0157374_10151270 Ga0157374_101512702 376
202 3300013307 Ga0157372_10133610 Ga0157372_101336102 376
203 3300013308 Ga0157375_10172571 Ga0157375_101725712 376
204 3300014326 Ga0157380_10028164 Ga0157380_100281642 376
205 3300025901 Ga0207688_10044607 Ga0207688_100446072 376
206 3300025908 Ga0207643_10151267 Ga0207643_101512671 376
207 3300025910 Ga0207684_10000750 Ga0207684_1000075024 376
208 3300025910 Ga0207684_10038811 Ga0207684_100388111 376
209 3300025915 Ga0207693_10092657 Ga0207693_100926573 376
210 3300025922 Ga0207646_10014781 Ga0207646_100147815 376
211 3300025922 Ga0207646_10085402 Ga0207646_100854022 376
212 3300025927 Ga0207687_10037929 Ga0207687_100379292 376
213 3300025929 Ga0207664_10003232 Ga0207664_100032324 376
214 3300025935 Ga0207709_10083363 Ga0207709_100833632 376
215 3300025941 Ga0207711_10276342 Ga0207711_102763422 376
216 3300025944 Ga0207661_10047497 Ga0207661_100474972 376
217 3300026023 Ga0207677_10187761 Ga0207677_101877612 376
218 3300026067 Ga0207678_10140873 Ga0207678_101408731 376
219 3300026095 Ga0207676_10204598 Ga0207676_102045982 376
220 3300026121 Ga0207683_10019848 Ga0207683_100198483 376
221 3300027614 Ga0209970_1000216 Ga0209970_10002165 376
222 3300027866 Ga0209813_10000538 Ga0209813_100005387 376
223 3300027876 Ga0209974_10008422 Ga0209974_100084222 376
224 3300028381 Ga0268264_10008180 Ga0268264_100081805 376
225 3300031616 Ga0307508_10007527 Ga0307508_100075273 376
226 3300035170 Ga0373943_0002887 Ga0373943_0002887_2735_3904 376
227 3300035171 Ga0373946_0015907 Ga0373946_0015907_761_1930 376
228 3300035695 Ga0373927_0023557 Ga0373927_0023557_1593_2762 376
229 3300035725 Ga0373947_0005518 Ga0373947_0005518_4358_5527 376
230 3300036401 Ga0373937_0204671 Ga0373937_0204671_52_1197 376
231 3300037068 Ga0373925_0015618 Ga0373925_0015618_3904_5073 376
232 3300046519 Ga0495632_0000071 Ga0495632_0000071_25471_26610 376
233 3300046530 Ga0495654_0092141 Ga0495654_0092141_208_1377 376
234 3300046542 Ga0495597_0001142 Ga0495597_0001142_11260_12429 376
235 3300046558 Ga0495633_0047771 Ga0495633_0047771_313_1482 376
236 3300046616 Ga0495668_0007365 Ga0495668_0007365_2057_3226 376
237 3300046665 Ga0495661_0012421 Ga0495661_0012421_1457_2596 376
238 3300046683 Ga0495658_0027317 Ga0495658_0027317_1314_2534 376
239 3300046684 Ga0495669_0000457 Ga0495669_0000457_14078_15247 376
240 3300046810 Ga0495660_0085296 Ga0495660_0085296_231_1400 376
241 3300047315 Ga0495581_0073713 Ga0495581_0073713_23_1243 376
242 3300047443 Ga0495687_000088 Ga0495687_000088_125523_126668 376
243 3300047472 Ga0495686_0116773 Ga0495686_0116773_246_1415 376
244 3300048090 Ga0495615_0002368 Ga0495615_0002368_130_1299 376
245 3300048904 Ga0496101_0134058 Ga0496101_0134058_140_1360 376
246 3300048913 Ga0496110_0078107 Ga0496110_0078107_1177_2397 376
247 3300048915 Ga0496112_0118720 Ga0496112_0118720_1403_2548 376
248 3300048929 Ga0496126_0000090 Ga0496126_0000090_189215_190369 376
249 3300048929 Ga0496126_0032887 Ga0496126_0032887_1892_3043 376
250 3300050489 nmdc:mga03683_591_c1 nmdc:mga03683_591_c1_4740_5915 376
251 3300050490 nmdc:mga03n38_20105_c1 nmdc:mga03n38_20105_c1_875_2050 376
252 3300050491 nmdc:mga00v17_139488_c1 nmdc:mga00v17_139488_c1_63_1238 376
253 3300050493 nmdc:mga0k408_161729_c1 nmdc:mga0k408_161729_c1_20_1189 376
254 3300050494 nmdc:mga06z11_231_c1 nmdc:mga06z11_231_c1_19045_20220 376
255 3300050495 nmdc:mga04h51_485_c1 nmdc:mga04h51_485_c1_2501_3676 376
256 3300050496 nmdc:mga07m45_116560_c1 nmdc:mga07m45_116560_c1_76_1251 376
257 3300050496 nmdc:mga07m45_263_c1 nmdc:mga07m45_263_c1_14845_16020 376
258 3300050496 nmdc:mga07m45_2_c1 nmdc:mga07m45_2_c1_349462_350631 376
259 3300050516 nmdc:mga0sz30_1776_c1 nmdc:mga0sz30_1776_c1_83_1258 376
260 3300053087 Ga0500643_006677 Ga0500643_006677_2356_3522 376
261 3300053093 Ga0500651_0002923 Ga0500651_0002923_3851_5020 376
262 3300053094 Ga0500566_0037686 Ga0500566_0037686_443_1612 376
263 3300053096 Ga0500641_0004583 Ga0500641_0004583_3388_4557 376
264 3300053104 Ga0500556_0049884 Ga0500556_0049884_286_1455 376
265 3300053109 Ga0500569_002802 Ga0500569_002802_1856_3025 376
266 3300053122 Ga0500608_000265 Ga0500608_000265_18655_19824 376
267 3300053123 Ga0500614_000567 Ga0500614_000567_4491_5660 376
268 3300053125 Ga0500618_004394 Ga0500618_004394_2183_3352 376
269 3300053130 Ga0500642_0000278 Ga0500642_0000278_3924_5093 376
270 3300053131 Ga0500652_003604 Ga0500652_003604_3193_4362 376
271 3300053133 Ga0500655_000670 Ga0500655_000670_3909_5078 376
272 3300053136 Ga0500559_0005405 Ga0500559_0005405_2047_3216 376
273 3300053142 Ga0500577_0004311 Ga0500577_0004311_1428_2597 376
274 3300053148 Ga0500590_021126 Ga0500590_021126_1979_3148 376
275 3300053154 Ga0500619_038130 Ga0500619_038130_103_1272 376
276 3300053156 Ga0500622_0006169 Ga0500622_0006169_1947_3116 376
277 3300053157 Ga0500624_000072 Ga0500624_000072_5356_6522 376
278 3300053163 Ga0500639_005154 Ga0500639_005154_1643_2812 376
279 3300053177 Ga0500636_0005061 Ga0500636_0005061_1144_2310 376
280 3300053177 Ga0500636_0120981 Ga0500636_0120981_156_1325 376
281 3300053723 Ga0500567_007296 Ga0500567_007296_3225_4394 376
282 3300053724 Ga0500570_000059 Ga0500570_000059_12750_13919 376
283 3300053729 Ga0500625_000003 Ga0500625_000003_194327_195496 376
284 3300053730 Ga0500645_004201 Ga0500645_004201_293_1462 376
285 3300053730 Ga0500645_005487 Ga0500645_005487_3080_4255 376
286 3300053732 Ga0500656_003807 Ga0500656_003807_121_1290 376
287 iso_pu_bacteria 2534681786 2535487023 376
288 iso_pu_bacteria 2739367664 2739651477 376
289 iso_pu_bacteria 2739367865 2740029950 376
290 iso_pu_bacteria 2751185800 2753357145 376
291 iso_pu_bacteria 2818991463 2819694293 376
292 iso_pu_bacteria 2915650412 2915654387 376
293 iso_pu_bacteria 2989776772 2989781214 376
294 3300005331 Ga0070670_100126234 Ga0070670_1001262342 377
295 3300005336 Ga0070680_100000727 Ga0070680_10000072716 377
296 3300005344 Ga0070661_100000001 Ga0070661_100000001342 377
297 3300005345 Ga0070692_10000276 Ga0070692_1000027615 377
298 3300005353 Ga0070669_100106120 Ga0070669_1001061202 377
299 3300005435 Ga0070714_100109168 Ga0070714_1001091682 377
300 3300005436 Ga0070713_100003580 Ga0070713_1000035805 377
301 3300005456 Ga0070678_100227437 Ga0070678_1002274372 377
302 3300005458 Ga0070681_10014042 Ga0070681_100140425 377
303 3300005530 Ga0070679_100000003 Ga0070679_100000003153 377
304 3300005535 Ga0070684_100183359 Ga0070684_1001833592 377
305 3300005539 Ga0068853_100018340 Ga0068853_1000183405 377
306 3300005544 Ga0070686_100000140 Ga0070686_10000014052 377
307 3300005614 Ga0068856_100214593 Ga0068856_1002145932 377
308 3300005841 Ga0068863_100059233 Ga0068863_1000592333 377
309 3300005937 Ga0081455_10001460 Ga0081455_100014604 377
310 3300006028 Ga0070717_10002935 Ga0070717_100029357 377
311 3300013307 Ga0157372_10037866 Ga0157372_100378665 377
312 3300020070 Ga0206356_10774019 Ga0206356_107740191 377
313 3300025291 Ga0209675_1002733 Ga0209675_10027336 377
314 3300025912 Ga0207707_10010643 Ga0207707_100106434 377
315 3300025917 Ga0207660_10000078 Ga0207660_100000789 377
316 3300025920 Ga0207649_10000011 Ga0207649_10000011156 377
317 3300025921 Ga0207652_10000004 Ga0207652_10000004152 377
318 3300025923 Ga0207681_10115709 Ga0207681_101157093 377
319 3300025927 Ga0207687_10013831 Ga0207687_100138314 377
320 3300025928 Ga0207700_10003514 Ga0207700_100035143 377
321 3300026078 Ga0207702_10293593 Ga0207702_102935932 377
322 3300026088 Ga0207641_10046616 Ga0207641_100466163 377
323 3300031456 Ga0307513_10015291 Ga0307513_100152917 377
324 3300031665 Ga0316575_10004304 Ga0316575_100043043 377
325 3300031691 Ga0316579_10003150 Ga0316579_100031502 377
326 3300031728 Ga0316578_10004181 Ga0316578_100041813 377
327 3300031733 Ga0316577_10006191 Ga0316577_100061913 377
328 3300031901 Ga0307406_10059244 Ga0307406_100592443 377
329 3300031995 Ga0307409_100052099 Ga0307409_1000520993 377
330 3300032002 Ga0307416_100024842 Ga0307416_1000248423 377
331 3300032126 Ga0307415_100000216 Ga0307415_10000021615 377
332 3300032133 Ga0316583_10005971 Ga0316583_100059713 377
333 3300035398 Ga0316574_0007755 Ga0316574_0007755_1531_2691 377
334 3300036647 Ga0316582_0012322 Ga0316582_0012322_2087_3247 377
335 3300036647 Ga0316582_0029496 Ga0316582_0029496_1529_2689 377
336 3300036712 Ga0316584_0024929 Ga0316584_0024929_2361_3521 377
337 3300037466 Ga0395898_0002667 Ga0395898_0002667_19049_20206 377
338 3300037466 Ga0395898_0228097 Ga0395898_0228097_106_1251 377
339 3300037588 Ga0316581_0002782 Ga0316581_0002782_1460_2620 377
340 3300039145 Ga0237816_00675 Ga0237816_00675_797_1939 377
341 3300039437 Ga0436365_1862304 Ga0436365_1862304_19827_20969 377
342 3300041443 Ga0451789_0160161 Ga0451789_0160161_80_1237 377
343 3300045976 Ga0466967_0210765 Ga0466967_0210765_484_1716 377
344 3300046471 Ga0495650_0064296 Ga0495650_0064296_234_1391 377
345 3300046616 Ga0495668_0002749 Ga0495668_0002749_2099_3250 377
346 3300046616 Ga0495668_0006888 Ga0495668_0006888_4842_5993 377
347 3300046691 Ga0495670_0044048 Ga0495670_0044048_893_2044 377
348 3300046692 Ga0495671_0088770 Ga0495671_0088770_266_1408 377
349 3300048915 Ga0496112_0231596 Ga0496112_0231596_434_1579 377
350 3300049459 Ga0495678_018010 Ga0495678_018010_1382_2533 377
351 3300049742 Ga0501080_0216113 Ga0501080_0216113_398_1549 377
352 3300050512 nmdc:mga0n895_25306_c1 nmdc:mga0n895_25306_c1_2399_3541 377
353 3300053087 Ga0500643_010806 Ga0500643_010806_531_1676 377
354 3300053087 Ga0500643_036052 Ga0500643_036052_121_1266 377
355 3300053116 Ga0500592_000770 Ga0500592_000770_1716_2867 377
356 3300053146 Ga0500588_0000198 Ga0500588_0000198_2862_4028 377
357 3300053153 Ga0500616_0002610 Ga0500616_0002610_12556_13788 377
358 3300053153 Ga0500616_0002923 Ga0500616_0002923_9956_11191 377
359 3300053158 Ga0500627_0000297 Ga0500627_0000297_10587_11738 377
360 iso_pu_bacteria 2828305725 2828307547 377
361 3300003791 Ga0055530_10000579 Ga0055530_100005795 378
362 3300005331 Ga0070670_100000981 Ga0070670_10000098110 378
363 3300005331 Ga0070670_100026142 Ga0070670_1000261422 378
364 3300005335 Ga0070666_10191773 Ga0070666_101917731 378
365 3300005347 Ga0070668_100000013 Ga0070668_100000013102 378
366 3300005347 Ga0070668_100002822 Ga0070668_1000028222 378
367 3300005353 Ga0070669_100006287 Ga0070669_1000062876 378
368 3300005353 Ga0070669_100019626 Ga0070669_1000196264 378
369 3300005355 Ga0070671_100000225 Ga0070671_10000022526 378
370 3300005355 Ga0070671_100038951 Ga0070671_1000389512 378
371 3300005367 Ga0070667_100000328 Ga0070667_10000032810 378
372 3300005367 Ga0070667_100000413 Ga0070667_10000041312 378
373 3300005367 Ga0070667_100000889 Ga0070667_1000008894 378
374 3300005466 Ga0070685_10000593 Ga0070685_1000059312 378
375 3300005548 Ga0070665_100024985 Ga0070665_1000249853 378
376 3300005617 Ga0068859_100013326 Ga0068859_1000133263 378
377 3300005617 Ga0068859_100143598 Ga0068859_1001435982 378
378 3300005618 Ga0068864_100001706 Ga0068864_1000017067 378
379 3300005618 Ga0068864_100017608 Ga0068864_1000176081 378
380 3300005719 Ga0068861_100015250 Ga0068861_1000152504 378
381 3300005841 Ga0068863_100000293 Ga0068863_10000029312 378
382 3300005841 Ga0068863_100000466 Ga0068863_10000046641 378
383 3300005841 Ga0068863_100000646 Ga0068863_1000006468 378
384 3300005841 Ga0068863_100004472 Ga0068863_10000447210 378
385 3300005841 Ga0068863_100012390 Ga0068863_1000123905 378
386 3300005841 Ga0068863_100016521 Ga0068863_1000165215 378
387 3300005841 Ga0068863_100054023 Ga0068863_1000540233 378
388 3300005842 Ga0068858_100000374 Ga0068858_1000003744 378
389 3300005842 Ga0068858_100174174 Ga0068858_1001741741 378
390 3300005843 Ga0068860_100000436 Ga0068860_10000043610 378
391 3300005843 Ga0068860_100000473 Ga0068860_1000004734 378
392 3300005843 Ga0068860_100000638 Ga0068860_10000063821 378
393 3300005844 Ga0068862_100001919 Ga0068862_1000019198 378
394 3300006931 Ga0097620_100013326 Ga0097620_1000133263 378
395 3300006931 Ga0097620_100143601 Ga0097620_1001436012 378
396 3300009177 Ga0105248_10003501 Ga0105248_1000350110 378
397 3300009551 Ga0105238_10014995 Ga0105238_100149952 378
398 3300009553 Ga0105249_10026960 Ga0105249_100269603 378
399 3300009553 Ga0105249_10257053 Ga0105249_102570532 378
400 3300014325 Ga0163163_10012463 Ga0163163_100124638 378
401 3300014497 Ga0182008_10002889 Ga0182008_100028892 378
402 3300014968 Ga0157379_10009393 Ga0157379_100093936 378
403 3300015261 Ga0182006_1000214 Ga0182006_100021421 378
404 3300025297 Ga0209758_1000924 Ga0209758_100092427 378
405 3300025298 Ga0209050_1000049 Ga0209050_100004914 378
406 3300025304 Ga0209257_1000692 Ga0209257_100069218 378
407 3300025304 Ga0209257_1018524 Ga0209257_10185243 378
408 3300025903 Ga0207680_10021518 Ga0207680_100215183 378
409 3300025913 Ga0207695_10094525 Ga0207695_100945253 378
410 3300025923 Ga0207681_10006820 Ga0207681_100068203 378
411 3300025924 Ga0207694_10052642 Ga0207694_100526425 378
412 3300025925 Ga0207650_10059019 Ga0207650_100590192 378
413 3300025931 Ga0207644_10000398 Ga0207644_1000039818 378
414 3300025941 Ga0207711_10000552 Ga0207711_1000055215 378
415 3300025941 Ga0207711_10001339 Ga0207711_1000133925 378
416 3300025961 Ga0207712_10124398 Ga0207712_101243982 378
417 3300025972 Ga0207668_10000022 Ga0207668_100000226 378
418 3300025972 Ga0207668_10000132 Ga0207668_1000013237 378
419 3300025986 Ga0207658_10000021 Ga0207658_10000021164 378
420 3300025986 Ga0207658_10000269 Ga0207658_1000026938 378
421 3300025986 Ga0207658_10000646 Ga0207658_1000064624 378
422 3300025986 Ga0207658_10024951 Ga0207658_100249512 378
423 3300026035 Ga0207703_10000309 Ga0207703_1000030937 378
424 3300026035 Ga0207703_10022814 Ga0207703_100228142 378
425 3300026088 Ga0207641_10000040 Ga0207641_10000040162 378
426 3300026088 Ga0207641_10000098 Ga0207641_1000009863 378
427 3300026088 Ga0207641_10000303 Ga0207641_100003038 378
428 3300026088 Ga0207641_10003348 Ga0207641_1000334810 378
429 3300026088 Ga0207641_10004850 Ga0207641_100048508 378
430 3300026095 Ga0207676_10000538 Ga0207676_100005387 378
431 3300026118 Ga0207675_100040137 Ga0207675_1000401373 378
432 3300028379 Ga0268266_10016499 Ga0268266_100164994 378
433 3300028380 Ga0268265_10000536 Ga0268265_1000053632 378
434 3300028380 Ga0268265_10001938 Ga0268265_100019384 378
435 3300028381 Ga0268264_10000224 Ga0268264_1000022455 378
436 3300028381 Ga0268264_10000448 Ga0268264_1000044810 378
437 3300028381 Ga0268264_10000670 Ga0268264_1000067033 378
438 3300031548 Ga0307408_100184728 Ga0307408_1001847282 378
439 3300031730 Ga0307516_10000780 Ga0307516_1000078016 378
440 3300038443 Ga0395901_0356252 Ga0395901_0356252_345_1493 378
441 3300039093 Ga0400489_74021 Ga0400489_74021_66426_67574 378
442 3300041413 Ga0439465_0003542 Ga0439465_0003542_2566_3729 378
443 3300041997 Ga0439431_0009881 Ga0439431_0009881_425_1588 378
444 3300041999 Ga0439433_0016132 Ga0439433_0016132_152_1315 378
445 3300042004 Ga0439445_0001721 Ga0439445_0001721_1359_2522 378
446 3300042006 Ga0439432_013107 Ga0439432_013107_1107_2270 378
447 3300042010 Ga0439452_002901 Ga0439452_002901_990_2153 378
448 3300042015 Ga0439462_0002353 Ga0439462_0002353_1631_2794 378
449 3300042876 Ga0451577_0009675 Ga0451577_0009675_4392_5549 378
450 3300044712 Ga0453684_0001067 Ga0453684_0001067_54681_55838 378
451 3300044712 Ga0453684_0005158 Ga0453684_0005158_1689_2846 378
452 3300044712 Ga0453684_0013899 Ga0453684_0013899_6874_8031 378
453 3300046474 Ga0495605_0085363 Ga0495605_0085363_196_1347 378
454 3300046518 Ga0495631_0002618 Ga0495631_0002618_6789_7940 378
455 3300046519 Ga0495632_0017991 Ga0495632_0017991_2095_3246 378
456 3300046648 Ga0495611_0005124 Ga0495611_0005124_327_1475 378
457 3300046660 Ga0495625_0009987 Ga0495625_0009987_3759_4910 378
458 3300047317 Ga0495604_0000217 Ga0495604_0000217_3367_4518 378
459 3300047472 Ga0495686_0045107 Ga0495686_0045107_422_1573 378
460 3300048905 Ga0496102_0019796 Ga0496102_0019796_253_1401 378
461 3300048907 Ga0496104_0024889 Ga0496104_0024889_3388_4578 378
462 3300048908 Ga0496105_0001303 Ga0496105_0001303_8715_9905 378
463 3300048920 Ga0496117_0011109 Ga0496117_0011109_4805_5995 378
464 3300048922 Ga0496119_0012959 Ga0496119_0012959_2095_3285 378
465 3300048922 Ga0496119_0059160 Ga0496119_0059160_581_1729 378
466 3300048924 Ga0496121_0000130 Ga0496121_0000130_67813_68961 378
467 3300048924 Ga0496121_0010155 Ga0496121_0010155_6516_7706 378
468 3300048924 Ga0496121_0054278 Ga0496121_0054278_234_1424 378
469 3300048927 Ga0496124_0004245 Ga0496124_0004245_11595_12785 378
470 3300049459 Ga0495678_005337 Ga0495678_005337_3142_4293 378
471 3300049573 Ga0501037_0007425 Ga0501037_0007425_2295_3455 378
472 3300049581 Ga0501047_0003160 Ga0501047_0003160_10180_11328 378
473 3300049588 Ga0501072_0109871 Ga0501072_0109871_493_1653 378
474 3300049589 Ga0501073_0000068 Ga0501073_0000068_1177_2337 378
475 3300049593 Ga0501077_0000056 Ga0501077_0000056_35554_36714 378
476 3300049671 Ga0501238_002816 Ga0501238_002816_383_1531 378
477 3300049823 Ga0501044_0087580 Ga0501044_0087580_187_1347 378
478 3300053118 Ga0500594_0002724 Ga0500594_0002724_2192_3343 378
479 3300053125 Ga0500618_000833 Ga0500618_000833_6640_7791 378
480 3300053125 Ga0500618_006225 Ga0500618_006225_1470_2621 378
481 3300053134 Ga0500658_0000047 Ga0500658_0000047_29118_30266 378
482 3300053136 Ga0500559_0000442 Ga0500559_0000442_11592_12743 378
483 iso_pu_bacteria 2558860112 2558911688 378
484 iso_pu_bacteria 2675902999 2676202151 378
485 3300003187 JGI25151J46595_10000228 JGI25151J46595_1000022829 379
486 3300005844 Ga0068862_100230441 Ga0068862_1002304411 379
487 3300006042 Ga0075368_10004106 Ga0075368_100041064 379
488 3300006177 Ga0075362_10058785 Ga0075362_100587852 379
489 3300006195 Ga0075366_10001326 Ga0075366_100013262 379
490 3300009036 Ga0105244_10035746 Ga0105244_100357463 379
491 3300009094 Ga0111539_10006194 Ga0111539_100061943 379
492 3300013102 Ga0157371_10003600 Ga0157371_100036003 379
493 3300014326 Ga0157380_10195109 Ga0157380_101951092 379
494 3300020082 Ga0206353_11669705 Ga0206353_116697052 379
495 3300025294 Ga0209025_1000019 Ga0209025_1000019308 379
496 3300026142 Ga0207698_10137939 Ga0207698_101379392 379
497 3300027907 Ga0207428_10000092 Ga0207428_1000009235 379
498 3300028556 Ga0265337_1009722 Ga0265337_10097223 379
499 3300028794 Ga0307515_10083866 Ga0307515_100838661 379
500 3300031240 Ga0265320_10001604 Ga0265320_100016048 379
501 3300031456 Ga0307513_10000012 Ga0307513_10000012281 379
502 3300031456 Ga0307513_10132955 Ga0307513_101329552 379
503 3300031711 Ga0265314_10004285 Ga0265314_1000428511 379
504 3300031711 Ga0265314_10017039 Ga0265314_100170392 379
505 3300031733 Ga0316577_10045703 Ga0316577_100457032 379
506 3300031911 Ga0307412_10002104 Ga0307412_100021042 379
507 3300032002 Ga0307416_100142383 Ga0307416_1001423832 379
508 3300037471 Ga0395905_0126226 Ga0395905_0126226_156_1397 379
509 3300044694 Ga0466963_0009063 Ga0466963_0009063_2415_3575 379
510 3300044694 Ga0466963_0017004 Ga0466963_0017004_2939_4111 379
511 3300045976 Ga0466967_0139468 Ga0466967_0139468_877_2037 379
512 3300046452 Ga0495617_001554 Ga0495617_001554_4924_6078 379
513 3300046453 Ga0495627_000014 Ga0495627_000014_129557_130711 379
514 3300046460 Ga0495638_0000574 Ga0495638_0000574_2977_4131 379
515 3300046501 Ga0495607_0004169 Ga0495607_0004169_4985_6139 379
516 3300046512 Ga0495610_0001425 Ga0495610_0001425_7702_8853 379
517 3300046522 Ga0495643_0079766 Ga0495643_0079766_529_1689 379
518 3300046538 Ga0495609_0011105 Ga0495609_0011105_2458_3624 379
519 3300046542 Ga0495597_0001324 Ga0495597_0001324_15210_16376 379
520 3300046692 Ga0495671_0052407 Ga0495671_0052407_571_1818 379
521 3300048916 Ga0496113_0128734 Ga0496113_0128734_437_1603 379
522 3300048919 Ga0496116_0009863 Ga0496116_0009863_4960_6108 379
523 3300048919 Ga0496116_0064990 Ga0496116_0064990_728_1876 379
524 3300048921 Ga0496118_0107692 Ga0496118_0107692_613_1761 379
525 3300048923 Ga0496120_0062689 Ga0496120_0062689_865_2013 379
526 3300048924 Ga0496121_0003287 Ga0496121_0003287_11804_12952 379
527 3300048924 Ga0496121_0015854 Ga0496121_0015854_4583_5734 379
528 3300048925 Ga0496122_0000497 Ga0496122_0000497_29937_31085 379
529 3300048925 Ga0496122_0017319 Ga0496122_0017319_4882_6030 379
530 3300048926 Ga0496123_0001884 Ga0496123_0001884_9101_10249 379
531 3300048926 Ga0496123_0013777 Ga0496123_0013777_3140_4288 379
532 3300048927 Ga0496124_0043872 Ga0496124_0043872_51_1199 379
533 3300048927 Ga0496124_0054741 Ga0496124_0054741_1793_2941 379
534 3300048928 Ga0496125_0000166 Ga0496125_0000166_56925_58073 379
535 3300048928 Ga0496125_0016464 Ga0496125_0016464_3953_5101 379
536 3300048928 Ga0496125_0136526 Ga0496125_0136526_147_1328 379
537 3300048928 Ga0496125_0189022 Ga0496125_0189022_63_1211 379
538 3300048929 Ga0496126_0032209 Ga0496126_0032209_2122_3270 379
539 3300049570 Ga0501033_0037756 Ga0501033_0037756_755_1906 379
540 3300049571 Ga0501034_0000874 Ga0501034_0000874_17205_18362 379
541 3300049571 Ga0501034_0001048 Ga0501034_0001048_12258_13421 379
542 3300049571 Ga0501034_0163474 Ga0501034_0163474_459_1610 379
543 3300049581 Ga0501047_0001179 Ga0501047_0001179_24070_25221 379
544 3300049822 Ga0501035_0060943 Ga0501035_0060943_1424_2575 379
545 3300049823 Ga0501044_0008276 Ga0501044_0008276_4174_5325 379
546 3300049823 Ga0501044_0010514 Ga0501044_0010514_969_2108 379
547 3300050489 nmdc:mga03683_38552_c1 nmdc:mga03683_38552_c1_346_1491 379
548 3300050511 nmdc:mga08y16_46_c1 nmdc:mga08y16_46_c1_70283_71428 379
549 3300053088 Ga0500644_0008259 Ga0500644_0008259_66_1220 379
550 3300053136 Ga0500559_0002100 Ga0500559_0002100_6175_7329 379
551 3300053142 Ga0500577_0007102 Ga0500577_0007102_143_1282 379
552 3300053153 Ga0500616_0000108 Ga0500616_0000108_22126_23280 379
553 3300053153 Ga0500616_0001953 Ga0500616_0001953_1788_2927 379
554 3300053156 Ga0500622_0000937 Ga0500622_0000937_835_1989 379
555 3300053157 Ga0500624_000210 Ga0500624_000210_3611_4771 379
556 3300048926 Ga0496123_0047399 Ga0496123_0047399_1207_2349 380
557 iso_pu_bacteria 2513237150 2513954612 381
558 iso_pu_bacteria 2513237165 2514043503 381
559 iso_pu_bacteria 2596583598 2597031435 381
560 iso_pu_bacteria 2599185178 2599445216 381
561 iso_pu_bacteria 2791355137 2792833517 381
562 iso_pu_bacteria 2834641062 2834643682 381
563 iso_pu_bacteria 2885266251 2885270335 381
564 iso_pu_bacteria 2900577576 2900580497 381
565 iso_pu_bacteria 2901300506 2901311801 381
566 iso_pu_bacteria 2928058823 2928063790 381
567 iso_pu_bacteria 644736347 644752294 381
568 iso_pu_bacteria 8003400568 8003405068 381
569 iso_pu_bacteria 8048746797 8048749669 381
570 3300001915 JGI24741J21665_1000448 JGI24741J21665_10004488 385
571 3300001979 JGI24740J21852_10000149 JGI24740J21852_100001494 385
572 3300001979 JGI24740J21852_10000159 JGI24740J21852_100001596 385
573 3300002705 JGI25156J39149_1007314 JGI25156J39149_10073143 385
574 3300002738 JGI25154J39366_1001599 JGI25154J39366_10015994 385
575 3300003187 JGI25151J46595_10001462 JGI25151J46595_1000146212 385
576 3300003752 Ga0055539_1000086 Ga0055539_1000086101 385
577 3300003756 Ga0055533_1001557 Ga0055533_10015574 385
578 3300003758 Ga0055532_1000041 Ga0055532_100004154 385
579 3300003761 Ga0055535_1000030 Ga0055535_1000030123 385
580 3300003762 Ga0055542_1000818 Ga0055542_10008184 385
581 3300003763 Ga0055529_1000058 Ga0055529_100005854 385
582 3300003771 Ga0055526_1011710 Ga0055526_10117104 385
583 3300003775 Ga0055524_1001952 Ga0055524_10019522 385
584 3300003781 Ga0055536_1000114 Ga0055536_100011440 385
585 3300003784 Ga0055534_1003641 Ga0055534_10036414 385
586 3300003841 Ga0055541_1001902 Ga0055541_10019024 385
587 3300005344 Ga0070661_100000072 Ga0070661_10000007255 385
588 3300005455 Ga0070663_100000015 Ga0070663_10000001565 385
589 3300005456 Ga0070678_100258433 Ga0070678_1002584332 385
590 3300005543 Ga0070672_100198775 Ga0070672_1001987752 385
591 3300005548 Ga0070665_100146602 Ga0070665_1001466022 385
592 3300005564 Ga0070664_100000058 Ga0070664_1000000588 385
593 3300005577 Ga0068857_100029386 Ga0068857_1000293863 385
594 3300005578 Ga0068854_100000025 Ga0068854_10000002557 385
595 3300005614 Ga0068856_100000084 Ga0068856_10000008456 385
596 3300006880 Ga0075429_100001204 Ga0075429_10000120419 385
597 3300006948 Ga0099826_10000107 Ga0099826_1000010713 385
598 3300009093 Ga0105240_10143133 Ga0105240_101431332 385
599 3300013100 Ga0157373_10008055 Ga0157373_100080554 385
600 3300013102 Ga0157371_10000100 Ga0157371_1000010056 385
601 3300013104 Ga0157370_10000004 Ga0157370_1000000457 385
602 3300013105 Ga0157369_10034953 Ga0157369_100349534 385
603 3300013307 Ga0157372_10000279 Ga0157372_1000027931 385
604 3300013308 Ga0157375_10108322 Ga0157375_101083222 385
605 3300014969 Ga0157376_10337921 Ga0157376_103379212 385
606 3300015261 Ga0182006_1001983 Ga0182006_10019833 385
607 3300020076 Ga0206355_1007462 Ga0206355_10074621 385
608 3300020610 Ga0154015_1588421 Ga0154015_15884215 385
609 3300025224 Ga0209784_100029 Ga0209784_100029281 385
610 3300025224 Ga0209784_100853 Ga0209784_1008534 385
611 3300025224 Ga0209784_101137 Ga0209784_1011374 385
612 3300025225 Ga0209566_100030 Ga0209566_10003057 385
613 3300025225 Ga0209566_100277 Ga0209566_10027729 385
614 3300025225 Ga0209566_101363 Ga0209566_1013634 385
615 3300025226 Ga0209674_100081 Ga0209674_10008169 385
616 3300025226 Ga0209674_100089 Ga0209674_10008937 385
617 3300025226 Ga0209674_100123 Ga0209674_10012362 385
618 3300025226 Ga0209674_102250 Ga0209674_1022504 385
619 3300025228 Ga0209672_101786 Ga0209672_1017863 385
620 3300025229 Ga0209147_100008 Ga0209147_100008667 385
621 3300025230 Ga0209563_100091 Ga0209563_10009123 385
622 3300025230 Ga0209563_100092 Ga0209563_100092128 385
623 3300025242 Ga0209258_100013 Ga0209258_100013667 385
624 3300025246 Ga0209646_1000065 Ga0209646_1000065107 385
625 3300025250 Ga0209026_1009936 Ga0209026_10099362 385
626 3300025253 Ga0209677_100030 Ga0209677_10003057 385
627 3300025254 Ga0209148_1000113 Ga0209148_1000113118 385
628 3300025254 Ga0209148_1008463 Ga0209148_10084632 385
629 3300025256 Ga0209759_1001532 Ga0209759_10015323 385
630 3300025256 Ga0209759_1005701 Ga0209759_10057012 385
631 3300025263 Ga0209565_1000659 Ga0209565_10006595 385
632 3300025272 Ga0209455_1000106 Ga0209455_100010656 385
633 3300025291 Ga0209675_1000092 Ga0209675_100009238 385
634 3300025291 Ga0209675_1000903 Ga0209675_100090310 385
635 3300025292 Ga0209676_1000378 Ga0209676_100037840 385
636 3300025294 Ga0209025_1000125 Ga0209025_1000125156 385
637 3300025294 Ga0209025_1000222 Ga0209025_100022284 385
638 3300025294 Ga0209025_1000837 Ga0209025_100083741 385
639 3300025294 Ga0209025_1001562 Ga0209025_10015629 385
640 3300025294 Ga0209025_1019959 Ga0209025_10199591 385
641 3300025295 Ga0209564_1000489 Ga0209564_100048946 385
642 3300025295 Ga0209564_1000655 Ga0209564_100065517 385
643 3300025295 Ga0209564_1001585 Ga0209564_100158513 385
644 3300025297 Ga0209758_1018355 Ga0209758_10183552 385
645 3300025299 Ga0209256_1000335 Ga0209256_100033533 385
646 3300025299 Ga0209256_1000362 Ga0209256_100036261 385
647 3300025303 Ga0209051_1016277 Ga0209051_10162772 385
648 3300025913 Ga0207695_10000535 Ga0207695_1000053531 385
649 3300025920 Ga0207649_10000222 Ga0207649_1000022217 385
650 3300025940 Ga0207691_10043621 Ga0207691_100436213 385
651 3300025945 Ga0207679_10000038 Ga0207679_1000003864 385
652 3300025981 Ga0207640_10000096 Ga0207640_1000009621 385
653 3300025986 Ga0207658_10129407 Ga0207658_101294072 385
654 3300026067 Ga0207678_10000021 Ga0207678_1000002163 385
655 3300026078 Ga0207702_10000203 Ga0207702_1000020343 385
656 3300026116 Ga0207674_10010466 Ga0207674_100104663 385
657 3300027666 Ga0209282_1000164 Ga0209282_100016413 385
658 3300028379 Ga0268266_10317852 Ga0268266_103178522 385
659 3300028786 Ga0307517_10000160 Ga0307517_1000016024 385
660 3300030522 Ga0307512_10028196 Ga0307512_100281963 385
661 3300031238 Ga0265332_10000023 Ga0265332_10000023201 385
662 3300031507 Ga0307509_10000317 Ga0307509_1000031742 385
663 3300031616 Ga0307508_10000332 Ga0307508_1000033225 385
664 3300031730 Ga0307516_10061200 Ga0307516_100612002 385
665 3300031730 Ga0307516_10114153 Ga0307516_101141533 385
666 3300033179 Ga0307507_10003609 Ga0307507_100036098 385
667 3300037312 Ga0395899_0068146 Ga0395899_0068146_576_1733 385
668 3300037418 Ga0395900_0017809 Ga0395900_0017809_3625_4782 385
669 3300037471 Ga0395905_0248951 Ga0395905_0248951_66_1226 385
670 3300039438 Ga0436360_0151113 Ga0436360_0151113_873_2033 385
671 3300039447 Ga0436361_1082374 Ga0436361_1082374_60_1220 385
672 3300039453 Ga0436362_0793039 Ga0436362_0793039_1174_2334 385
673 3300042876 Ga0451577_0003119 Ga0451577_0003119_3015_4175 385
674 3300042876 Ga0451577_0024476 Ga0451577_0024476_3924_5096 385
675 3300044658 Ga0466972_0012085 Ga0466972_0012085_162_1334 385
676 3300044666 Ga0466977_0000017 Ga0466977_0000017_22968_24137 385
677 3300044673 Ga0453683_0008099 Ga0453683_0008099_1390_2550 385
678 3300044693 Ga0466961_0029656 Ga0466961_0029656_27_1193 385
679 3300044712 Ga0453684_0048167 Ga0453684_0048167_4394_5554 385
680 3300046457 Ga0495590_0005528 Ga0495590_0005528_3450_4610 385
681 3300046463 Ga0495653_0013130 Ga0495653_0013130_983_2143 385
682 3300046472 Ga0495580_0007367 Ga0495580_0007367_7395_8555 385
683 3300046472 Ga0495580_0049094 Ga0495580_0049094_259_1422 385
684 3300046474 Ga0495605_0002043 Ga0495605_0002043_7831_8988 385
685 3300046477 Ga0495664_0014761 Ga0495664_0014761_1412_2584 385
686 3300046512 Ga0495610_0000544 Ga0495610_0000544_10811_11968 385
687 3300046526 Ga0495666_0000304 Ga0495666_0000304_386_1546 385
688 3300046531 Ga0495665_0042865 Ga0495665_0042865_285_1445 385
689 3300046538 Ga0495609_0000774 Ga0495609_0000774_4598_5755 385
690 3300046539 Ga0495621_0023547 Ga0495621_0023547_707_1867 385
691 3300046615 Ga0495656_0003734 Ga0495656_0003734_1478_2638 385
692 3300046678 Ga0495599_0017583 Ga0495599_0017583_1930_3090 385
693 3300046679 Ga0495623_0071650 Ga0495623_0071650_517_1677 385
694 3300047317 Ga0495604_0034176 Ga0495604_0034176_2696_3856 385
695 3300047319 Ga0495674_0024158 Ga0495674_0024158_2198_3370 385
696 3300047444 Ga0495675_0045177 Ga0495675_0045177_886_2046 385
697 3300048090 Ga0495615_0012211 Ga0495615_0012211_256_1416 385
698 3300048925 Ga0496122_0001804 Ga0496122_0001804_5804_6961 385
699 3300048926 Ga0496123_0003744 Ga0496123_0003744_11958_13115 385
700 3300048928 Ga0496125_0041883 Ga0496125_0041883_1236_2393 385
701 3300049571 Ga0501034_0000022 Ga0501034_0000022_199883_201040 385
702 3300049665 Ga0501227_000555 Ga0501227_000555_1564_2730 385
703 3300049668 Ga0501233_007858 Ga0501233_007858_865_2031 385
704 3300049705 Ga0501225_0005596 Ga0501225_0005596_313_1479 385

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

278

427

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

54

166

0.98

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

170

265

0.93

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

293

416

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lnx-assembly2.cif.gz_E crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9647 10 383
5lnx-assembly1.cif.gz_B crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9634 7 383
5lnx-assembly1.cif.gz_C crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.9627 12 383
2vig-assembly1.cif.gz_B crystal structure of human short-chain acyl coa dehydrogenase 0.9604 4 384
5lnx-assembly2.cif.gz_H crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis. 0.96 4 383
ID Description Score Start End Superfamily
3pfdC03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9795 231 382 1.20.140.10
af_Q9D7B6_155_263_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9736 121 230 2.40.110.10
3pfdB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.972 231 382 1.20.140.10
af_M0RAD8_170_241_2.40.110.10 Mainly Beta;Beta Barrel;Butyryl-CoA Dehydrogenase, subunit A; domain 2;Butyryl-CoA Dehydrogenase, subunit A, domain 2 0.9704 119 185 2.40.110.10
af_P9WQG1_243_389_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9689 235 384 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A2N3CQG8-F1-model_v4 Acyl-CoA dehydrogenase 0.9782 2 308 GO:0003995
GO:0050660
AF-A0A176QGM5-F1-model_v4 Acyl-CoA dehydrogenase 0.9745 3 384 GO:0003995
GO:0050660
AF-A0A437CAG7-F1-model_v4 Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial (EC 1.3.8.5) (2-methyl branched chain acyl-CoA dehydrogenase) (2-methylbutyryl-coenzyme A dehydrogenase) 0.9727 118 289 GO:0003995
GO:0005739
GO:0006631
AF-A0A2N0QJJ7-F1-model_v4 Acyl-CoA dehydrogenase NM domain-like protein 0.972 63 306 GO:0003995
GO:0050660
AF-A0A528IP61-F1-model_v4 Acyl-CoA dehydrogenase 0.9715 63 359 GO:0003995
GO:0050660

Feature Viewer

pLDDT pTM Quality
94.8 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map