F476343

General Info

Members Datasets Scaffolds Average Seq Length
704 460 566 153

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10052421|Ga0075364_100524212
Length 169
Sequence MSGGVARGVVEPGPQAAADGGQRDGRQGGQQVVMFRIGSESFALEAGMVREIIDPIPATRVAGARPHIDRIVNVRGNVVPLADIRERFGMPAASASPDTRFLVLEVPVAGDPVVVALVADKVFAVTEVDPAQCEAVPPVGTTWRPEYIRSIVKAGDEFIIVPELEQILD

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
10 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
11 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
12 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
13 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
14 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
15 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
16 2643221733 Bosea sp. Root381 Isolate Unclassified
17 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
22 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
23 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
24 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
25 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
26 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
27 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
28 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
29 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
30 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
31 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
32 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
33 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
34 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
35 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
36 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
37 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
38 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
39 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
40 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
41 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
42 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
43 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
44 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
45 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
46 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
47 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
48 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
49 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
50 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
51 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
52 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
53 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
54 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
55 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
56 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
57 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
58 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
59 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
60 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
61 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
62 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
63 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
64 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
65 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
66 2902330777 Methylobacterium sp. 2A Isolate Unclassified
67 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
68 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
69 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
70 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
71 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
72 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
73 2922368715
74 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
75 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
76 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
77 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
78 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
79 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
80 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
81 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
82 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
83 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
84 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
85 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
86 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
87 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
88 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
89 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
90 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
91 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
92 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
93 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
94 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
95 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
96 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
97 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
98 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
99 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
100 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
101 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
102 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
103 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
104 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
105 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
106 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
107 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
108 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
109 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
110 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
111 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
112 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
113 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
114 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
115 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
116 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
117 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
118 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
119 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
120 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
121 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
122 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
123 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
124 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
125 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
126 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
127 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
128 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
129 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
130 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
131 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
132 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
133 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
134 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
135 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
136 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
137 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
138 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
139 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
140 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
141 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
142 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
143 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
144 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
145 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
146 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
147 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
148 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
149 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
150 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
153 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
154 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
155 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
156 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
157 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
158 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
159 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
160 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
161 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
162 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
163 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
164 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
165 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
166 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
167 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
168 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
169 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
170 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
171 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
172 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
173 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
174 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
175 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
176 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
177 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
180 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
181 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
182 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
183 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
184 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
185 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
186 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
187 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
188 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
189 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
190 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
192 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
195 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
200 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
238 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
239 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
240 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
241 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
245 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
246 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
247 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
248 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
249 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
250 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
251 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
252 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
253 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
254 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
257 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
258 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
259 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
266 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
267 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
269 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
270 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
271 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
272 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
273 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
274 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
275 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
276 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
277 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
278 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
279 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
280 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
281 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
282 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
283 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
284 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
285 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
286 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
287 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
288 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
289 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
290 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
291 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
292 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
293 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
294 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
295 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
296 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
297 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
298 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
299 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
300 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
301 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
302 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
303 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
306 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
307 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
308 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
309 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
310 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
311 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
314 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
315 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
316 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
319 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
320 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
321 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
322 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
323 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
324 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
325 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
338 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
339 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
351 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
352 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
353 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
354 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
355 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
356 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
365 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
366 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
380 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
381 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
389 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
390 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
391 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
392 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
393 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
394 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
395 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
396 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
397 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
398 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
399 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
400 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
401 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
402 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
403 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
404 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
405 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
406 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
407 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
408 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
409 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
410 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
411 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
412 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
413 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
414 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
415 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
416 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
417 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
418 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
419 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
422 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
423 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
424 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
425 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
426 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
427 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
428 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
429 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
430 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
431 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
432 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
433 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
434 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
435 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
436 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
437 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
438 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
439 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
440 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
441 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
442 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
443 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
444 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
445 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
446 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
447 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
448 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
449 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
450 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
451 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
452 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
453 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
454 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
455 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
456 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
457 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
458 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
459 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
460 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.37
Metatranscriptomes 0.14
Isolates 19.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.03
Nodule 14.06
Rhizoplane 3.55
Rhizosphere 47.73
Stem 0
Stem Tuber 0
Unclassified 14.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000633 3300003215 Bacteria 21490
2 JGI25153J46596_10000651 3300003215 Bacteria 21219
3 JGI25153J46596_10006525 3300003215 Bacteria 5888
4 JGI25153J46596_10011915 3300003215 Bacteria 3805
5 rootH2_10071434 3300003320 Bacteria 2124
6 rootH2_10142191 3300003320 Bacteria 1102
7 rootH1_10210164 3300003323 Bacteria 1791
8 JGI25160J50197_1003702 3300003354 Bacteria 6749
9 JGI25160J50197_1020379 3300003354 Bacteria 2001
10 JGI25160J50197_1034445 3300003354 Bacteria 1257
11 JGI25160J50197_1052554 3300003354 Bacteria 855
12 Ga0055542_1012336 3300003762 Bacteria 1481
13 Ga0055526_1000173 3300003771 Bacteria 57134
14 Ga0055526_1039695 3300003771 Bacteria 1196
15 Ga0055524_1007998 3300003775 Bacteria 4435
16 Ga0055524_1038238 3300003775 Bacteria 1259
17 Ga0055531_10012438 3300003794 Bacteria 4005
18 Ga0055543_1018854 3300004625 Bacteria 1283
19 Ga0065165_1000054 3300005262 Bacteria 187351
20 Ga0065165_1001857 3300005262 Bacteria 20523
21 Ga0065165_1002497 3300005262 Bacteria 15404
22 Ga0065165_1012017 3300005262 Bacteria 3558
23 Ga0065165_1028496 3300005262 Bacteria 1802
24 Ga0065165_1146310 3300005262 Bacteria 554
25 Ga0070658_10286870 3300005327 Bacteria 1402
26 Ga0070658_11232645 3300005327 Bacteria 650
27 Ga0070683_100016869 3300005329 Bacteria 6443
28 Ga0070683_100057527 3300005329 Bacteria 3612
29 Ga0070683_100380517 3300005329 Bacteria 1345
30 Ga0068869_100629538 3300005334 Bacteria 909
31 Ga0070660_100356866 3300005339 Bacteria 1204
32 Ga0070661_100496948 3300005344 Bacteria 976
33 Ga0070668_100067353 3300005347 Bacteria 2781
34 Ga0070668_101912293 3300005347 Bacteria 546
35 Ga0070671_100664452 3300005355 Bacteria 903
36 Ga0070671_100671638 3300005355 Bacteria 898
37 Ga0070709_10001267 3300005434 Bacteria 13836
38 Ga0070714_100074581 3300005435 Bacteria 2941
39 Ga0070714_100100248 3300005435 Bacteria 2551
40 Ga0070713_100003456 3300005436 Bacteria 10433
41 Ga0070713_100012930 3300005436 Bacteria 6143
42 Ga0070710_10001610 3300005437 Bacteria 10663
43 Ga0070711_100002880 3300005439 Bacteria 9907
44 Ga0070663_100028242 3300005455 Bacteria 3817
45 Ga0070663_100205671 3300005455 Bacteria 1539
46 Ga0070663_100303255 3300005455 Bacteria 1279
47 Ga0070663_100864258 3300005455 Bacteria 779
48 Ga0070663_101258972 3300005455 Bacteria 652
49 Ga0070662_100116916 3300005457 Bacteria 2039
50 Ga0070662_100957630 3300005457 Bacteria 732
51 Ga0070681_10490107 3300005458 Bacteria 1142
52 Ga0070681_10764613 3300005458 Bacteria 883
53 Ga0068867_100590894 3300005459 Bacteria 967
54 Ga0070679_100644478 3300005530 Bacteria 1002
55 Ga0070679_101252965 3300005530 Bacteria 687
56 Ga0070684_100119361 3300005535 Bacteria 2371
57 Ga0070684_100467275 3300005535 Bacteria 1167
58 Ga0068853_100094938 3300005539 Bacteria 2629
59 Ga0068855_100406802 3300005563 Bacteria 1490
60 Ga0068854_100182894 3300005578 Bacteria 1638
61 Ga0068854_101294770 3300005578 Bacteria 656
62 Ga0068856_100136993 3300005614 Bacteria 2454
63 Ga0068856_100946365 3300005614 Bacteria 880
64 Ga0068852_100004911 3300005616 Bacteria 9495
65 Ga0068852_100563397 3300005616 Bacteria 1141
66 Ga0068861_100482891 3300005719 Bacteria 1117
67 Ga0068860_101160816 3300005843 Bacteria 792
68 Ga0081540_1024700 3300005983 Bacteria 3480
69 Ga0081540_1042065 3300005983 Bacteria 2361
70 Ga0070717_10304191 3300006028 Bacteria 1418
71 Ga0075365_10112608 3300006038 Bacteria 1871
72 Ga0075365_10391558 3300006038 Bacteria 980
73 Ga0075368_10012228 3300006042 Bacteria 3135
74 Ga0075363_100053622 3300006048 Bacteria 2155
75 Ga0075364_10052421 3300006051 Bacteria 2666
76 Ga0075364_10231929 3300006051 Bacteria 1253
77 Ga0075364_10284209 3300006051 Bacteria 1125
78 Ga0070715_10300045 3300006163 Bacteria 859
79 Ga0070716_100001907 3300006173 Bacteria 9470
80 Ga0075362_10130019 3300006177 Bacteria 1197
81 Ga0075367_10019153 3300006178 Bacteria 3791
82 Ga0075369_10041495 3300006186 Bacteria 1970
83 Ga0075366_10008786 3300006195 Bacteria 5626
84 Ga0075370_10035459 3300006353 Bacteria 2799
85 Ga0075370_10077807 3300006353 Bacteria 1903
86 Ga0075370_10115486 3300006353 Bacteria 1560
87 Ga0099825_1035136 3300006941 Bacteria 1812
88 Ga0099824_1024667 3300006942 Bacteria 3458
89 Ga0099823_1035448 3300006944 Bacteria 3892
90 Ga0105240_10008853 3300009093 Bacteria 14333
91 Ga0105240_10020641 3300009093 Bacteria 8781
92 Ga0105240_10529580 3300009093 Bacteria 1306
93 Ga0105245_10018245 3300009098 Bacteria 6135
94 Ga0105247_10240037 3300009101 Bacteria 1234
95 Ga0105247_11130622 3300009101 Bacteria 619
96 Ga0105243_10163201 3300009148 Bacteria 1923
97 Ga0105241_10026075 3300009174 Bacteria 4347
98 Ga0105248_10174632 3300009177 Bacteria 2422
99 Ga0105248_11778212 3300009177 Bacteria 699
100 Ga0105237_10000457 3300009545 Bacteria 57876
101 Ga0105237_10233149 3300009545 Bacteria 1842
102 Ga0105237_10299996 3300009545 Bacteria 1610
103 Ga0105237_10351814 3300009545 Bacteria 1478
104 Ga0105238_10112481 3300009551 Bacteria 2702
105 Ga0105238_10246878 3300009551 Bacteria 1763
106 Ga0105249_11111616 3300009553 Bacteria 860
107 Ga0105239_10039622 3300010375 Bacteria 5161
108 Ga0105239_10967885 3300010375 Bacteria 978
109 Ga0105246_10663090 3300011119 Bacteria 910
110 Ga0157313_1033209 3300012503 Bacteria 597
111 Ga0157370_10255697 3300013104 Bacteria 1620
112 Ga0157370_11778291 3300013104 Bacteria 553
113 Ga0157369_10007758 3300013105 Bacteria 12344
114 Ga0157369_10009352 3300013105 Bacteria 11208
115 Ga0157369_11298813 3300013105 Bacteria 742
116 Ga0157369_11712365 3300013105 Bacteria 639
117 Ga0157372_10091432 3300013307 Bacteria 3461
118 Ga0182008_10302064 3300014497 Bacteria 838
119 Ga0157376_10772014 3300014969 Bacteria 972
120 Ga0163161_10857756 3300017792 Bacteria 767
121 Ga0213872_10132161 3300021361 Bacteria 1099
122 Ga0213874_10185445 3300021377 Bacteria 742
123 Ga0213876_10101179 3300021384 Bacteria 1528
124 Ga0213871_10000466 3300021441 Bacteria 5488
125 Ga0209563_108109 3300025230 Bacteria 1676
126 Ga0207425_1011633 3300025245 Bacteria 2091
127 Ga0209677_102436 3300025253 Bacteria 7003
128 Ga0209148_1000421 3300025254 Bacteria 47524
129 Ga0209148_1027802 3300025254 Bacteria 867
130 Ga0209233_1002484 3300025261 Bacteria 6755
131 Ga0209233_1054776 3300025261 Bacteria 794
132 Ga0209455_1002493 3300025272 Bacteria 7068
133 Ga0209455_1006416 3300025272 Bacteria 3475
134 Ga0209455_1026778 3300025272 Bacteria 1030
135 Ga0209673_1017159 3300025273 Bacteria 2676
136 Ga0209025_1068474 3300025294 Bacteria 1275
137 Ga0209564_1000044 3300025295 Bacteria 381017
138 Ga0209564_1004705 3300025295 Bacteria 8182
139 Ga0209564_1014807 3300025295 Bacteria 3216
140 Ga0209758_1000117 3300025297 Bacteria 198325
141 Ga0209758_1000506 3300025297 Bacteria 63135
142 Ga0209758_1001068 3300025297 Bacteria 35664
143 Ga0209758_1001793 3300025297 Bacteria 23709
144 Ga0209758_1003491 3300025297 Bacteria 14222
145 Ga0209758_1007058 3300025297 Bacteria 7792
146 Ga0209758_1025207 3300025297 Bacteria 2617
147 Ga0209050_1103381 3300025298 Bacteria 560
148 Ga0209256_1000740 3300025299 Bacteria 42806
149 Ga0209256_1007255 3300025299 Bacteria 5533
150 Ga0209256_1010920 3300025299 Bacteria 3721
151 Ga0209256_1052785 3300025299 Bacteria 975
152 Ga0207426_1000467 3300025302 Bacteria 62488
153 Ga0207426_1000508 3300025302 Bacteria 57035
154 Ga0207426_1004734 3300025302 Bacteria 6503
155 Ga0207426_1004808 3300025302 Bacteria 6410
156 Ga0207426_1007596 3300025302 Bacteria 4513
157 Ga0207426_1028439 3300025302 Bacteria 1853
158 Ga0209257_1000158 3300025304 Bacteria 180079
159 Ga0209257_1010490 3300025304 Bacteria 4675
160 Ga0209257_1024526 3300025304 Bacteria 2086
161 Ga0207692_10001796 3300025898 Bacteria 8136
162 Ga0207647_10049933 3300025904 Bacteria 2593
163 Ga0207647_10062038 3300025904 Bacteria 2278
164 Ga0207699_10000749 3300025906 Bacteria 15507
165 Ga0207699_10105039 3300025906 Bacteria 1800
166 Ga0207705_10207755 3300025909 Bacteria 1485
167 Ga0207707_10387110 3300025912 Bacteria 1201
168 Ga0207707_10483173 3300025912 Bacteria 1058
169 Ga0207695_10000136 3300025913 Bacteria 217596
170 Ga0207695_10019551 3300025913 Bacteria 7793
171 Ga0207695_10588513 3300025913 Bacteria 994
172 Ga0207671_10000202 3300025914 Bacteria 90868
173 Ga0207671_10193140 3300025914 Bacteria 1588
174 Ga0207671_10460633 3300025914 Bacteria 1013
175 Ga0207671_10739685 3300025914 Bacteria 781
176 Ga0207663_10001805 3300025916 Bacteria 10114
177 Ga0207657_10327332 3300025919 Bacteria 1211
178 Ga0207649_10182781 3300025920 Bacteria 1469
179 Ga0207652_10096788 3300025921 Bacteria 2600
180 Ga0207652_10773751 3300025921 Bacteria 853
181 Ga0207694_10108605 3300025924 Bacteria 2205
182 Ga0207694_10423569 3300025924 Bacteria 1109
183 Ga0207694_10509732 3300025924 Bacteria 1008
184 Ga0207700_10004852 3300025928 Bacteria 7985
185 Ga0207700_10230989 3300025928 Bacteria 1573
186 Ga0207664_10012842 3300025929 Bacteria 6000
187 Ga0207664_10078418 3300025929 Bacteria 2679
188 Ga0207644_10345515 3300025931 Bacteria 1207
189 Ga0207690_10995139 3300025932 Bacteria 697
190 Ga0207706_10239609 3300025933 Bacteria 1586
191 Ga0207704_11071255 3300025938 Bacteria 684
192 Ga0207665_10002001 3300025939 Bacteria 13745
193 Ga0207691_10406959 3300025940 Bacteria 1160
194 Ga0207661_10009082 3300025944 Bacteria 7123
195 Ga0207661_10013432 3300025944 Bacteria 5981
196 Ga0207661_10308980 3300025944 Bacteria 1419
197 Ga0207679_10280192 3300025945 Bacteria 1429
198 Ga0207667_10202524 3300025949 Bacteria 2036
199 Ga0207667_10680242 3300025949 Bacteria 1032
200 Ga0207667_11341324 3300025949 Bacteria 690
201 Ga0207712_11504045 3300025961 Bacteria 603
202 Ga0207640_10132607 3300025981 Bacteria 1803
203 Ga0207640_10598478 3300025981 Bacteria 933
204 Ga0207703_10614328 3300026035 Bacteria 1029
205 Ga0207678_10142454 3300026067 Bacteria 2046
206 Ga0207678_10288099 3300026067 Bacteria 1410
207 Ga0207702_10048849 3300026078 Bacteria 3569
208 Ga0207702_11329397 3300026078 Bacteria 713
209 Ga0207648_10091226 3300026089 Bacteria 2664
210 Ga0207674_10287691 3300026116 Bacteria 1592
211 Ga0207675_100398490 3300026118 Bacteria 1356
212 Ga0207683_10201072 3300026121 Bacteria 1811
213 Ga0207698_10130247 3300026142 Bacteria 2148
214 Ga0207698_12321642 3300026142 Bacteria 548
215 Ga0209389_1000056 3300027296 Bacteria 107673
216 Ga0209389_1000206 3300027296 Bacteria 42342
217 Ga0209589_1000034 3300027357 Bacteria 138086
218 Ga0209489_100009 3300027361 Bacteria 263873
219 Ga0209489_103071 3300027361 Bacteria 33029
220 Ga0209700_100471 3300027363 Bacteria 75447
221 Ga0268266_10413922 3300028379 Bacteria 1276
222 Ga0268266_11116163 3300028379 Bacteria 763
223 Ga0268265_11200562 3300028380 Bacteria 756
224 Ga0268265_11312664 3300028380 Bacteria 724
225 Ga0268264_10377387 3300028381 Bacteria 1357
226 Ga0265337_1011803 3300028556 Bacteria 2997
227 Ga0265319_1020457 3300028563 Bacteria 2452
228 Ga0265334_10019060 3300028573 Bacteria 2825
229 Ga0265323_10003447 3300028653 Bacteria 6980
230 Ga0265322_10010245 3300028654 Bacteria 2718
231 Ga0265336_10001603 3300028666 Bacteria 10097
232 Ga0307515_10356520 3300028794 Bacteria 1106
233 Ga0307515_10483755 3300028794 Bacteria 850
234 Ga0265338_10000119 3300028800 Bacteria 146599
235 Ga0265324_10003043 3300029957 Bacteria 8195
236 Ga0265330_10013665 3300031235 Bacteria 3780
237 Ga0265330_10023908 3300031235 Bacteria 2772
238 Ga0265330_10032553 3300031235 Bacteria 2336
239 Ga0265330_10350038 3300031235 Bacteria 624
240 Ga0265328_10027924 3300031239 Bacteria 2113
241 Ga0265325_10014457 3300031241 Bacteria 4460
242 Ga0265325_10029818 3300031241 Bacteria 2929
243 Ga0265325_10096818 3300031241 Bacteria 1449
244 Ga0265340_10005088 3300031247 Bacteria 7315
245 Ga0265340_10009354 3300031247 Bacteria 5263
246 Ga0265339_10021233 3300031249 Bacteria 3781
247 Ga0265339_10104739 3300031249 Bacteria 1469
248 Ga0265316_10236920 3300031344 Bacteria 1343
249 Ga0265316_10839484 3300031344 Bacteria 643
250 Ga0307508_10000002 3300031616 Bacteria 407635
251 Ga0265314_10199694 3300031711 Bacteria 1183
252 Ga0265314_10521539 3300031711 Bacteria 622
253 Ga0265342_10312167 3300031712 Bacteria 826
254 Ga0265342_10443944 3300031712 Bacteria 666
255 Ga0307406_10072735 3300031901 Bacteria 2258
256 Ga0307409_100297943 3300031995 Bacteria 1499
257 Ga0307510_10020579 3300033180 Bacteria 7705
258 Ga0307510_10079893 3300033180 Bacteria 3184
259 Ga0316215_1003229 3300033544 Bacteria 1549
260 Ga0372808_022651 3300036459 Bacteria 903
261 Ga0373925_0232094 3300037068 Bacteria 1476
262 Ga0395900_0003815 3300037418 Bacteria 16114
263 Ga0395900_0033307 3300037418 Bacteria 5303
264 Ga0395898_0007171 3300037466 Bacteria 11834
265 Ga0395898_0022885 3300037466 Bacteria 6320
266 Ga0395905_0396858 3300037471 Bacteria 1274
267 Ga0395905_0431446 3300037471 Bacteria 1215
268 Ga0436364_0702767 3300037853 Bacteria 2047
269 Ga0436364_0992294 3300037853 Bacteria 2476
270 Ga0436364_1006809 3300037853 Bacteria 2884
271 Ga0395901_0017745 3300038443 Bacteria 7264
272 Ga0395901_0086930 3300038443 Bacteria 3269
273 Ga0436365_0328373 3300039437 Bacteria 1181
274 Ga0436365_0877926 3300039437 Bacteria 1738
275 Ga0436360_0048231 3300039438 Bacteria 2048
276 Ga0436360_0210980 3300039438 Bacteria 939
277 Ga0436360_0517490 3300039438 Bacteria 674
278 Ga0436361_0603673 3300039447 Bacteria 2172
279 Ga0436361_0856172 3300039447 Bacteria 2683
280 Ga0436363_0369931 3300039450 Bacteria 1303
281 Ga0451795_0607088 3300041456 Bacteria 698
282 Ga0451853_0276558 3300041512 Bacteria 838
283 Ga0439448_0305875 3300042005 Bacteria 565
284 Ga0439455_0061018 3300042012 Bacteria 1000
285 Ga0466969_0058336 3300044656 Bacteria 1879
286 Ga0466972_0064349 3300044658 Bacteria 1755
287 Ga0466972_0530824 3300044658 Bacteria 555
288 Ga0466965_0059710 3300044683 Bacteria 1904
289 Ga0466966_0000101 3300044684 Bacteria 51920
290 Ga0466966_0033392 3300044684 Bacteria 3332
291 Ga0466966_0097463 3300044684 Bacteria 1821
292 Ga0466961_0000031 3300044693 Bacteria 85869
293 Ga0466961_0180738 3300044693 Bacteria 1310
294 Ga0466961_0180775 3300044693 Bacteria 1310
295 Ga0466963_0093654 3300044694 Bacteria 2048
296 Ga0466963_0960950 3300044694 Bacteria 602
297 Ga0466964_0021841 3300044706 Bacteria 2478
298 Ga0466964_0155474 3300044706 Bacteria 1064
299 Ga0466964_0299213 3300044706 Bacteria 810
300 Ga0466964_0354482 3300044706 Bacteria 755
301 Ga0453684_0016148 3300044712 Bacteria 11709
302 Ga0453684_0033684 3300044712 Bacteria 7133
303 Ga0466971_0042632 3300044719 Bacteria 2039
304 Ga0466968_0006726 3300044735 Bacteria 4345
305 Ga0466968_0101386 3300044735 Bacteria 1285
306 Ga0466970_0228919 3300044765 Bacteria 1039
307 Ga0466970_0297872 3300044765 Bacteria 909
308 Ga0466970_0452917 3300044765 Bacteria 736
309 Ga0466957_0065030 3300044842 Bacteria 2245
310 Ga0466957_0066288 3300044842 Bacteria 2225
311 Ga0466957_0272704 3300044842 Bacteria 1130
312 Ga0466957_0740681 3300044842 Bacteria 695
313 Ga0466960_0124246 3300044901 Bacteria 1355
314 Ga0466959_0002151 3300045049 Bacteria 12504
315 Ga0466959_0002988 3300045049 Bacteria 10928
316 Ga0466959_0031213 3300045049 Bacteria 3943
317 Ga0466959_0057353 3300045049 Bacteria 2839
318 Ga0466959_0070341 3300045049 Bacteria 2535
319 Ga0466959_0471538 3300045049 Bacteria 850
320 Ga0466958_0070371 3300045836 Bacteria 2141
321 Ga0466958_0102453 3300045836 Bacteria 1781
322 Ga0466958_0150623 3300045836 Bacteria 1467
323 Ga0466967_0203868 3300045976 Bacteria 1874
324 Ga0466967_0498506 3300045976 Bacteria 1195
325 Ga0466967_1056145 3300045976 Bacteria 809
326 Ga0466967_1372642 3300045976 Bacteria 704
327 Ga0495617_108299 3300046452 Bacteria 900
328 Ga0495603_0202146 3300046455 Bacteria 1148
329 Ga0495603_0740761 3300046455 Bacteria 561
330 Ga0495629_0002586 3300046459 Bacteria 13860
331 Ga0495638_0105506 3300046460 Bacteria 1679
332 Ga0495638_0126783 3300046460 Bacteria 1504
333 Ga0495651_0167439 3300046462 Bacteria 1568
334 Ga0495653_0060377 3300046463 Bacteria 2873
335 Ga0495605_0041048 3300046474 Bacteria 2306
336 Ga0495585_0068543 3300046492 Bacteria 1938
337 Ga0495594_0403405 3300046499 Bacteria 778
338 Ga0495596_0131895 3300046500 Bacteria 970
339 Ga0495606_0302646 3300046507 Bacteria 866
340 Ga0495608_0054448 3300046511 Bacteria 2645
341 Ga0495616_0099956 3300046513 Bacteria 1362
342 Ga0495616_0235884 3300046513 Bacteria 791
343 Ga0495620_0092671 3300046515 Bacteria 1211
344 Ga0495637_0188466 3300046520 Bacteria 762
345 Ga0495643_0014632 3300046522 Bacteria 4662
346 Ga0495648_0033175 3300046524 Bacteria 3376
347 Ga0495648_0140871 3300046524 Bacteria 1269
348 Ga0495648_0366692 3300046524 Bacteria 653
349 Ga0495642_0329594 3300046528 Bacteria 670
350 Ga0495652_0008977 3300046529 Bacteria 9096
351 Ga0495640_0172724 3300046533 Bacteria 1380
352 Ga0495609_0084811 3300046538 Bacteria 1382
353 Ga0495597_0160761 3300046542 Bacteria 917
354 Ga0495622_0026692 3300046557 Bacteria 2695
355 Ga0495622_0126479 3300046557 Bacteria 1165
356 Ga0495668_0079416 3300046616 Bacteria 1801
357 Ga0495668_0222339 3300046616 Bacteria 1034
358 Ga0495668_0257753 3300046616 Bacteria 955
359 Ga0495634_0068687 3300046642 Bacteria 2340
360 Ga0495611_0158863 3300046648 Bacteria 1056
361 Ga0495625_0126219 3300046660 Bacteria 1737
362 Ga0495625_0179116 3300046660 Bacteria 1411
363 Ga0495635_0031284 3300046663 Bacteria 3695
364 Ga0495661_0080164 3300046665 Bacteria 1885
365 Ga0495661_0335685 3300046665 Bacteria 748
366 Ga0495588_0053235 3300046674 Bacteria 2087
367 Ga0495588_0653229 3300046674 Bacteria 550
368 Ga0495657_0013301 3300046675 Bacteria 6076
369 Ga0495646_0336735 3300046680 Bacteria 792
370 Ga0495613_0049718 3300046689 Bacteria 3093
371 Ga0495624_0048352 3300046690 Bacteria 2700
372 Ga0495624_0418800 3300046690 Bacteria 803
373 Ga0495670_0140923 3300046691 Bacteria 1261
374 Ga0495671_0271837 3300046692 Bacteria 817
375 Ga0495649_0119544 3300046694 Bacteria 1394
376 Ga0495649_0228765 3300046694 Bacteria 960
377 Ga0495581_0061631 3300047315 Bacteria 2168
378 Ga0495672_0097648 3300047320 Bacteria 1599
379 Ga0495672_0184032 3300047320 Bacteria 1056
380 Ga0495672_0265729 3300047320 Bacteria 826
381 Ga0495676_0052331 3300047321 Bacteria 3260
382 Ga0495683_0155259 3300047323 Bacteria 1062
383 Ga0495687_040179 3300047443 Bacteria 2063
384 Ga0495673_0030706 3300047469 Bacteria 2522
385 Ga0495686_0090430 3300047472 Bacteria 1859
386 Ga0495686_0325725 3300047472 Bacteria 841
387 Ga0495686_0436442 3300047472 Bacteria 698
388 Ga0495686_0730236 3300047472 Bacteria 503
389 Ga0495593_0079090 3300047673 Bacteria 1702
390 Ga0496100_0073149 3300048903 Bacteria 2293
391 Ga0496100_0625779 3300048903 Bacteria 837
392 Ga0496100_0766154 3300048903 Bacteria 755
393 Ga0496101_0141782 3300048904 Bacteria 1832
394 Ga0496102_0799958 3300048905 Bacteria 865
395 Ga0496102_1957750 3300048905 Bacteria 502
396 Ga0496103_0076550 3300048906 Bacteria 2100
397 Ga0496104_0001655 3300048907 Bacteria 19236
398 Ga0496104_0158818 3300048907 Bacteria 2169
399 Ga0496104_0165528 3300048907 Bacteria 2120
400 Ga0496105_0015424 3300048908 Bacteria 6089
401 Ga0496105_0116057 3300048908 Bacteria 2208
402 Ga0496106_0181806 3300048909 Bacteria 1669
403 Ga0496107_0072888 3300048910 Bacteria 2497
404 Ga0496110_1007957 3300048913 Bacteria 740
405 Ga0496111_1254508 3300048914 Bacteria 524
406 Ga0496112_0081338 3300048915 Bacteria 3203
407 Ga0496113_0050256 3300048916 Bacteria 3108
408 Ga0496113_0162699 3300048916 Bacteria 1765
409 Ga0496114_0150263 3300048917 Bacteria 2020
410 Ga0496114_0342206 3300048917 Bacteria 1323
411 Ga0496114_0975142 3300048917 Bacteria 730
412 Ga0496115_0027286 3300048918 Bacteria 4465
413 Ga0496115_0327399 3300048918 Bacteria 1252
414 Ga0496116_0009012 3300048919 Bacteria 8574
415 Ga0496116_0348644 3300048919 Bacteria 679
416 Ga0496116_0392700 3300048919 Bacteria 617
417 Ga0496117_0055992 3300048920 Bacteria 2751
418 Ga0496117_0060417 3300048920 Bacteria 2612
419 Ga0496117_0226669 3300048920 Bacteria 1036
420 Ga0496118_0039981 3300048921 Bacteria 3735
421 Ga0496118_0061946 3300048921 Bacteria 2766
422 Ga0496118_0168438 3300048921 Bacteria 1342
423 Ga0496119_0007977 3300048922 Bacteria 9412
424 Ga0496119_0244252 3300048922 Bacteria 908
425 Ga0496119_0393461 3300048922 Bacteria 662
426 Ga0496120_0003849 3300048923 Bacteria 13184
427 Ga0496120_0224294 3300048923 Bacteria 896
428 Ga0496121_0013561 3300048924 Bacteria 8740
429 Ga0496121_0021475 3300048924 Bacteria 6319
430 Ga0496121_0049950 3300048924 Bacteria 3539
431 Ga0496121_0069873 3300048924 Bacteria 2831
432 Ga0496121_0072664 3300048924 Bacteria 2761
433 Ga0496121_0181866 3300048924 Bacteria 1516
434 Ga0496121_0189658 3300048924 Bacteria 1475
435 Ga0496121_0362266 3300048924 Bacteria 962
436 Ga0496122_0021585 3300048925 Bacteria 5757
437 Ga0496122_0320772 3300048925 Bacteria 824
438 Ga0496123_0033056 3300048926 Bacteria 3730
439 Ga0496125_0058251 3300048928 Bacteria 3122
440 Ga0496126_0002980 3300048929 Bacteria 21982
441 Ga0496126_0016467 3300048929 Bacteria 7391
442 Ga0496126_0030510 3300048929 Bacteria 5106
443 Ga0496126_0060949 3300048929 Bacteria 3391
444 Ga0496126_0073851 3300048929 Bacteria 3031
445 Ga0496126_0109054 3300048929 Bacteria 2413
446 Ga0496126_0132174 3300048929 Bacteria 2156
447 Ga0496126_0145281 3300048929 Bacteria 2038
448 Ga0496126_0209061 3300048929 Bacteria 1644
449 Ga0496126_0258787 3300048929 Bacteria 1448
450 Ga0496126_0331349 3300048929 Bacteria 1249
451 Ga0496126_0459310 3300048929 Bacteria 1024
452 Ga0501031_0006422 3300049568 Bacteria 7667
453 Ga0501032_0000040 3300049569 Bacteria 115662
454 Ga0501032_0586385 3300049569 Bacteria 710
455 Ga0501033_0000128 3300049570 Bacteria 73419
456 Ga0501033_0134409 3300049570 Bacteria 1790
457 Ga0501034_0000254 3300049571 Bacteria 97896
458 Ga0501034_0374992 3300049571 Bacteria 1348
459 Ga0501036_0000375 3300049572 Bacteria 31541
460 Ga0501036_0240258 3300049572 Bacteria 1519
461 Ga0501037_0000041 3300049573 Bacteria 118457
462 Ga0501038_0000057 3300049574 Bacteria 92766
463 Ga0501039_0000084 3300049575 Bacteria 71542
464 Ga0501043_0000184 3300049579 Bacteria 56470
465 Ga0501043_0311063 3300049579 Bacteria 1202
466 Ga0501046_0000072 3300049580 Bacteria 106407
467 Ga0501046_0136987 3300049580 Bacteria 1854
468 Ga0501047_0000044 3300049581 Bacteria 174789
469 Ga0501047_0009182 3300049581 Bacteria 9337
470 Ga0501047_0098684 3300049581 Bacteria 2799
471 Ga0501048_0000295 3300049582 Bacteria 33908
472 Ga0501067_0004567 3300049583 Bacteria 7655
473 Ga0501068_0000113 3300049584 Bacteria 34900
474 Ga0501070_0000310 3300049586 Bacteria 44627
475 Ga0501070_0098505 3300049586 Bacteria 2418
476 Ga0501070_0170589 3300049586 Bacteria 1792
477 Ga0501070_0748054 3300049586 Bacteria 770
478 Ga0501071_0082831 3300049587 Bacteria 2350
479 Ga0501073_0000043 3300049589 Bacteria 80142
480 Ga0501073_0513768 3300049589 Bacteria 828
481 Ga0501074_0000035 3300049590 Bacteria 64770
482 Ga0501079_0000839 3300049741 Bacteria 20917
483 Ga0501080_0000600 3300049742 Bacteria 28483
484 Ga0501080_0238726 3300049742 Bacteria 1659
485 Ga0501035_0000128 3300049822 Bacteria 92297
486 Ga0501035_0168456 3300049822 Bacteria 1893
487 Ga0501035_0190594 3300049822 Bacteria 1763
488 Ga0501044_0000108 3300049823 Bacteria 100968
489 Ga0501044_0168054 3300049823 Bacteria 2166
490 Ga0501044_0192957 3300049823 Bacteria 1998
491 nmdc:mga03n38_72610_c1 3300050490 Bacteria 1596
492 nmdc:mga00v17_120618_c1 3300050491 Bacteria 1669
493 nmdc:mga00v17_84895_c1 3300050491 Bacteria 1982
494 nmdc:mga0yw44_17645_c1 3300050492 Bacteria 3890
495 nmdc:mga0yw44_181061_c1 3300050492 Bacteria 1387
496 nmdc:mga0yw44_3454_c1 3300050492 Bacteria 7016
497 nmdc:mga0k408_11705_c1 3300050493 Bacteria 4783
498 nmdc:mga06z11_36518_c1 3300050494 Bacteria 2426
499 nmdc:mga06z11_84947_c1 3300050494 Bacteria 1707
500 nmdc:mga04h51_243680_c1 3300050495 Bacteria 718
501 nmdc:mga07m45_70978_c1 3300050496 Bacteria 1982
502 nmdc:mga0sz30_19353_c1 3300050516 Bacteria 2736
503 nmdc:mga0sz30_336207_c1 3300050516 Bacteria 675
504 Ga0500610_0089377 3300053079 Bacteria 1601
505 Ga0500578_0088963 3300053086 Bacteria 1961
506 Ga0500578_0174854 3300053086 Bacteria 1326
507 Ga0500643_000095 3300053087 Bacteria 92535
508 Ga0500647_0069478 3300053091 Bacteria 1694
509 Ga0500583_0128213 3300053092 Bacteria 1258
510 Ga0500651_0001437 3300053093 Bacteria 11972
511 Ga0500651_0071348 3300053093 Bacteria 2161
512 Ga0500566_0000123 3300053094 Bacteria 40138
513 Ga0500566_0129947 3300053094 Bacteria 1349
514 Ga0500556_0033572 3300053104 Bacteria 1760
515 Ga0500557_000036 3300053105 Bacteria 71169
516 Ga0500572_000007 3300053111 Bacteria 75901
517 Ga0500572_036657 3300053111 Bacteria 1401
518 Ga0500572_057420 3300053111 Bacteria 1175
519 Ga0500594_0005223 3300053118 Bacteria 2879
520 Ga0500595_000839 3300053119 Bacteria 17559
521 Ga0500595_001859 3300053119 Bacteria 10918
522 Ga0500595_006961 3300053119 Bacteria 4743
523 Ga0500595_041418 3300053119 Bacteria 1480
524 Ga0500607_181938 3300053121 Bacteria 930
525 Ga0500608_012042 3300053122 Bacteria 3777
526 Ga0500621_201449 3300053126 Bacteria 705
527 Ga0500642_0000103 3300053130 Bacteria 40846
528 Ga0500642_0001828 3300053130 Bacteria 6142
529 Ga0500642_0101505 3300053130 Bacteria 1338
530 Ga0500655_010875 3300053133 Bacteria 1646
531 Ga0500658_0092770 3300053134 Bacteria 1308
532 Ga0500559_0000725 3300053136 Bacteria 21721
533 Ga0500564_054697 3300053138 Bacteria 1820
534 Ga0500568_0053111 3300053139 Bacteria 1589
535 Ga0500568_0072323 3300053139 Bacteria 1319
536 Ga0500568_0080945 3300053139 Bacteria 1233
537 Ga0500588_0109433 3300053146 Bacteria 962
538 Ga0500588_0323879 3300053146 Bacteria 584
539 Ga0500590_040973 3300053148 Bacteria 2383
540 Ga0500590_080638 3300053148 Bacteria 1599
541 Ga0500604_0029379 3300053151 Bacteria 1602
542 Ga0500604_0079330 3300053151 Bacteria 1058
543 Ga0500616_0034464 3300053153 Bacteria 2757
544 Ga0500619_098566 3300053154 Bacteria 990
545 Ga0500622_0012724 3300053156 Bacteria 4551
546 Ga0500622_0012726 3300053156 Bacteria 4550
547 Ga0500624_007628 3300053157 Bacteria 1494
548 Ga0500627_0032148 3300053158 Bacteria 2210
549 Ga0500639_019994 3300053163 Bacteria 3531
550 Ga0500636_0000807 3300053177 Bacteria 16914
551 Ga0500636_0283208 3300053177 Bacteria 826
552 Ga0500637_0515247 3300053178 Bacteria 589
553 Ga0500625_000325 3300053729 Bacteria 11897
554 Ga0500645_061521 3300053730 Bacteria 1085
555 Ga0500609_028446 3300053731 Bacteria 766
556 Ga0500552_003879 3300053733 Bacteria 1546
557 Ga0500596_036145 3300053735 Bacteria 778
558 Ga0500599_002149 3300053736 Bacteria 2343
559 Ga0500601_000390 3300053737 Bacteria 7562
560 Ga0501084_0195524 3300054114 Bacteria 1706
561 Ga0500661_010231 3300055283 Bacteria 1709
562 Ga0501082_0005614 3300060353 Bacteria 10889
563 Ga0466962_0085716 3300061719 Bacteria 1508
564 Ga0466962_0211067 3300061719 Bacteria 950
565 Ga0466962_0226512 3300061719 Bacteria 916
566 Ga0466962_0570726 3300061719 Bacteria 575

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016539877 8016546196 119
2 iso_pu_bacteria 8016522445 8016527847 136
3 iso_pu_bacteria 8016548790 8016555931 136
4 3300044684 Ga0466966_0033392 Ga0466966_0033392_2871_3293 137
5 3300021361 Ga0213872_10132161 Ga0213872_101321612 139
6 3300021441 Ga0213871_10000466 Ga0213871_100004664 139
7 3300028794 Ga0307515_10483755 Ga0307515_104837552 139
8 3300039447 Ga0436361_0603673 Ga0436361_0603673_738_1208 139
9 3300053156 Ga0500622_0012724 Ga0500622_0012724_469_951 139
10 3300005329 Ga0070683_100380517 Ga0070683_1003805172 140
11 3300037853 Ga0436364_0702767 Ga0436364_0702767_1601_2023 140
12 3300044842 Ga0466957_0740681 Ga0466957_0740681_257_679 140
13 3300046455 Ga0495603_0740761 Ga0495603_0740761_21_443 140
14 3300047472 Ga0495686_0730236 Ga0495686_0730236_70_492 140
15 3300048905 Ga0496102_1957750 Ga0496102_1957750_67_489 140
16 3300048919 Ga0496116_0348644 Ga0496116_0348644_234_656 140
17 3300048929 Ga0496126_0060949 Ga0496126_0060949_2957_3379 140
18 3300049569 Ga0501032_0586385 Ga0501032_0586385_18_440 140
19 3300050516 nmdc:mga0sz30_336207_c1 nmdc:mga0sz30_336207_c1_22_444 140
20 3300053134 Ga0500658_0092770 Ga0500658_0092770_29_451 140
21 3300053139 Ga0500568_0080945 Ga0500568_0080945_783_1205 140
22 3300053177 Ga0500636_0283208 Ga0500636_0283208_383_805 140
23 iso_pu_bacteria 3003665799 3003667354 143
24 iso_pu_bacteria 2513237102 2513701343 144
25 iso_pu_bacteria 2824617872 2824620558 144
26 iso_pu_bacteria 2824626560 2824630154 144
27 iso_pu_bacteria 2824635225 2824636354 144
28 iso_pu_bacteria 2824644064 2824644889 144
29 iso_pu_bacteria 2824714736 2824715246 144
30 iso_pu_bacteria 2824723954 2824724677 144
31 iso_pu_bacteria 2902330777 2902334651 144
32 iso_pu_bacteria 8054002106 8054008571 144
33 3300044712 Ga0453684_0016148 Ga0453684_0016148_7730_8173 145
34 iso_pu_bacteria 2841911363 2841914104 145
35 iso_pu_bacteria 2841917233 2841919595 145
36 iso_pu_bacteria 2891088606 2891089765 145
37 3300005327 Ga0070658_11232645 Ga0070658_112326451 146
38 3300045049 Ga0466959_0471538 Ga0466959_0471538_194_667 146
39 3300031711 Ga0265314_10521539 Ga0265314_105215391 147
40 3300031712 Ga0265342_10443944 Ga0265342_104439442 147
41 iso_pu_bacteria 2528768022 2528853153 147
42 iso_pu_bacteria 2929615660 2929621377 147
43 iso_pu_bacteria 2929624759 2929631809 147
44 iso_pu_bacteria 2933577622 2933583596 147
45 iso_pu_bacteria 8055742211 8055744418 147
46 3300005614 Ga0068856_100946365 Ga0068856_1009463652 148
47 3300031235 Ga0265330_10023908 Ga0265330_100239082 148
48 3300031235 Ga0265330_10032553 Ga0265330_100325532 148
49 3300031235 Ga0265330_10350038 Ga0265330_103500381 148
50 3300031239 Ga0265328_10027924 Ga0265328_100279242 148
51 3300031241 Ga0265325_10014457 Ga0265325_100144574 148
52 3300031241 Ga0265325_10029818 Ga0265325_100298182 148
53 3300031241 Ga0265325_10096818 Ga0265325_100968181 148
54 3300031247 Ga0265340_10009354 Ga0265340_100093542 148
55 3300031249 Ga0265339_10021233 Ga0265339_100212332 148
56 3300031344 Ga0265316_10839484 Ga0265316_108394842 148
57 3300031711 Ga0265314_10199694 Ga0265314_101996942 148
58 3300031712 Ga0265342_10312167 Ga0265342_103121672 148
59 3300044693 Ga0466961_0180738 Ga0466961_0180738_105_554 148
60 3300045049 Ga0466959_0002151 Ga0466959_0002151_6748_7197 148
61 3300045836 Ga0466958_0102453 Ga0466958_0102453_897_1346 148
62 3300053178 Ga0500637_0515247 Ga0500637_0515247_96_557 148
63 3300061719 Ga0466962_0085716 Ga0466962_0085716_192_641 148
64 iso_pu_bacteria 2824704595 2824709412 148
65 iso_pu_bacteria 2824753945 2824762061 148
66 iso_pu_bacteria 2824763712 2824768076 148
67 iso_pu_bacteria 2844315083 2844320721 148
68 iso_pu_bacteria 2902405164 2902408637 148
69 iso_pu_bacteria 2903727486 2903728166 148
70 iso_pu_bacteria 2904711408 2904712879 148
71 iso_pu_bacteria 2906602504 2906605918 148
72 iso_pu_bacteria 3005718088 3005723806 148
73 3300025906 Ga0207699_10105039 Ga0207699_101050392 149
74 3300044712 Ga0453684_0033684 Ga0453684_0033684_2322_2777 149
75 3300044735 Ga0466968_0101386 Ga0466968_0101386_252_716 149
76 3300049586 Ga0501070_0748054 Ga0501070_0748054_115_579 149
77 iso_pu_bacteria 2508501128 2509153011 149
78 iso_pu_bacteria 2511231028 2511399992 149
79 iso_pu_bacteria 2513237092 2513623785 149
80 iso_pu_bacteria 2513237094 2513641520 149
81 iso_pu_bacteria 2513237095 2513650529 149
82 iso_pu_bacteria 2513237098 2513677471 149
83 iso_pu_bacteria 2513237139 2513877445 149
84 iso_pu_bacteria 2513237161 2514013123 149
85 iso_pu_bacteria 2517093001 2517106411 149
86 iso_pu_bacteria 2524023205 2524439432 149
87 iso_pu_bacteria 2524023210 2524466213 149
88 iso_pu_bacteria 2617270735 2617348171 149
89 iso_pu_bacteria 2643221733 2644732485 149
90 iso_pu_bacteria 2744054633 2745078143 149
91 iso_pu_bacteria 2791355196 2793064298 149
92 iso_pu_bacteria 2802429603 2805918904 149
93 iso_pu_bacteria 2816332527 2818242125 149
94 iso_pu_bacteria 2824600985 2824603156 149
95 iso_pu_bacteria 2824609381 2824613648 149
96 iso_pu_bacteria 2824653114 2824655961 149
97 iso_pu_bacteria 2824661429 2824664370 149
98 iso_pu_bacteria 2824671348 2824674635 149
99 iso_pu_bacteria 2824679649 2824683390 149
100 iso_pu_bacteria 2824687955 2824689389 149
101 iso_pu_bacteria 2824696289 2824699104 149
102 iso_pu_bacteria 2824773399 2824778677 149
103 iso_pu_bacteria 2838122688 2838126857 149
104 iso_pu_bacteria 2841941048 2841945670 149
105 iso_pu_bacteria 2841949485 2841954864 149
106 iso_pu_bacteria 2841957949 2841963289 149
107 iso_pu_bacteria 2841966195 2841972334 149
108 iso_pu_bacteria 2841974524 2841980416 149
109 iso_pu_bacteria 2841983080 2841988581 149
110 iso_pu_bacteria 2842038055 2842044883 149
111 iso_pu_bacteria 2842045827 2842052931 149
112 iso_pu_bacteria 2847939898 2847940165 149
113 iso_pu_bacteria 2849076700 2849077636 149
114 iso_pu_bacteria 2857509624 2857510864 149
115 iso_pu_bacteria 2874612657 2874618884 149
116 iso_pu_bacteria 2874628541 2874630729 149
117 iso_pu_bacteria 2876761206 2876761902 149
118 iso_pu_bacteria 2879099564 2879104795 149
119 iso_pu_bacteria 2881364244 2881364367 149
120 iso_pu_bacteria 2881665667 2881666727 149
121 iso_pu_bacteria 2885383462 2885384811 149
122 iso_pu_bacteria 2885409591 2885414658 149
123 iso_pu_bacteria 2888378607 2888386123 149
124 iso_pu_bacteria 2888388044 2888392154 149
125 iso_pu_bacteria 2888419890 2888426265 149
126 iso_pu_bacteria 2903768456 2903771324 149
127 iso_pu_bacteria 2906643746 2906645311 149
128 iso_pu_bacteria 2922368715 2922370431 149
129 iso_pu_bacteria 2922393267 2922399758 149
130 iso_pu_bacteria 2932809354 2932815329 149
131 iso_pu_bacteria 2932818245 2932824391 149
132 iso_pu_bacteria 2932828146 2932832209 149
133 iso_pu_bacteria 2935616580 2935622147 149
134 iso_pu_bacteria 2935638405 2935646405 149
135 iso_pu_bacteria 2935665750 2935669242 149
136 iso_pu_bacteria 2935675223 2935683199 149
137 iso_pu_bacteria 2935684952 2935692141 149
138 iso_pu_bacteria 2935694250 2935702454 149
139 iso_pu_bacteria 2935703347 2935708682 149
140 iso_pu_bacteria 2935713505 2935720620 149
141 iso_pu_bacteria 2935722832 2935729901 149
142 iso_pu_bacteria 2935732158 2935739116 149
143 iso_pu_bacteria 2935741537 2935748343 149
144 iso_pu_bacteria 2935750917 2935758545 149
145 iso_pu_bacteria 2935760218 2935766027 149
146 iso_pu_bacteria 2935777560 2935784496 149
147 iso_pu_bacteria 2935785616 2935787683 149
148 iso_pu_bacteria 2935793552 2935793760 149
149 iso_pu_bacteria 2935801545 2935805958 149
150 iso_pu_bacteria 2935810662 2935815482 149
151 iso_pu_bacteria 2935827899 2935835558 149
152 iso_pu_bacteria 2935837841 2935843335 149
153 iso_pu_bacteria 2935855204 2935860394 149
154 iso_pu_bacteria 2935864058 2935867792 149
155 iso_pu_bacteria 2935873716 2935878399 149
156 iso_pu_bacteria 2935959822 2935964841 149
157 iso_pu_bacteria 2935992306 2935998718 149
158 iso_pu_bacteria 2936002035 2936007023 149
159 iso_pu_bacteria 2936037263 2936040720 149
160 iso_pu_bacteria 2940556831 2940564449 149
161 iso_pu_bacteria 2941531003 2941536547 149
162 iso_pu_bacteria 2941538514 2941544881 149
163 iso_pu_bacteria 3005483717 3005485302 149
164 iso_pu_bacteria 3005594810 3005601036 149
165 iso_pu_bacteria 3005710791 3005716503 149
166 iso_pu_bacteria 8006926726 8006932991 149
167 iso_pu_bacteria 8016511872 8016519946 149
168 iso_pu_bacteria 8016530956 8016532960 149
169 iso_pu_bacteria 8016557553 8016564284 149
170 iso_pu_bacteria 8016566248 8016571273 149
171 iso_pu_bacteria 8016575299 8016583751 149
172 iso_pu_bacteria 8016595262 8016601972 149
173 iso_pu_bacteria 8016603502 8016608255 149
174 iso_pu_bacteria 8016613128 8016616613 149
175 iso_pu_bacteria 8017057580 8017065601 149
176 iso_pu_bacteria 8019530166 8019532758 149
177 iso_pu_bacteria 8019576017 8019585007 149
178 iso_pu_bacteria 8019586578 8019592967 149
179 iso_pu_bacteria 8019597564 8019598494 149
180 iso_pu_bacteria 8019608314 8019609881 149
181 iso_pu_bacteria 8056681323 8056687058 149
182 iso_pu_bacteria 8056967851 8056969270 149
183 3300044706 Ga0466964_0354482 Ga0466964_0354482_269_733 150
184 3300053146 Ga0500588_0323879 Ga0500588_0323879_100_552 150
185 iso_pu_bacteria 2595698237 2596374851 150
186 iso_pu_bacteria 2928125067 2928125562 150
187 3300005347 Ga0070668_101912293 Ga0070668_1019122931 151
188 3300005455 Ga0070663_100864258 Ga0070663_1008642582 151
189 3300005455 Ga0070663_101258972 Ga0070663_1012589721 151
190 3300005459 Ga0068867_100590894 Ga0068867_1005908942 151
191 3300014497 Ga0182008_10302064 Ga0182008_103020641 151
192 3300026118 Ga0207675_100398490 Ga0207675_1003984902 151
193 3300026142 Ga0207698_12321642 Ga0207698_123216421 151
194 3300044842 Ga0466957_0065030 Ga0466957_0065030_188_658 151
195 3300046507 Ga0495606_0302646 Ga0495606_0302646_380_835 151
196 3300046542 Ga0495597_0160761 Ga0495597_0160761_452_907 151
197 3300048917 Ga0496114_0975142 Ga0496114_0975142_24_491 151
198 3300048918 Ga0496115_0327399 Ga0496115_0327399_658_1125 151
199 3300003771 Ga0055526_1000173 Ga0055526_10001732 152
200 3300005435 Ga0070714_100100248 Ga0070714_1001002482 152
201 3300005436 Ga0070713_100003456 Ga0070713_10000345610 152
202 3300005530 Ga0070679_101252965 Ga0070679_1012529651 152
203 3300005535 Ga0070684_100467275 Ga0070684_1004672751 152
204 3300005614 Ga0068856_100136993 Ga0068856_1001369932 152
205 3300005616 Ga0068852_100563397 Ga0068852_1005633972 152
206 3300006028 Ga0070717_10304191 Ga0070717_103041912 152
207 3300009093 Ga0105240_10020641 Ga0105240_100206418 152
208 3300009545 Ga0105237_10351814 Ga0105237_103518142 152
209 3300013105 Ga0157369_10009352 Ga0157369_100093528 152
210 3300013307 Ga0157372_10091432 Ga0157372_100914322 152
211 3300025295 Ga0209564_1000044 Ga0209564_1000044157 152
212 3300025913 Ga0207695_10019551 Ga0207695_100195512 152
213 3300025914 Ga0207671_10193140 Ga0207671_101931402 152
214 3300025921 Ga0207652_10773751 Ga0207652_107737511 152
215 3300025928 Ga0207700_10004852 Ga0207700_100048526 152
216 3300025929 Ga0207664_10078418 Ga0207664_100784182 152
217 3300025944 Ga0207661_10308980 Ga0207661_103089802 152
218 3300025949 Ga0207667_10202524 Ga0207667_102025242 152
219 3300026078 Ga0207702_10048849 Ga0207702_100488492 152
220 3300026116 Ga0207674_10287691 Ga0207674_102876911 152
221 3300028379 Ga0268266_10413922 Ga0268266_104139222 152
222 3300033180 Ga0307510_10020579 Ga0307510_100205792 152
223 3300037418 Ga0395900_0033307 Ga0395900_0033307_918_1394 152
224 3300044694 Ga0466963_0960950 Ga0466963_0960950_99_566 152
225 3300045976 Ga0466967_1372642 Ga0466967_1372642_154_630 152
226 3300046460 Ga0495638_0105506 Ga0495638_0105506_817_1275 152
227 3300046524 Ga0495648_0033175 Ga0495648_0033175_342_800 152
228 3300046616 Ga0495668_0222339 Ga0495668_0222339_499_957 152
229 3300046660 Ga0495625_0126219 Ga0495625_0126219_187_645 152
230 3300046692 Ga0495671_0271837 Ga0495671_0271837_152_610 152
231 3300048917 Ga0496114_0342206 Ga0496114_0342206_94_576 152
232 3300048920 Ga0496117_0055992 Ga0496117_0055992_76_549 152
233 3300048921 Ga0496118_0168438 Ga0496118_0168438_168_641 152
234 3300048923 Ga0496120_0224294 Ga0496120_0224294_42_515 152
235 3300048924 Ga0496121_0189658 Ga0496121_0189658_985_1443 152
236 3300048929 Ga0496126_0016467 Ga0496126_0016467_2664_3128 152
237 3300048929 Ga0496126_0132174 Ga0496126_0132174_409_879 152
238 3300048929 Ga0496126_0209061 Ga0496126_0209061_499_957 152
239 3300049580 Ga0501046_0136987 Ga0501046_0136987_134_601 152
240 3300049581 Ga0501047_0009182 Ga0501047_0009182_7740_8207 152
241 3300049586 Ga0501070_0098505 Ga0501070_0098505_778_1245 152
242 3300049589 Ga0501073_0513768 Ga0501073_0513768_128_595 152
243 3300049742 Ga0501080_0238726 Ga0501080_0238726_1177_1644 152
244 3300049822 Ga0501035_0190594 Ga0501035_0190594_913_1380 152
245 3300049823 Ga0501044_0192957 Ga0501044_0192957_1267_1734 152
246 3300053104 Ga0500556_0033572 Ga0500556_0033572_1069_1527 152
247 3300053111 Ga0500572_057420 Ga0500572_057420_532_996 152
248 3300053126 Ga0500621_201449 Ga0500621_201449_232_690 152
249 3300053153 Ga0500616_0034464 Ga0500616_0034464_1558_2016 152
250 3300053156 Ga0500622_0012726 Ga0500622_0012726_592_1050 152
251 3300053736 Ga0500599_002149 Ga0500599_002149_1477_1935 152
252 3300003215 JGI25153J46596_10000633 JGI25153J46596_1000063319 153
253 3300003215 JGI25153J46596_10000651 JGI25153J46596_100006514 153
254 3300003215 JGI25153J46596_10006525 JGI25153J46596_100065254 153
255 3300003215 JGI25153J46596_10011915 JGI25153J46596_100119153 153
256 3300003320 rootH2_10071434 rootH2_100714342 153
257 3300003320 rootH2_10142191 rootH2_101421912 153
258 3300003323 rootH1_10210164 rootH1_102101642 153
259 3300003354 JGI25160J50197_1003702 JGI25160J50197_10037025 153
260 3300003354 JGI25160J50197_1020379 JGI25160J50197_10203792 153
261 3300003354 JGI25160J50197_1034445 JGI25160J50197_10344452 153
262 3300003354 JGI25160J50197_1052554 JGI25160J50197_10525542 153
263 3300003762 Ga0055542_1012336 Ga0055542_10123361 153
264 3300003771 Ga0055526_1039695 Ga0055526_10396951 153
265 3300003775 Ga0055524_1007998 Ga0055524_10079985 153
266 3300003775 Ga0055524_1038238 Ga0055524_10382382 153
267 3300003794 Ga0055531_10012438 Ga0055531_100124383 153
268 3300004625 Ga0055543_1018854 Ga0055543_10188542 153
269 3300005262 Ga0065165_1000054 Ga0065165_1000054114 153
270 3300005262 Ga0065165_1001857 Ga0065165_100185718 153
271 3300005262 Ga0065165_1002497 Ga0065165_10024974 153
272 3300005262 Ga0065165_1012017 Ga0065165_10120172 153
273 3300005262 Ga0065165_1028496 Ga0065165_10284962 153
274 3300005262 Ga0065165_1146310 Ga0065165_11463101 153
275 3300005327 Ga0070658_10286870 Ga0070658_102868702 153
276 3300005329 Ga0070683_100016869 Ga0070683_1000168692 153
277 3300005329 Ga0070683_100057527 Ga0070683_1000575274 153
278 3300005334 Ga0068869_100629538 Ga0068869_1006295382 153
279 3300005339 Ga0070660_100356866 Ga0070660_1003568662 153
280 3300005344 Ga0070661_100496948 Ga0070661_1004969481 153
281 3300005347 Ga0070668_100067353 Ga0070668_1000673531 153
282 3300005355 Ga0070671_100664452 Ga0070671_1006644522 153
283 3300005355 Ga0070671_100671638 Ga0070671_1006716382 153
284 3300005434 Ga0070709_10001267 Ga0070709_100012672 153
285 3300005435 Ga0070714_100074581 Ga0070714_1000745812 153
286 3300005436 Ga0070713_100012930 Ga0070713_1000129302 153
287 3300005437 Ga0070710_10001610 Ga0070710_100016106 153
288 3300005439 Ga0070711_100002880 Ga0070711_1000028804 153
289 3300005455 Ga0070663_100028242 Ga0070663_1000282421 153
290 3300005455 Ga0070663_100205671 Ga0070663_1002056711 153
291 3300005455 Ga0070663_100303255 Ga0070663_1003032552 153
292 3300005457 Ga0070662_100116916 Ga0070662_1001169162 153
293 3300005457 Ga0070662_100957630 Ga0070662_1009576301 153
294 3300005458 Ga0070681_10490107 Ga0070681_104901072 153
295 3300005458 Ga0070681_10764613 Ga0070681_107646132 153
296 3300005530 Ga0070679_100644478 Ga0070679_1006444781 153
297 3300005535 Ga0070684_100119361 Ga0070684_1001193611 153
298 3300005539 Ga0068853_100094938 Ga0068853_1000949382 153
299 3300005563 Ga0068855_100406802 Ga0068855_1004068022 153
300 3300005578 Ga0068854_100182894 Ga0068854_1001828942 153
301 3300005578 Ga0068854_101294770 Ga0068854_1012947702 153
302 3300005616 Ga0068852_100004911 Ga0068852_1000049118 153
303 3300005719 Ga0068861_100482891 Ga0068861_1004828912 153
304 3300005843 Ga0068860_101160816 Ga0068860_1011608162 153
305 3300005983 Ga0081540_1024700 Ga0081540_10247003 153
306 3300005983 Ga0081540_1042065 Ga0081540_10420652 153
307 3300006038 Ga0075365_10112608 Ga0075365_101126082 153
308 3300006038 Ga0075365_10391558 Ga0075365_103915581 153
309 3300006042 Ga0075368_10012228 Ga0075368_100122282 153
310 3300006048 Ga0075363_100053622 Ga0075363_1000536222 153
311 3300006051 Ga0075364_10052421 Ga0075364_100524212 153
312 3300006051 Ga0075364_10231929 Ga0075364_102319291 153
313 3300006051 Ga0075364_10284209 Ga0075364_102842092 153
314 3300006163 Ga0070715_10300045 Ga0070715_103000452 153
315 3300006173 Ga0070716_100001907 Ga0070716_1000019077 153
316 3300006177 Ga0075362_10130019 Ga0075362_101300192 153
317 3300006178 Ga0075367_10019153 Ga0075367_100191532 153
318 3300006186 Ga0075369_10041495 Ga0075369_100414952 153
319 3300006195 Ga0075366_10008786 Ga0075366_100087862 153
320 3300006353 Ga0075370_10035459 Ga0075370_100354592 153
321 3300006353 Ga0075370_10077807 Ga0075370_100778072 153
322 3300006353 Ga0075370_10115486 Ga0075370_101154862 153
323 3300006941 Ga0099825_1035136 Ga0099825_10351362 153
324 3300006942 Ga0099824_1024667 Ga0099824_10246673 153
325 3300006944 Ga0099823_1035448 Ga0099823_10354482 153
326 3300009093 Ga0105240_10008853 Ga0105240_100088535 153
327 3300009093 Ga0105240_10529580 Ga0105240_105295802 153
328 3300009098 Ga0105245_10018245 Ga0105245_100182455 153
329 3300009101 Ga0105247_10240037 Ga0105247_102400372 153
330 3300009101 Ga0105247_11130622 Ga0105247_111306221 153
331 3300009148 Ga0105243_10163201 Ga0105243_101632012 153
332 3300009174 Ga0105241_10026075 Ga0105241_100260753 153
333 3300009177 Ga0105248_10174632 Ga0105248_101746322 153
334 3300009177 Ga0105248_11778212 Ga0105248_117782122 153
335 3300009545 Ga0105237_10000457 Ga0105237_100004572 153
336 3300009545 Ga0105237_10233149 Ga0105237_102331492 153
337 3300009545 Ga0105237_10299996 Ga0105237_102999962 153
338 3300009551 Ga0105238_10112481 Ga0105238_101124812 153
339 3300009551 Ga0105238_10246878 Ga0105238_102468782 153
340 3300009553 Ga0105249_11111616 Ga0105249_111116162 153
341 3300010375 Ga0105239_10039622 Ga0105239_100396222 153
342 3300010375 Ga0105239_10967885 Ga0105239_109678852 153
343 3300011119 Ga0105246_10663090 Ga0105246_106630902 153
344 3300012503 Ga0157313_1033209 Ga0157313_10332091 153
345 3300013104 Ga0157370_10255697 Ga0157370_102556972 153
346 3300013104 Ga0157370_11778291 Ga0157370_117782911 153
347 3300013105 Ga0157369_10007758 Ga0157369_100077582 153
348 3300013105 Ga0157369_11298813 Ga0157369_112988132 153
349 3300013105 Ga0157369_11712365 Ga0157369_117123651 153
350 3300014969 Ga0157376_10772014 Ga0157376_107720142 153
351 3300017792 Ga0163161_10857756 Ga0163161_108577561 153
352 3300021377 Ga0213874_10185445 Ga0213874_101854452 153
353 3300021384 Ga0213876_10101179 Ga0213876_101011792 153
354 3300025230 Ga0209563_108109 Ga0209563_1081092 153
355 3300025245 Ga0207425_1011633 Ga0207425_10116332 153
356 3300025253 Ga0209677_102436 Ga0209677_1024362 153
357 3300025254 Ga0209148_1000421 Ga0209148_100042127 153
358 3300025254 Ga0209148_1027802 Ga0209148_10278022 153
359 3300025261 Ga0209233_1002484 Ga0209233_10024846 153
360 3300025261 Ga0209233_1054776 Ga0209233_10547761 153
361 3300025272 Ga0209455_1002493 Ga0209455_10024931 153
362 3300025272 Ga0209455_1006416 Ga0209455_10064163 153
363 3300025272 Ga0209455_1026778 Ga0209455_10267782 153
364 3300025273 Ga0209673_1017159 Ga0209673_10171592 153
365 3300025294 Ga0209025_1068474 Ga0209025_10684742 153
366 3300025295 Ga0209564_1004705 Ga0209564_10047058 153
367 3300025295 Ga0209564_1014807 Ga0209564_10148072 153
368 3300025297 Ga0209758_1000117 Ga0209758_100011747 153
369 3300025297 Ga0209758_1000506 Ga0209758_100050643 153
370 3300025297 Ga0209758_1001068 Ga0209758_100106813 153
371 3300025297 Ga0209758_1001793 Ga0209758_100179313 153
372 3300025297 Ga0209758_1003491 Ga0209758_10034918 153
373 3300025297 Ga0209758_1007058 Ga0209758_10070585 153
374 3300025297 Ga0209758_1025207 Ga0209758_10252072 153
375 3300025298 Ga0209050_1103381 Ga0209050_11033811 153
376 3300025299 Ga0209256_1000740 Ga0209256_100074036 153
377 3300025299 Ga0209256_1007255 Ga0209256_10072554 153
378 3300025299 Ga0209256_1010920 Ga0209256_10109203 153
379 3300025299 Ga0209256_1052785 Ga0209256_10527852 153
380 3300025302 Ga0207426_1000467 Ga0207426_100046753 153
381 3300025302 Ga0207426_1000508 Ga0207426_100050834 153
382 3300025302 Ga0207426_1004734 Ga0207426_10047342 153
383 3300025302 Ga0207426_1004808 Ga0207426_10048085 153
384 3300025302 Ga0207426_1007596 Ga0207426_10075962 153
385 3300025302 Ga0207426_1028439 Ga0207426_10284392 153
386 3300025304 Ga0209257_1000158 Ga0209257_1000158140 153
387 3300025304 Ga0209257_1010490 Ga0209257_10104902 153
388 3300025304 Ga0209257_1024526 Ga0209257_10245262 153
389 3300025898 Ga0207692_10001796 Ga0207692_100017962 153
390 3300025904 Ga0207647_10049933 Ga0207647_100499332 153
391 3300025904 Ga0207647_10062038 Ga0207647_100620382 153
392 3300025906 Ga0207699_10000749 Ga0207699_100007499 153
393 3300025909 Ga0207705_10207755 Ga0207705_102077552 153
394 3300025912 Ga0207707_10387110 Ga0207707_103871101 153
395 3300025912 Ga0207707_10483173 Ga0207707_104831732 153
396 3300025913 Ga0207695_10000136 Ga0207695_1000013656 153
397 3300025913 Ga0207695_10588513 Ga0207695_105885132 153
398 3300025914 Ga0207671_10000202 Ga0207671_1000020229 153
399 3300025914 Ga0207671_10460633 Ga0207671_104606332 153
400 3300025914 Ga0207671_10739685 Ga0207671_107396851 153
401 3300025916 Ga0207663_10001805 Ga0207663_100018054 153
402 3300025919 Ga0207657_10327332 Ga0207657_103273321 153
403 3300025920 Ga0207649_10182781 Ga0207649_101827812 153
404 3300025921 Ga0207652_10096788 Ga0207652_100967882 153
405 3300025924 Ga0207694_10108605 Ga0207694_101086052 153
406 3300025924 Ga0207694_10423569 Ga0207694_104235692 153
407 3300025924 Ga0207694_10509732 Ga0207694_105097321 153
408 3300025928 Ga0207700_10230989 Ga0207700_102309892 153
409 3300025929 Ga0207664_10012842 Ga0207664_100128422 153
410 3300025931 Ga0207644_10345515 Ga0207644_103455152 153
411 3300025932 Ga0207690_10995139 Ga0207690_109951392 153
412 3300025933 Ga0207706_10239609 Ga0207706_102396092 153
413 3300025938 Ga0207704_11071255 Ga0207704_110712552 153
414 3300025939 Ga0207665_10002001 Ga0207665_100020017 153
415 3300025940 Ga0207691_10406959 Ga0207691_104069592 153
416 3300025944 Ga0207661_10009082 Ga0207661_1000908210 153
417 3300025944 Ga0207661_10013432 Ga0207661_100134326 153
418 3300025945 Ga0207679_10280192 Ga0207679_102801922 153
419 3300025949 Ga0207667_10680242 Ga0207667_106802422 153
420 3300025949 Ga0207667_11341324 Ga0207667_113413241 153
421 3300025961 Ga0207712_11504045 Ga0207712_115040451 153
422 3300025981 Ga0207640_10132607 Ga0207640_101326072 153
423 3300025981 Ga0207640_10598478 Ga0207640_105984782 153
424 3300026035 Ga0207703_10614328 Ga0207703_106143282 153
425 3300026067 Ga0207678_10142454 Ga0207678_101424542 153
426 3300026067 Ga0207678_10288099 Ga0207678_102880992 153
427 3300026078 Ga0207702_11329397 Ga0207702_113293972 153
428 3300026089 Ga0207648_10091226 Ga0207648_100912262 153
429 3300026121 Ga0207683_10201072 Ga0207683_102010722 153
430 3300026142 Ga0207698_10130247 Ga0207698_101302472 153
431 3300027296 Ga0209389_1000056 Ga0209389_100005637 153
432 3300027296 Ga0209389_1000206 Ga0209389_100020631 153
433 3300027357 Ga0209589_1000034 Ga0209589_1000034111 153
434 3300027361 Ga0209489_100009 Ga0209489_10000973 153
435 3300027361 Ga0209489_103071 Ga0209489_10307120 153
436 3300027363 Ga0209700_100471 Ga0209700_10047115 153
437 3300028379 Ga0268266_11116163 Ga0268266_111161631 153
438 3300028380 Ga0268265_11200562 Ga0268265_112005622 153
439 3300028380 Ga0268265_11312664 Ga0268265_113126642 153
440 3300028381 Ga0268264_10377387 Ga0268264_103773872 153
441 3300028556 Ga0265337_1011803 Ga0265337_10118033 153
442 3300028563 Ga0265319_1020457 Ga0265319_10204572 153
443 3300028573 Ga0265334_10019060 Ga0265334_100190602 153
444 3300028653 Ga0265323_10003447 Ga0265323_100034472 153
445 3300028654 Ga0265322_10010245 Ga0265322_100102452 153
446 3300028666 Ga0265336_10001603 Ga0265336_100016038 153
447 3300028794 Ga0307515_10356520 Ga0307515_103565202 153
448 3300028800 Ga0265338_10000119 Ga0265338_10000119134 153
449 3300029957 Ga0265324_10003043 Ga0265324_100030435 153
450 3300031235 Ga0265330_10013665 Ga0265330_100136654 153
451 3300031247 Ga0265340_10005088 Ga0265340_100050882 153
452 3300031249 Ga0265339_10104739 Ga0265339_101047392 153
453 3300031344 Ga0265316_10236920 Ga0265316_102369202 153
454 3300031616 Ga0307508_10000002 Ga0307508_10000002354 153
455 3300031901 Ga0307406_10072735 Ga0307406_100727352 153
456 3300031995 Ga0307409_100297943 Ga0307409_1002979432 153
457 3300033180 Ga0307510_10079893 Ga0307510_100798932 153
458 3300033544 Ga0316215_1003229 Ga0316215_10032292 153
459 3300036459 Ga0372808_022651 Ga0372808_022651_303_779 153
460 3300037068 Ga0373925_0232094 Ga0373925_0232094_690_1151 153
461 3300037418 Ga0395900_0003815 Ga0395900_0003815_2681_3148 153
462 3300037466 Ga0395898_0007171 Ga0395898_0007171_5651_6124 153
463 3300037466 Ga0395898_0022885 Ga0395898_0022885_2325_2792 153
464 3300037471 Ga0395905_0396858 Ga0395905_0396858_294_761 153
465 3300037471 Ga0395905_0431446 Ga0395905_0431446_434_895 153
466 3300037853 Ga0436364_0992294 Ga0436364_0992294_534_1004 153
467 3300037853 Ga0436364_1006809 Ga0436364_1006809_474_947 153
468 3300038443 Ga0395901_0017745 Ga0395901_0017745_1172_1645 153
469 3300038443 Ga0395901_0086930 Ga0395901_0086930_1520_1987 153
470 3300039437 Ga0436365_0328373 Ga0436365_0328373_180_641 153
471 3300039437 Ga0436365_0877926 Ga0436365_0877926_271_741 153
472 3300039438 Ga0436360_0048231 Ga0436360_0048231_311_802 153
473 3300039438 Ga0436360_0210980 Ga0436360_0210980_158_646 153
474 3300039438 Ga0436360_0517490 Ga0436360_0517490_33_503 153
475 3300039447 Ga0436361_0856172 Ga0436361_0856172_1075_1545 153
476 3300039450 Ga0436363_0369931 Ga0436363_0369931_159_653 153
477 3300041456 Ga0451795_0607088 Ga0451795_0607088_125_586 153
478 3300041512 Ga0451853_0276558 Ga0451853_0276558_270_731 153
479 3300042005 Ga0439448_0305875 Ga0439448_0305875_38_499 153
480 3300042012 Ga0439455_0061018 Ga0439455_0061018_56_517 153
481 3300044656 Ga0466969_0058336 Ga0466969_0058336_242_703 153
482 3300044658 Ga0466972_0064349 Ga0466972_0064349_759_1220 153
483 3300044658 Ga0466972_0530824 Ga0466972_0530824_54_515 153
484 3300044683 Ga0466965_0059710 Ga0466965_0059710_730_1191 153
485 3300044684 Ga0466966_0000101 Ga0466966_0000101_2999_3460 153
486 3300044684 Ga0466966_0097463 Ga0466966_0097463_305_775 153
487 3300044693 Ga0466961_0000031 Ga0466961_0000031_40470_40931 153
488 3300044693 Ga0466961_0180775 Ga0466961_0180775_314_784 153
489 3300044694 Ga0466963_0093654 Ga0466963_0093654_1017_1478 153
490 3300044706 Ga0466964_0021841 Ga0466964_0021841_1668_2138 153
491 3300044706 Ga0466964_0155474 Ga0466964_0155474_148_609 153
492 3300044706 Ga0466964_0299213 Ga0466964_0299213_280_747 153
493 3300044719 Ga0466971_0042632 Ga0466971_0042632_1304_1765 153
494 3300044735 Ga0466968_0006726 Ga0466968_0006726_358_819 153
495 3300044765 Ga0466970_0228919 Ga0466970_0228919_524_994 153
496 3300044765 Ga0466970_0297872 Ga0466970_0297872_239_709 153
497 3300044765 Ga0466970_0452917 Ga0466970_0452917_97_567 153
498 3300044842 Ga0466957_0066288 Ga0466957_0066288_68_538 153
499 3300044842 Ga0466957_0272704 Ga0466957_0272704_589_1050 153
500 3300044901 Ga0466960_0124246 Ga0466960_0124246_230_691 153
501 3300045049 Ga0466959_0002988 Ga0466959_0002988_7296_7757 153
502 3300045049 Ga0466959_0031213 Ga0466959_0031213_2164_2634 153
503 3300045049 Ga0466959_0057353 Ga0466959_0057353_647_1117 153
504 3300045049 Ga0466959_0070341 Ga0466959_0070341_36_506 153
505 3300045836 Ga0466958_0070371 Ga0466958_0070371_1432_1893 153
506 3300045836 Ga0466958_0150623 Ga0466958_0150623_867_1337 153
507 3300045976 Ga0466967_0203868 Ga0466967_0203868_1135_1605 153
508 3300045976 Ga0466967_0498506 Ga0466967_0498506_344_808 153
509 3300045976 Ga0466967_1056145 Ga0466967_1056145_272_742 153
510 3300046452 Ga0495617_108299 Ga0495617_108299_180_641 153
511 3300046455 Ga0495603_0202146 Ga0495603_0202146_85_546 153
512 3300046459 Ga0495629_0002586 Ga0495629_0002586_6786_7247 153
513 3300046460 Ga0495638_0126783 Ga0495638_0126783_662_1135 153
514 3300046462 Ga0495651_0167439 Ga0495651_0167439_979_1440 153
515 3300046463 Ga0495653_0060377 Ga0495653_0060377_1206_1667 153
516 3300046474 Ga0495605_0041048 Ga0495605_0041048_490_951 153
517 3300046492 Ga0495585_0068543 Ga0495585_0068543_1044_1505 153
518 3300046499 Ga0495594_0403405 Ga0495594_0403405_149_610 153
519 3300046500 Ga0495596_0131895 Ga0495596_0131895_217_678 153
520 3300046511 Ga0495608_0054448 Ga0495608_0054448_533_994 153
521 3300046513 Ga0495616_0099956 Ga0495616_0099956_406_867 153
522 3300046513 Ga0495616_0235884 Ga0495616_0235884_179_640 153
523 3300046515 Ga0495620_0092671 Ga0495620_0092671_398_859 153
524 3300046520 Ga0495637_0188466 Ga0495637_0188466_254_736 153
525 3300046522 Ga0495643_0014632 Ga0495643_0014632_495_956 153
526 3300046524 Ga0495648_0140871 Ga0495648_0140871_380_841 153
527 3300046524 Ga0495648_0366692 Ga0495648_0366692_124_597 153
528 3300046528 Ga0495642_0329594 Ga0495642_0329594_74_535 153
529 3300046529 Ga0495652_0008977 Ga0495652_0008977_2041_2502 153
530 3300046533 Ga0495640_0172724 Ga0495640_0172724_64_525 153
531 3300046538 Ga0495609_0084811 Ga0495609_0084811_778_1239 153
532 3300046557 Ga0495622_0026692 Ga0495622_0026692_367_828 153
533 3300046557 Ga0495622_0126479 Ga0495622_0126479_98_559 153
534 3300046616 Ga0495668_0079416 Ga0495668_0079416_470_931 153
535 3300046616 Ga0495668_0257753 Ga0495668_0257753_113_580 153
536 3300046642 Ga0495634_0068687 Ga0495634_0068687_466_927 153
537 3300046648 Ga0495611_0158863 Ga0495611_0158863_571_1032 153
538 3300046660 Ga0495625_0179116 Ga0495625_0179116_218_679 153
539 3300046663 Ga0495635_0031284 Ga0495635_0031284_1036_1497 153
540 3300046665 Ga0495661_0080164 Ga0495661_0080164_1270_1731 153
541 3300046665 Ga0495661_0335685 Ga0495661_0335685_185_646 153
542 3300046674 Ga0495588_0053235 Ga0495588_0053235_547_1008 153
543 3300046674 Ga0495588_0653229 Ga0495588_0653229_64_525 153
544 3300046675 Ga0495657_0013301 Ga0495657_0013301_2888_3349 153
545 3300046680 Ga0495646_0336735 Ga0495646_0336735_268_729 153
546 3300046689 Ga0495613_0049718 Ga0495613_0049718_1406_1867 153
547 3300046690 Ga0495624_0048352 Ga0495624_0048352_2117_2578 153
548 3300046690 Ga0495624_0418800 Ga0495624_0418800_223_684 153
549 3300046691 Ga0495670_0140923 Ga0495670_0140923_430_891 153
550 3300046694 Ga0495649_0119544 Ga0495649_0119544_246_707 153
551 3300046694 Ga0495649_0228765 Ga0495649_0228765_336_797 153
552 3300047315 Ga0495581_0061631 Ga0495581_0061631_1091_1552 153
553 3300047320 Ga0495672_0097648 Ga0495672_0097648_99_572 153
554 3300047320 Ga0495672_0184032 Ga0495672_0184032_269_739 153
555 3300047320 Ga0495672_0265729 Ga0495672_0265729_343_816 153
556 3300047321 Ga0495676_0052331 Ga0495676_0052331_1611_2072 153
557 3300047323 Ga0495683_0155259 Ga0495683_0155259_82_543 153
558 3300047443 Ga0495687_040179 Ga0495687_040179_1454_1915 153
559 3300047469 Ga0495673_0030706 Ga0495673_0030706_1343_1804 153
560 3300047472 Ga0495686_0090430 Ga0495686_0090430_1084_1554 153
561 3300047472 Ga0495686_0325725 Ga0495686_0325725_283_744 153
562 3300047472 Ga0495686_0436442 Ga0495686_0436442_109_582 153
563 3300047673 Ga0495593_0079090 Ga0495593_0079090_1157_1618 153
564 3300048903 Ga0496100_0073149 Ga0496100_0073149_1243_1704 153
565 3300048903 Ga0496100_0625779 Ga0496100_0625779_208_669 153
566 3300048903 Ga0496100_0766154 Ga0496100_0766154_240_701 153
567 3300048904 Ga0496101_0141782 Ga0496101_0141782_1064_1525 153
568 3300048905 Ga0496102_0799958 Ga0496102_0799958_91_552 153
569 3300048906 Ga0496103_0076550 Ga0496103_0076550_516_977 153
570 3300048907 Ga0496104_0001655 Ga0496104_0001655_6969_7430 153
571 3300048907 Ga0496104_0158818 Ga0496104_0158818_155_616 153
572 3300048907 Ga0496104_0165528 Ga0496104_0165528_1273_1734 153
573 3300048908 Ga0496105_0015424 Ga0496105_0015424_3142_3603 153
574 3300048908 Ga0496105_0116057 Ga0496105_0116057_755_1216 153
575 3300048909 Ga0496106_0181806 Ga0496106_0181806_619_1080 153
576 3300048910 Ga0496107_0072888 Ga0496107_0072888_1887_2348 153
577 3300048913 Ga0496110_1007957 Ga0496110_1007957_122_583 153
578 3300048914 Ga0496111_1254508 Ga0496111_1254508_16_477 153
579 3300048915 Ga0496112_0081338 Ga0496112_0081338_117_578 153
580 3300048916 Ga0496113_0050256 Ga0496113_0050256_133_594 153
581 3300048916 Ga0496113_0162699 Ga0496113_0162699_128_589 153
582 3300048917 Ga0496114_0150263 Ga0496114_0150263_1417_1878 153
583 3300048918 Ga0496115_0027286 Ga0496115_0027286_2770_3231 153
584 3300048919 Ga0496116_0009012 Ga0496116_0009012_3391_3852 153
585 3300048919 Ga0496116_0392700 Ga0496116_0392700_133_606 153
586 3300048920 Ga0496117_0060417 Ga0496117_0060417_1291_1764 153
587 3300048920 Ga0496117_0226669 Ga0496117_0226669_312_773 153
588 3300048921 Ga0496118_0039981 Ga0496118_0039981_3208_3669 153
589 3300048921 Ga0496118_0061946 Ga0496118_0061946_1879_2340 153
590 3300048922 Ga0496119_0007977 Ga0496119_0007977_7571_8032 153
591 3300048922 Ga0496119_0244252 Ga0496119_0244252_330_803 153
592 3300048922 Ga0496119_0393461 Ga0496119_0393461_100_561 153
593 3300048923 Ga0496120_0003849 Ga0496120_0003849_8166_8627 153
594 3300048924 Ga0496121_0013561 Ga0496121_0013561_7396_7869 153
595 3300048924 Ga0496121_0021475 Ga0496121_0021475_5528_6001 153
596 3300048924 Ga0496121_0049950 Ga0496121_0049950_2455_2916 153
597 3300048924 Ga0496121_0069873 Ga0496121_0069873_218_679 153
598 3300048924 Ga0496121_0072664 Ga0496121_0072664_758_1219 153
599 3300048924 Ga0496121_0181866 Ga0496121_0181866_219_680 153
600 3300048924 Ga0496121_0362266 Ga0496121_0362266_370_840 153
601 3300048925 Ga0496122_0021585 Ga0496122_0021585_2146_2628 153
602 3300048925 Ga0496122_0320772 Ga0496122_0320772_285_770 153
603 3300048926 Ga0496123_0033056 Ga0496123_0033056_2125_2607 153
604 3300048928 Ga0496125_0058251 Ga0496125_0058251_1398_1859 153
605 3300048929 Ga0496126_0002980 Ga0496126_0002980_11710_12180 153
606 3300048929 Ga0496126_0030510 Ga0496126_0030510_515_1006 153
607 3300048929 Ga0496126_0073851 Ga0496126_0073851_794_1255 153
608 3300048929 Ga0496126_0109054 Ga0496126_0109054_596_1057 153
609 3300048929 Ga0496126_0145281 Ga0496126_0145281_566_1027 153
610 3300048929 Ga0496126_0258787 Ga0496126_0258787_859_1320 153
611 3300048929 Ga0496126_0331349 Ga0496126_0331349_523_984 153
612 3300048929 Ga0496126_0459310 Ga0496126_0459310_296_766 153
613 3300049568 Ga0501031_0006422 Ga0501031_0006422_448_921 153
614 3300049569 Ga0501032_0000040 Ga0501032_0000040_67681_68154 153
615 3300049570 Ga0501033_0000128 Ga0501033_0000128_69855_70328 153
616 3300049570 Ga0501033_0134409 Ga0501033_0134409_553_1026 153
617 3300049571 Ga0501034_0000254 Ga0501034_0000254_35421_35894 153
618 3300049571 Ga0501034_0374992 Ga0501034_0374992_339_812 153
619 3300049572 Ga0501036_0000375 Ga0501036_0000375_3092_3565 153
620 3300049572 Ga0501036_0240258 Ga0501036_0240258_963_1436 153
621 3300049573 Ga0501037_0000041 Ga0501037_0000041_67581_68054 153
622 3300049574 Ga0501038_0000057 Ga0501038_0000057_43869_44342 153
623 3300049575 Ga0501039_0000084 Ga0501039_0000084_41714_42187 153
624 3300049579 Ga0501043_0000184 Ga0501043_0000184_41313_41786 153
625 3300049579 Ga0501043_0311063 Ga0501043_0311063_607_1080 153
626 3300049580 Ga0501046_0000072 Ga0501046_0000072_38230_38703 153
627 3300049581 Ga0501047_0000044 Ga0501047_0000044_67663_68136 153
628 3300049581 Ga0501047_0098684 Ga0501047_0098684_1170_1643 153
629 3300049582 Ga0501048_0000295 Ga0501048_0000295_6522_6995 153
630 3300049583 Ga0501067_0004567 Ga0501067_0004567_337_810 153
631 3300049584 Ga0501068_0000113 Ga0501068_0000113_7100_7573 153
632 3300049586 Ga0501070_0000310 Ga0501070_0000310_15808_16281 153
633 3300049586 Ga0501070_0170589 Ga0501070_0170589_181_657 153
634 3300049587 Ga0501071_0082831 Ga0501071_0082831_924_1397 153
635 3300049589 Ga0501073_0000043 Ga0501073_0000043_25351_25824 153
636 3300049590 Ga0501074_0000035 Ga0501074_0000035_3569_4042 153
637 3300049741 Ga0501079_0000839 Ga0501079_0000839_6508_6981 153
638 3300049742 Ga0501080_0000600 Ga0501080_0000600_1100_1573 153
639 3300049822 Ga0501035_0000128 Ga0501035_0000128_31665_32138 153
640 3300049822 Ga0501035_0168456 Ga0501035_0168456_481_954 153
641 3300049823 Ga0501044_0000108 Ga0501044_0000108_884_1357 153
642 3300049823 Ga0501044_0168054 Ga0501044_0168054_768_1241 153
643 3300050490 nmdc:mga03n38_72610_c1 nmdc:mga03n38_72610_c1_520_981 153
644 3300050491 nmdc:mga00v17_120618_c1 nmdc:mga00v17_120618_c1_1117_1626 153
645 3300050491 nmdc:mga00v17_84895_c1 nmdc:mga00v17_84895_c1_321_782 153
646 3300050492 nmdc:mga0yw44_17645_c1 nmdc:mga0yw44_17645_c1_1934_2395 153
647 3300050492 nmdc:mga0yw44_181061_c1 nmdc:mga0yw44_181061_c1_409_870 153
648 3300050492 nmdc:mga0yw44_3454_c1 nmdc:mga0yw44_3454_c1_1915_2376 153
649 3300050493 nmdc:mga0k408_11705_c1 nmdc:mga0k408_11705_c1_2858_3319 153
650 3300050494 nmdc:mga06z11_36518_c1 nmdc:mga06z11_36518_c1_1806_2267 153
651 3300050494 nmdc:mga06z11_84947_c1 nmdc:mga06z11_84947_c1_1013_1474 153
652 3300050495 nmdc:mga04h51_243680_c1 nmdc:mga04h51_243680_c1_30_491 153
653 3300050496 nmdc:mga07m45_70978_c1 nmdc:mga07m45_70978_c1_1268_1729 153
654 3300050516 nmdc:mga0sz30_19353_c1 nmdc:mga0sz30_19353_c1_1834_2295 153
655 3300053079 Ga0500610_0089377 Ga0500610_0089377_603_1064 153
656 3300053086 Ga0500578_0088963 Ga0500578_0088963_649_1122 153
657 3300053086 Ga0500578_0174854 Ga0500578_0174854_339_821 153
658 3300053087 Ga0500643_000095 Ga0500643_000095_53079_53540 153
659 3300053091 Ga0500647_0069478 Ga0500647_0069478_707_1168 153
660 3300053092 Ga0500583_0128213 Ga0500583_0128213_300_773 153
661 3300053093 Ga0500651_0001437 Ga0500651_0001437_3881_4354 153
662 3300053093 Ga0500651_0071348 Ga0500651_0071348_792_1253 153
663 3300053094 Ga0500566_0000123 Ga0500566_0000123_16331_16792 153
664 3300053094 Ga0500566_0129947 Ga0500566_0129947_602_1063 153
665 3300053105 Ga0500557_000036 Ga0500557_000036_48915_49376 153
666 3300053111 Ga0500572_000007 Ga0500572_000007_2741_3217 153
667 3300053111 Ga0500572_036657 Ga0500572_036657_902_1363 153
668 3300053118 Ga0500594_0005223 Ga0500594_0005223_799_1272 153
669 3300053119 Ga0500595_000839 Ga0500595_000839_1170_1643 153
670 3300053119 Ga0500595_001859 Ga0500595_001859_3565_4038 153
671 3300053119 Ga0500595_006961 Ga0500595_006961_3310_3783 153
672 3300053119 Ga0500595_041418 Ga0500595_041418_915_1376 153
673 3300053121 Ga0500607_181938 Ga0500607_181938_378_839 153
674 3300053122 Ga0500608_012042 Ga0500608_012042_2008_2469 153
675 3300053130 Ga0500642_0000103 Ga0500642_0000103_13900_14361 153
676 3300053130 Ga0500642_0001828 Ga0500642_0001828_90_563 153
677 3300053130 Ga0500642_0101505 Ga0500642_0101505_428_889 153
678 3300053133 Ga0500655_010875 Ga0500655_010875_858_1319 153
679 3300053136 Ga0500559_0000725 Ga0500559_0000725_20026_20502 153
680 3300053138 Ga0500564_054697 Ga0500564_054697_477_938 153
681 3300053139 Ga0500568_0053111 Ga0500568_0053111_316_777 153
682 3300053139 Ga0500568_0072323 Ga0500568_0072323_244_717 153
683 3300053146 Ga0500588_0109433 Ga0500588_0109433_191_664 153
684 3300053148 Ga0500590_040973 Ga0500590_040973_1083_1544 153
685 3300053148 Ga0500590_080638 Ga0500590_080638_33_494 153
686 3300053151 Ga0500604_0029379 Ga0500604_0029379_194_655 153
687 3300053151 Ga0500604_0079330 Ga0500604_0079330_235_708 153
688 3300053154 Ga0500619_098566 Ga0500619_098566_70_531 153
689 3300053157 Ga0500624_007628 Ga0500624_007628_694_1155 153
690 3300053158 Ga0500627_0032148 Ga0500627_0032148_1027_1488 153
691 3300053163 Ga0500639_019994 Ga0500639_019994_2337_2813 153
692 3300053177 Ga0500636_0000807 Ga0500636_0000807_15261_15722 153
693 3300053729 Ga0500625_000325 Ga0500625_000325_11260_11721 153
694 3300053730 Ga0500645_061521 Ga0500645_061521_430_891 153
695 3300053731 Ga0500609_028446 Ga0500609_028446_195_656 153
696 3300053733 Ga0500552_003879 Ga0500552_003879_648_1109 153
697 3300053735 Ga0500596_036145 Ga0500596_036145_102_563 153
698 3300053737 Ga0500601_000390 Ga0500601_000390_6419_6880 153
699 3300054114 Ga0501084_0195524 Ga0501084_0195524_258_731 153
700 3300055283 Ga0500661_010231 Ga0500661_010231_939_1400 153
701 3300060353 Ga0501082_0005614 Ga0501082_0005614_2098_2571 153
702 3300061719 Ga0466962_0211067 Ga0466962_0211067_256_726 153
703 3300061719 Ga0466962_0226512 Ga0466962_0226512_341_802 153
704 3300061719 Ga0466962_0570726 Ga0466962_0570726_64_534 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01584

CheW

CheW-like domain

31

169

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jpb-assembly1.cif.gz_W the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. 0.8658 11 152
2qdl-assembly2.cif.gz_B crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis 0.8592 12 151
1b3q-assembly1.cif.gz_B crystal structure of chea-289, a signal transducing histidine kinase 0.8348 12 148
3ja6-assembly1.cif.gz_F cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling 0.8342 12 152
2ho9-assembly1.cif.gz_A solution structure of chemotaxi protein chew from escherichia coli 0.832 8 153
ID Description Score Start End Superfamily
af_Q8IXI1_282_473_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.869 85 101 1.10.238.10
af_Q8IMX7_308_504_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.8672 85 101 1.10.238.10
2ch4W02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.7986 33 104 2.40.50.180
2ch4A02 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.7963 13 148 2.30.30.40
1b3qA04 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 0.7918 34 103 2.40.50.180
ID Description Score Start End GO Terms
AF-A0A147I783-F1-model_v4 Chemotaxis protein CheW 0.9619 13 152 GO:0005829
GO:0006935
GO:0007165
AF-A0A3Q9IPZ2-F1-model_v4 Chemotaxis protein CheW 0.9447 11 152 GO:0005829
GO:0006935
GO:0007165
AF-A0A1Y5R7R6-F1-model_v4 Chemotaxis protein CheW 0.933 7 151 GO:0005829
GO:0006935
GO:0007165
AF-A0A2E6UDM5-F1-model_v4 deleted 0.9313 12 153
AF-K6DQV2-F1-model_v4 Chemotaxis protein CheA (EC 2.7.13.3) 0.9272 12 153 GO:0000155
GO:0005524
GO:0005737
GO:0006935

Feature Viewer

pLDDT pTM Quality
85.77 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map