F476343
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 704 | 460 | 566 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10052421|Ga0075364_100524212 |
| Length | 169 |
| Sequence | MSGGVARGVVEPGPQAAADGGQRDGRQGGQQVVMFRIGSESFALEAGMVREIIDPIPATRVAGARPHIDRIVNVRGNVVPLADIRERFGMPAASASPDTRFLVLEVPVAGDPVVVALVADKVFAVTEVDPAQCEAVPPVGTTWRPEYIRSIVKAGDEFIIVPELEQILD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 6 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 9 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 10 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 11 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 12 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 13 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 14 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 15 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 16 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 17 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 18 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 21 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 22 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 23 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 24 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 25 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 26 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 27 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 28 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 29 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 30 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 31 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 32 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 33 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 34 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 35 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 36 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 37 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 38 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 39 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 40 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 41 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 42 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 43 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 44 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 45 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 46 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 47 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 48 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 49 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 50 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 51 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 52 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 53 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 54 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 55 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 56 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 57 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 58 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 59 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 60 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 61 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 62 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 63 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 64 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 65 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 66 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 67 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 68 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 69 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 70 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 71 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 72 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 73 | 2922368715 | |||
| 74 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 75 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 76 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 77 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 78 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 79 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 80 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 81 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 82 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 83 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 84 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 85 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 86 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 87 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 88 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 89 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 90 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 91 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 92 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 93 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 94 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 95 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 96 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 97 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 98 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 99 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 100 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 101 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 102 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 103 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 104 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 105 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 106 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 107 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 108 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 109 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 110 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 111 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 112 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 113 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 114 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 115 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 116 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 117 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 118 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 119 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 120 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 121 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 122 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 123 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 124 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 125 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 126 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 127 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 130 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 137 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 138 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 139 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 142 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 143 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 144 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 145 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 146 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 147 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 148 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 149 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 150 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 151 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 152 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 153 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 155 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 156 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 157 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 158 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 159 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 161 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 162 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 163 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 164 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 165 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 166 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 167 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 168 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 180 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 184 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 187 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 188 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 189 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 190 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 239 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 240 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 241 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 245 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 246 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 247 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 248 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 250 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 251 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 254 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 255 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 256 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 257 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 258 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 259 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 260 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 261 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 262 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 263 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 266 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 267 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 269 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 270 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 271 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 272 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 273 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 274 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 275 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 276 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 277 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 279 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 280 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 281 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 282 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 283 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 284 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 285 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 286 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 287 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 288 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 289 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 290 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 291 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 292 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 293 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 294 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 295 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 296 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 297 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 345 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 346 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 347 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 348 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 349 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 350 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 351 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 352 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 353 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 354 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 355 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 356 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 357 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 358 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 359 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 360 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 361 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 362 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 363 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 364 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 389 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 390 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 392 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 393 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 394 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 395 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 396 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 398 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 399 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 400 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 401 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 402 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 404 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 405 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 407 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 409 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 410 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 411 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 412 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 413 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 415 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 417 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 418 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 419 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 423 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 424 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 426 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 428 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 429 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 430 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 432 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 433 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 434 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 435 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 437 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 439 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 440 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 441 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 442 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 443 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 444 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 445 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 446 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 447 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 448 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 449 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 450 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 451 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 452 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 453 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 454 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 455 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 456 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 457 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 458 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 459 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 460 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.37 |
| Metatranscriptomes | 0.14 |
| Isolates | 19.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.03 |
| Nodule | 14.06 |
| Rhizoplane | 3.55 |
| Rhizosphere | 47.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10000633 | 3300003215 | Bacteria | 21490 |
| 2 | JGI25153J46596_10000651 | 3300003215 | Bacteria | 21219 |
| 3 | JGI25153J46596_10006525 | 3300003215 | Bacteria | 5888 |
| 4 | JGI25153J46596_10011915 | 3300003215 | Bacteria | 3805 |
| 5 | rootH2_10071434 | 3300003320 | Bacteria | 2124 |
| 6 | rootH2_10142191 | 3300003320 | Bacteria | 1102 |
| 7 | rootH1_10210164 | 3300003323 | Bacteria | 1791 |
| 8 | JGI25160J50197_1003702 | 3300003354 | Bacteria | 6749 |
| 9 | JGI25160J50197_1020379 | 3300003354 | Bacteria | 2001 |
| 10 | JGI25160J50197_1034445 | 3300003354 | Bacteria | 1257 |
| 11 | JGI25160J50197_1052554 | 3300003354 | Bacteria | 855 |
| 12 | Ga0055542_1012336 | 3300003762 | Bacteria | 1481 |
| 13 | Ga0055526_1000173 | 3300003771 | Bacteria | 57134 |
| 14 | Ga0055526_1039695 | 3300003771 | Bacteria | 1196 |
| 15 | Ga0055524_1007998 | 3300003775 | Bacteria | 4435 |
| 16 | Ga0055524_1038238 | 3300003775 | Bacteria | 1259 |
| 17 | Ga0055531_10012438 | 3300003794 | Bacteria | 4005 |
| 18 | Ga0055543_1018854 | 3300004625 | Bacteria | 1283 |
| 19 | Ga0065165_1000054 | 3300005262 | Bacteria | 187351 |
| 20 | Ga0065165_1001857 | 3300005262 | Bacteria | 20523 |
| 21 | Ga0065165_1002497 | 3300005262 | Bacteria | 15404 |
| 22 | Ga0065165_1012017 | 3300005262 | Bacteria | 3558 |
| 23 | Ga0065165_1028496 | 3300005262 | Bacteria | 1802 |
| 24 | Ga0065165_1146310 | 3300005262 | Bacteria | 554 |
| 25 | Ga0070658_10286870 | 3300005327 | Bacteria | 1402 |
| 26 | Ga0070658_11232645 | 3300005327 | Bacteria | 650 |
| 27 | Ga0070683_100016869 | 3300005329 | Bacteria | 6443 |
| 28 | Ga0070683_100057527 | 3300005329 | Bacteria | 3612 |
| 29 | Ga0070683_100380517 | 3300005329 | Bacteria | 1345 |
| 30 | Ga0068869_100629538 | 3300005334 | Bacteria | 909 |
| 31 | Ga0070660_100356866 | 3300005339 | Bacteria | 1204 |
| 32 | Ga0070661_100496948 | 3300005344 | Bacteria | 976 |
| 33 | Ga0070668_100067353 | 3300005347 | Bacteria | 2781 |
| 34 | Ga0070668_101912293 | 3300005347 | Bacteria | 546 |
| 35 | Ga0070671_100664452 | 3300005355 | Bacteria | 903 |
| 36 | Ga0070671_100671638 | 3300005355 | Bacteria | 898 |
| 37 | Ga0070709_10001267 | 3300005434 | Bacteria | 13836 |
| 38 | Ga0070714_100074581 | 3300005435 | Bacteria | 2941 |
| 39 | Ga0070714_100100248 | 3300005435 | Bacteria | 2551 |
| 40 | Ga0070713_100003456 | 3300005436 | Bacteria | 10433 |
| 41 | Ga0070713_100012930 | 3300005436 | Bacteria | 6143 |
| 42 | Ga0070710_10001610 | 3300005437 | Bacteria | 10663 |
| 43 | Ga0070711_100002880 | 3300005439 | Bacteria | 9907 |
| 44 | Ga0070663_100028242 | 3300005455 | Bacteria | 3817 |
| 45 | Ga0070663_100205671 | 3300005455 | Bacteria | 1539 |
| 46 | Ga0070663_100303255 | 3300005455 | Bacteria | 1279 |
| 47 | Ga0070663_100864258 | 3300005455 | Bacteria | 779 |
| 48 | Ga0070663_101258972 | 3300005455 | Bacteria | 652 |
| 49 | Ga0070662_100116916 | 3300005457 | Bacteria | 2039 |
| 50 | Ga0070662_100957630 | 3300005457 | Bacteria | 732 |
| 51 | Ga0070681_10490107 | 3300005458 | Bacteria | 1142 |
| 52 | Ga0070681_10764613 | 3300005458 | Bacteria | 883 |
| 53 | Ga0068867_100590894 | 3300005459 | Bacteria | 967 |
| 54 | Ga0070679_100644478 | 3300005530 | Bacteria | 1002 |
| 55 | Ga0070679_101252965 | 3300005530 | Bacteria | 687 |
| 56 | Ga0070684_100119361 | 3300005535 | Bacteria | 2371 |
| 57 | Ga0070684_100467275 | 3300005535 | Bacteria | 1167 |
| 58 | Ga0068853_100094938 | 3300005539 | Bacteria | 2629 |
| 59 | Ga0068855_100406802 | 3300005563 | Bacteria | 1490 |
| 60 | Ga0068854_100182894 | 3300005578 | Bacteria | 1638 |
| 61 | Ga0068854_101294770 | 3300005578 | Bacteria | 656 |
| 62 | Ga0068856_100136993 | 3300005614 | Bacteria | 2454 |
| 63 | Ga0068856_100946365 | 3300005614 | Bacteria | 880 |
| 64 | Ga0068852_100004911 | 3300005616 | Bacteria | 9495 |
| 65 | Ga0068852_100563397 | 3300005616 | Bacteria | 1141 |
| 66 | Ga0068861_100482891 | 3300005719 | Bacteria | 1117 |
| 67 | Ga0068860_101160816 | 3300005843 | Bacteria | 792 |
| 68 | Ga0081540_1024700 | 3300005983 | Bacteria | 3480 |
| 69 | Ga0081540_1042065 | 3300005983 | Bacteria | 2361 |
| 70 | Ga0070717_10304191 | 3300006028 | Bacteria | 1418 |
| 71 | Ga0075365_10112608 | 3300006038 | Bacteria | 1871 |
| 72 | Ga0075365_10391558 | 3300006038 | Bacteria | 980 |
| 73 | Ga0075368_10012228 | 3300006042 | Bacteria | 3135 |
| 74 | Ga0075363_100053622 | 3300006048 | Bacteria | 2155 |
| 75 | Ga0075364_10052421 | 3300006051 | Bacteria | 2666 |
| 76 | Ga0075364_10231929 | 3300006051 | Bacteria | 1253 |
| 77 | Ga0075364_10284209 | 3300006051 | Bacteria | 1125 |
| 78 | Ga0070715_10300045 | 3300006163 | Bacteria | 859 |
| 79 | Ga0070716_100001907 | 3300006173 | Bacteria | 9470 |
| 80 | Ga0075362_10130019 | 3300006177 | Bacteria | 1197 |
| 81 | Ga0075367_10019153 | 3300006178 | Bacteria | 3791 |
| 82 | Ga0075369_10041495 | 3300006186 | Bacteria | 1970 |
| 83 | Ga0075366_10008786 | 3300006195 | Bacteria | 5626 |
| 84 | Ga0075370_10035459 | 3300006353 | Bacteria | 2799 |
| 85 | Ga0075370_10077807 | 3300006353 | Bacteria | 1903 |
| 86 | Ga0075370_10115486 | 3300006353 | Bacteria | 1560 |
| 87 | Ga0099825_1035136 | 3300006941 | Bacteria | 1812 |
| 88 | Ga0099824_1024667 | 3300006942 | Bacteria | 3458 |
| 89 | Ga0099823_1035448 | 3300006944 | Bacteria | 3892 |
| 90 | Ga0105240_10008853 | 3300009093 | Bacteria | 14333 |
| 91 | Ga0105240_10020641 | 3300009093 | Bacteria | 8781 |
| 92 | Ga0105240_10529580 | 3300009093 | Bacteria | 1306 |
| 93 | Ga0105245_10018245 | 3300009098 | Bacteria | 6135 |
| 94 | Ga0105247_10240037 | 3300009101 | Bacteria | 1234 |
| 95 | Ga0105247_11130622 | 3300009101 | Bacteria | 619 |
| 96 | Ga0105243_10163201 | 3300009148 | Bacteria | 1923 |
| 97 | Ga0105241_10026075 | 3300009174 | Bacteria | 4347 |
| 98 | Ga0105248_10174632 | 3300009177 | Bacteria | 2422 |
| 99 | Ga0105248_11778212 | 3300009177 | Bacteria | 699 |
| 100 | Ga0105237_10000457 | 3300009545 | Bacteria | 57876 |
| 101 | Ga0105237_10233149 | 3300009545 | Bacteria | 1842 |
| 102 | Ga0105237_10299996 | 3300009545 | Bacteria | 1610 |
| 103 | Ga0105237_10351814 | 3300009545 | Bacteria | 1478 |
| 104 | Ga0105238_10112481 | 3300009551 | Bacteria | 2702 |
| 105 | Ga0105238_10246878 | 3300009551 | Bacteria | 1763 |
| 106 | Ga0105249_11111616 | 3300009553 | Bacteria | 860 |
| 107 | Ga0105239_10039622 | 3300010375 | Bacteria | 5161 |
| 108 | Ga0105239_10967885 | 3300010375 | Bacteria | 978 |
| 109 | Ga0105246_10663090 | 3300011119 | Bacteria | 910 |
| 110 | Ga0157313_1033209 | 3300012503 | Bacteria | 597 |
| 111 | Ga0157370_10255697 | 3300013104 | Bacteria | 1620 |
| 112 | Ga0157370_11778291 | 3300013104 | Bacteria | 553 |
| 113 | Ga0157369_10007758 | 3300013105 | Bacteria | 12344 |
| 114 | Ga0157369_10009352 | 3300013105 | Bacteria | 11208 |
| 115 | Ga0157369_11298813 | 3300013105 | Bacteria | 742 |
| 116 | Ga0157369_11712365 | 3300013105 | Bacteria | 639 |
| 117 | Ga0157372_10091432 | 3300013307 | Bacteria | 3461 |
| 118 | Ga0182008_10302064 | 3300014497 | Bacteria | 838 |
| 119 | Ga0157376_10772014 | 3300014969 | Bacteria | 972 |
| 120 | Ga0163161_10857756 | 3300017792 | Bacteria | 767 |
| 121 | Ga0213872_10132161 | 3300021361 | Bacteria | 1099 |
| 122 | Ga0213874_10185445 | 3300021377 | Bacteria | 742 |
| 123 | Ga0213876_10101179 | 3300021384 | Bacteria | 1528 |
| 124 | Ga0213871_10000466 | 3300021441 | Bacteria | 5488 |
| 125 | Ga0209563_108109 | 3300025230 | Bacteria | 1676 |
| 126 | Ga0207425_1011633 | 3300025245 | Bacteria | 2091 |
| 127 | Ga0209677_102436 | 3300025253 | Bacteria | 7003 |
| 128 | Ga0209148_1000421 | 3300025254 | Bacteria | 47524 |
| 129 | Ga0209148_1027802 | 3300025254 | Bacteria | 867 |
| 130 | Ga0209233_1002484 | 3300025261 | Bacteria | 6755 |
| 131 | Ga0209233_1054776 | 3300025261 | Bacteria | 794 |
| 132 | Ga0209455_1002493 | 3300025272 | Bacteria | 7068 |
| 133 | Ga0209455_1006416 | 3300025272 | Bacteria | 3475 |
| 134 | Ga0209455_1026778 | 3300025272 | Bacteria | 1030 |
| 135 | Ga0209673_1017159 | 3300025273 | Bacteria | 2676 |
| 136 | Ga0209025_1068474 | 3300025294 | Bacteria | 1275 |
| 137 | Ga0209564_1000044 | 3300025295 | Bacteria | 381017 |
| 138 | Ga0209564_1004705 | 3300025295 | Bacteria | 8182 |
| 139 | Ga0209564_1014807 | 3300025295 | Bacteria | 3216 |
| 140 | Ga0209758_1000117 | 3300025297 | Bacteria | 198325 |
| 141 | Ga0209758_1000506 | 3300025297 | Bacteria | 63135 |
| 142 | Ga0209758_1001068 | 3300025297 | Bacteria | 35664 |
| 143 | Ga0209758_1001793 | 3300025297 | Bacteria | 23709 |
| 144 | Ga0209758_1003491 | 3300025297 | Bacteria | 14222 |
| 145 | Ga0209758_1007058 | 3300025297 | Bacteria | 7792 |
| 146 | Ga0209758_1025207 | 3300025297 | Bacteria | 2617 |
| 147 | Ga0209050_1103381 | 3300025298 | Bacteria | 560 |
| 148 | Ga0209256_1000740 | 3300025299 | Bacteria | 42806 |
| 149 | Ga0209256_1007255 | 3300025299 | Bacteria | 5533 |
| 150 | Ga0209256_1010920 | 3300025299 | Bacteria | 3721 |
| 151 | Ga0209256_1052785 | 3300025299 | Bacteria | 975 |
| 152 | Ga0207426_1000467 | 3300025302 | Bacteria | 62488 |
| 153 | Ga0207426_1000508 | 3300025302 | Bacteria | 57035 |
| 154 | Ga0207426_1004734 | 3300025302 | Bacteria | 6503 |
| 155 | Ga0207426_1004808 | 3300025302 | Bacteria | 6410 |
| 156 | Ga0207426_1007596 | 3300025302 | Bacteria | 4513 |
| 157 | Ga0207426_1028439 | 3300025302 | Bacteria | 1853 |
| 158 | Ga0209257_1000158 | 3300025304 | Bacteria | 180079 |
| 159 | Ga0209257_1010490 | 3300025304 | Bacteria | 4675 |
| 160 | Ga0209257_1024526 | 3300025304 | Bacteria | 2086 |
| 161 | Ga0207692_10001796 | 3300025898 | Bacteria | 8136 |
| 162 | Ga0207647_10049933 | 3300025904 | Bacteria | 2593 |
| 163 | Ga0207647_10062038 | 3300025904 | Bacteria | 2278 |
| 164 | Ga0207699_10000749 | 3300025906 | Bacteria | 15507 |
| 165 | Ga0207699_10105039 | 3300025906 | Bacteria | 1800 |
| 166 | Ga0207705_10207755 | 3300025909 | Bacteria | 1485 |
| 167 | Ga0207707_10387110 | 3300025912 | Bacteria | 1201 |
| 168 | Ga0207707_10483173 | 3300025912 | Bacteria | 1058 |
| 169 | Ga0207695_10000136 | 3300025913 | Bacteria | 217596 |
| 170 | Ga0207695_10019551 | 3300025913 | Bacteria | 7793 |
| 171 | Ga0207695_10588513 | 3300025913 | Bacteria | 994 |
| 172 | Ga0207671_10000202 | 3300025914 | Bacteria | 90868 |
| 173 | Ga0207671_10193140 | 3300025914 | Bacteria | 1588 |
| 174 | Ga0207671_10460633 | 3300025914 | Bacteria | 1013 |
| 175 | Ga0207671_10739685 | 3300025914 | Bacteria | 781 |
| 176 | Ga0207663_10001805 | 3300025916 | Bacteria | 10114 |
| 177 | Ga0207657_10327332 | 3300025919 | Bacteria | 1211 |
| 178 | Ga0207649_10182781 | 3300025920 | Bacteria | 1469 |
| 179 | Ga0207652_10096788 | 3300025921 | Bacteria | 2600 |
| 180 | Ga0207652_10773751 | 3300025921 | Bacteria | 853 |
| 181 | Ga0207694_10108605 | 3300025924 | Bacteria | 2205 |
| 182 | Ga0207694_10423569 | 3300025924 | Bacteria | 1109 |
| 183 | Ga0207694_10509732 | 3300025924 | Bacteria | 1008 |
| 184 | Ga0207700_10004852 | 3300025928 | Bacteria | 7985 |
| 185 | Ga0207700_10230989 | 3300025928 | Bacteria | 1573 |
| 186 | Ga0207664_10012842 | 3300025929 | Bacteria | 6000 |
| 187 | Ga0207664_10078418 | 3300025929 | Bacteria | 2679 |
| 188 | Ga0207644_10345515 | 3300025931 | Bacteria | 1207 |
| 189 | Ga0207690_10995139 | 3300025932 | Bacteria | 697 |
| 190 | Ga0207706_10239609 | 3300025933 | Bacteria | 1586 |
| 191 | Ga0207704_11071255 | 3300025938 | Bacteria | 684 |
| 192 | Ga0207665_10002001 | 3300025939 | Bacteria | 13745 |
| 193 | Ga0207691_10406959 | 3300025940 | Bacteria | 1160 |
| 194 | Ga0207661_10009082 | 3300025944 | Bacteria | 7123 |
| 195 | Ga0207661_10013432 | 3300025944 | Bacteria | 5981 |
| 196 | Ga0207661_10308980 | 3300025944 | Bacteria | 1419 |
| 197 | Ga0207679_10280192 | 3300025945 | Bacteria | 1429 |
| 198 | Ga0207667_10202524 | 3300025949 | Bacteria | 2036 |
| 199 | Ga0207667_10680242 | 3300025949 | Bacteria | 1032 |
| 200 | Ga0207667_11341324 | 3300025949 | Bacteria | 690 |
| 201 | Ga0207712_11504045 | 3300025961 | Bacteria | 603 |
| 202 | Ga0207640_10132607 | 3300025981 | Bacteria | 1803 |
| 203 | Ga0207640_10598478 | 3300025981 | Bacteria | 933 |
| 204 | Ga0207703_10614328 | 3300026035 | Bacteria | 1029 |
| 205 | Ga0207678_10142454 | 3300026067 | Bacteria | 2046 |
| 206 | Ga0207678_10288099 | 3300026067 | Bacteria | 1410 |
| 207 | Ga0207702_10048849 | 3300026078 | Bacteria | 3569 |
| 208 | Ga0207702_11329397 | 3300026078 | Bacteria | 713 |
| 209 | Ga0207648_10091226 | 3300026089 | Bacteria | 2664 |
| 210 | Ga0207674_10287691 | 3300026116 | Bacteria | 1592 |
| 211 | Ga0207675_100398490 | 3300026118 | Bacteria | 1356 |
| 212 | Ga0207683_10201072 | 3300026121 | Bacteria | 1811 |
| 213 | Ga0207698_10130247 | 3300026142 | Bacteria | 2148 |
| 214 | Ga0207698_12321642 | 3300026142 | Bacteria | 548 |
| 215 | Ga0209389_1000056 | 3300027296 | Bacteria | 107673 |
| 216 | Ga0209389_1000206 | 3300027296 | Bacteria | 42342 |
| 217 | Ga0209589_1000034 | 3300027357 | Bacteria | 138086 |
| 218 | Ga0209489_100009 | 3300027361 | Bacteria | 263873 |
| 219 | Ga0209489_103071 | 3300027361 | Bacteria | 33029 |
| 220 | Ga0209700_100471 | 3300027363 | Bacteria | 75447 |
| 221 | Ga0268266_10413922 | 3300028379 | Bacteria | 1276 |
| 222 | Ga0268266_11116163 | 3300028379 | Bacteria | 763 |
| 223 | Ga0268265_11200562 | 3300028380 | Bacteria | 756 |
| 224 | Ga0268265_11312664 | 3300028380 | Bacteria | 724 |
| 225 | Ga0268264_10377387 | 3300028381 | Bacteria | 1357 |
| 226 | Ga0265337_1011803 | 3300028556 | Bacteria | 2997 |
| 227 | Ga0265319_1020457 | 3300028563 | Bacteria | 2452 |
| 228 | Ga0265334_10019060 | 3300028573 | Bacteria | 2825 |
| 229 | Ga0265323_10003447 | 3300028653 | Bacteria | 6980 |
| 230 | Ga0265322_10010245 | 3300028654 | Bacteria | 2718 |
| 231 | Ga0265336_10001603 | 3300028666 | Bacteria | 10097 |
| 232 | Ga0307515_10356520 | 3300028794 | Bacteria | 1106 |
| 233 | Ga0307515_10483755 | 3300028794 | Bacteria | 850 |
| 234 | Ga0265338_10000119 | 3300028800 | Bacteria | 146599 |
| 235 | Ga0265324_10003043 | 3300029957 | Bacteria | 8195 |
| 236 | Ga0265330_10013665 | 3300031235 | Bacteria | 3780 |
| 237 | Ga0265330_10023908 | 3300031235 | Bacteria | 2772 |
| 238 | Ga0265330_10032553 | 3300031235 | Bacteria | 2336 |
| 239 | Ga0265330_10350038 | 3300031235 | Bacteria | 624 |
| 240 | Ga0265328_10027924 | 3300031239 | Bacteria | 2113 |
| 241 | Ga0265325_10014457 | 3300031241 | Bacteria | 4460 |
| 242 | Ga0265325_10029818 | 3300031241 | Bacteria | 2929 |
| 243 | Ga0265325_10096818 | 3300031241 | Bacteria | 1449 |
| 244 | Ga0265340_10005088 | 3300031247 | Bacteria | 7315 |
| 245 | Ga0265340_10009354 | 3300031247 | Bacteria | 5263 |
| 246 | Ga0265339_10021233 | 3300031249 | Bacteria | 3781 |
| 247 | Ga0265339_10104739 | 3300031249 | Bacteria | 1469 |
| 248 | Ga0265316_10236920 | 3300031344 | Bacteria | 1343 |
| 249 | Ga0265316_10839484 | 3300031344 | Bacteria | 643 |
| 250 | Ga0307508_10000002 | 3300031616 | Bacteria | 407635 |
| 251 | Ga0265314_10199694 | 3300031711 | Bacteria | 1183 |
| 252 | Ga0265314_10521539 | 3300031711 | Bacteria | 622 |
| 253 | Ga0265342_10312167 | 3300031712 | Bacteria | 826 |
| 254 | Ga0265342_10443944 | 3300031712 | Bacteria | 666 |
| 255 | Ga0307406_10072735 | 3300031901 | Bacteria | 2258 |
| 256 | Ga0307409_100297943 | 3300031995 | Bacteria | 1499 |
| 257 | Ga0307510_10020579 | 3300033180 | Bacteria | 7705 |
| 258 | Ga0307510_10079893 | 3300033180 | Bacteria | 3184 |
| 259 | Ga0316215_1003229 | 3300033544 | Bacteria | 1549 |
| 260 | Ga0372808_022651 | 3300036459 | Bacteria | 903 |
| 261 | Ga0373925_0232094 | 3300037068 | Bacteria | 1476 |
| 262 | Ga0395900_0003815 | 3300037418 | Bacteria | 16114 |
| 263 | Ga0395900_0033307 | 3300037418 | Bacteria | 5303 |
| 264 | Ga0395898_0007171 | 3300037466 | Bacteria | 11834 |
| 265 | Ga0395898_0022885 | 3300037466 | Bacteria | 6320 |
| 266 | Ga0395905_0396858 | 3300037471 | Bacteria | 1274 |
| 267 | Ga0395905_0431446 | 3300037471 | Bacteria | 1215 |
| 268 | Ga0436364_0702767 | 3300037853 | Bacteria | 2047 |
| 269 | Ga0436364_0992294 | 3300037853 | Bacteria | 2476 |
| 270 | Ga0436364_1006809 | 3300037853 | Bacteria | 2884 |
| 271 | Ga0395901_0017745 | 3300038443 | Bacteria | 7264 |
| 272 | Ga0395901_0086930 | 3300038443 | Bacteria | 3269 |
| 273 | Ga0436365_0328373 | 3300039437 | Bacteria | 1181 |
| 274 | Ga0436365_0877926 | 3300039437 | Bacteria | 1738 |
| 275 | Ga0436360_0048231 | 3300039438 | Bacteria | 2048 |
| 276 | Ga0436360_0210980 | 3300039438 | Bacteria | 939 |
| 277 | Ga0436360_0517490 | 3300039438 | Bacteria | 674 |
| 278 | Ga0436361_0603673 | 3300039447 | Bacteria | 2172 |
| 279 | Ga0436361_0856172 | 3300039447 | Bacteria | 2683 |
| 280 | Ga0436363_0369931 | 3300039450 | Bacteria | 1303 |
| 281 | Ga0451795_0607088 | 3300041456 | Bacteria | 698 |
| 282 | Ga0451853_0276558 | 3300041512 | Bacteria | 838 |
| 283 | Ga0439448_0305875 | 3300042005 | Bacteria | 565 |
| 284 | Ga0439455_0061018 | 3300042012 | Bacteria | 1000 |
| 285 | Ga0466969_0058336 | 3300044656 | Bacteria | 1879 |
| 286 | Ga0466972_0064349 | 3300044658 | Bacteria | 1755 |
| 287 | Ga0466972_0530824 | 3300044658 | Bacteria | 555 |
| 288 | Ga0466965_0059710 | 3300044683 | Bacteria | 1904 |
| 289 | Ga0466966_0000101 | 3300044684 | Bacteria | 51920 |
| 290 | Ga0466966_0033392 | 3300044684 | Bacteria | 3332 |
| 291 | Ga0466966_0097463 | 3300044684 | Bacteria | 1821 |
| 292 | Ga0466961_0000031 | 3300044693 | Bacteria | 85869 |
| 293 | Ga0466961_0180738 | 3300044693 | Bacteria | 1310 |
| 294 | Ga0466961_0180775 | 3300044693 | Bacteria | 1310 |
| 295 | Ga0466963_0093654 | 3300044694 | Bacteria | 2048 |
| 296 | Ga0466963_0960950 | 3300044694 | Bacteria | 602 |
| 297 | Ga0466964_0021841 | 3300044706 | Bacteria | 2478 |
| 298 | Ga0466964_0155474 | 3300044706 | Bacteria | 1064 |
| 299 | Ga0466964_0299213 | 3300044706 | Bacteria | 810 |
| 300 | Ga0466964_0354482 | 3300044706 | Bacteria | 755 |
| 301 | Ga0453684_0016148 | 3300044712 | Bacteria | 11709 |
| 302 | Ga0453684_0033684 | 3300044712 | Bacteria | 7133 |
| 303 | Ga0466971_0042632 | 3300044719 | Bacteria | 2039 |
| 304 | Ga0466968_0006726 | 3300044735 | Bacteria | 4345 |
| 305 | Ga0466968_0101386 | 3300044735 | Bacteria | 1285 |
| 306 | Ga0466970_0228919 | 3300044765 | Bacteria | 1039 |
| 307 | Ga0466970_0297872 | 3300044765 | Bacteria | 909 |
| 308 | Ga0466970_0452917 | 3300044765 | Bacteria | 736 |
| 309 | Ga0466957_0065030 | 3300044842 | Bacteria | 2245 |
| 310 | Ga0466957_0066288 | 3300044842 | Bacteria | 2225 |
| 311 | Ga0466957_0272704 | 3300044842 | Bacteria | 1130 |
| 312 | Ga0466957_0740681 | 3300044842 | Bacteria | 695 |
| 313 | Ga0466960_0124246 | 3300044901 | Bacteria | 1355 |
| 314 | Ga0466959_0002151 | 3300045049 | Bacteria | 12504 |
| 315 | Ga0466959_0002988 | 3300045049 | Bacteria | 10928 |
| 316 | Ga0466959_0031213 | 3300045049 | Bacteria | 3943 |
| 317 | Ga0466959_0057353 | 3300045049 | Bacteria | 2839 |
| 318 | Ga0466959_0070341 | 3300045049 | Bacteria | 2535 |
| 319 | Ga0466959_0471538 | 3300045049 | Bacteria | 850 |
| 320 | Ga0466958_0070371 | 3300045836 | Bacteria | 2141 |
| 321 | Ga0466958_0102453 | 3300045836 | Bacteria | 1781 |
| 322 | Ga0466958_0150623 | 3300045836 | Bacteria | 1467 |
| 323 | Ga0466967_0203868 | 3300045976 | Bacteria | 1874 |
| 324 | Ga0466967_0498506 | 3300045976 | Bacteria | 1195 |
| 325 | Ga0466967_1056145 | 3300045976 | Bacteria | 809 |
| 326 | Ga0466967_1372642 | 3300045976 | Bacteria | 704 |
| 327 | Ga0495617_108299 | 3300046452 | Bacteria | 900 |
| 328 | Ga0495603_0202146 | 3300046455 | Bacteria | 1148 |
| 329 | Ga0495603_0740761 | 3300046455 | Bacteria | 561 |
| 330 | Ga0495629_0002586 | 3300046459 | Bacteria | 13860 |
| 331 | Ga0495638_0105506 | 3300046460 | Bacteria | 1679 |
| 332 | Ga0495638_0126783 | 3300046460 | Bacteria | 1504 |
| 333 | Ga0495651_0167439 | 3300046462 | Bacteria | 1568 |
| 334 | Ga0495653_0060377 | 3300046463 | Bacteria | 2873 |
| 335 | Ga0495605_0041048 | 3300046474 | Bacteria | 2306 |
| 336 | Ga0495585_0068543 | 3300046492 | Bacteria | 1938 |
| 337 | Ga0495594_0403405 | 3300046499 | Bacteria | 778 |
| 338 | Ga0495596_0131895 | 3300046500 | Bacteria | 970 |
| 339 | Ga0495606_0302646 | 3300046507 | Bacteria | 866 |
| 340 | Ga0495608_0054448 | 3300046511 | Bacteria | 2645 |
| 341 | Ga0495616_0099956 | 3300046513 | Bacteria | 1362 |
| 342 | Ga0495616_0235884 | 3300046513 | Bacteria | 791 |
| 343 | Ga0495620_0092671 | 3300046515 | Bacteria | 1211 |
| 344 | Ga0495637_0188466 | 3300046520 | Bacteria | 762 |
| 345 | Ga0495643_0014632 | 3300046522 | Bacteria | 4662 |
| 346 | Ga0495648_0033175 | 3300046524 | Bacteria | 3376 |
| 347 | Ga0495648_0140871 | 3300046524 | Bacteria | 1269 |
| 348 | Ga0495648_0366692 | 3300046524 | Bacteria | 653 |
| 349 | Ga0495642_0329594 | 3300046528 | Bacteria | 670 |
| 350 | Ga0495652_0008977 | 3300046529 | Bacteria | 9096 |
| 351 | Ga0495640_0172724 | 3300046533 | Bacteria | 1380 |
| 352 | Ga0495609_0084811 | 3300046538 | Bacteria | 1382 |
| 353 | Ga0495597_0160761 | 3300046542 | Bacteria | 917 |
| 354 | Ga0495622_0026692 | 3300046557 | Bacteria | 2695 |
| 355 | Ga0495622_0126479 | 3300046557 | Bacteria | 1165 |
| 356 | Ga0495668_0079416 | 3300046616 | Bacteria | 1801 |
| 357 | Ga0495668_0222339 | 3300046616 | Bacteria | 1034 |
| 358 | Ga0495668_0257753 | 3300046616 | Bacteria | 955 |
| 359 | Ga0495634_0068687 | 3300046642 | Bacteria | 2340 |
| 360 | Ga0495611_0158863 | 3300046648 | Bacteria | 1056 |
| 361 | Ga0495625_0126219 | 3300046660 | Bacteria | 1737 |
| 362 | Ga0495625_0179116 | 3300046660 | Bacteria | 1411 |
| 363 | Ga0495635_0031284 | 3300046663 | Bacteria | 3695 |
| 364 | Ga0495661_0080164 | 3300046665 | Bacteria | 1885 |
| 365 | Ga0495661_0335685 | 3300046665 | Bacteria | 748 |
| 366 | Ga0495588_0053235 | 3300046674 | Bacteria | 2087 |
| 367 | Ga0495588_0653229 | 3300046674 | Bacteria | 550 |
| 368 | Ga0495657_0013301 | 3300046675 | Bacteria | 6076 |
| 369 | Ga0495646_0336735 | 3300046680 | Bacteria | 792 |
| 370 | Ga0495613_0049718 | 3300046689 | Bacteria | 3093 |
| 371 | Ga0495624_0048352 | 3300046690 | Bacteria | 2700 |
| 372 | Ga0495624_0418800 | 3300046690 | Bacteria | 803 |
| 373 | Ga0495670_0140923 | 3300046691 | Bacteria | 1261 |
| 374 | Ga0495671_0271837 | 3300046692 | Bacteria | 817 |
| 375 | Ga0495649_0119544 | 3300046694 | Bacteria | 1394 |
| 376 | Ga0495649_0228765 | 3300046694 | Bacteria | 960 |
| 377 | Ga0495581_0061631 | 3300047315 | Bacteria | 2168 |
| 378 | Ga0495672_0097648 | 3300047320 | Bacteria | 1599 |
| 379 | Ga0495672_0184032 | 3300047320 | Bacteria | 1056 |
| 380 | Ga0495672_0265729 | 3300047320 | Bacteria | 826 |
| 381 | Ga0495676_0052331 | 3300047321 | Bacteria | 3260 |
| 382 | Ga0495683_0155259 | 3300047323 | Bacteria | 1062 |
| 383 | Ga0495687_040179 | 3300047443 | Bacteria | 2063 |
| 384 | Ga0495673_0030706 | 3300047469 | Bacteria | 2522 |
| 385 | Ga0495686_0090430 | 3300047472 | Bacteria | 1859 |
| 386 | Ga0495686_0325725 | 3300047472 | Bacteria | 841 |
| 387 | Ga0495686_0436442 | 3300047472 | Bacteria | 698 |
| 388 | Ga0495686_0730236 | 3300047472 | Bacteria | 503 |
| 389 | Ga0495593_0079090 | 3300047673 | Bacteria | 1702 |
| 390 | Ga0496100_0073149 | 3300048903 | Bacteria | 2293 |
| 391 | Ga0496100_0625779 | 3300048903 | Bacteria | 837 |
| 392 | Ga0496100_0766154 | 3300048903 | Bacteria | 755 |
| 393 | Ga0496101_0141782 | 3300048904 | Bacteria | 1832 |
| 394 | Ga0496102_0799958 | 3300048905 | Bacteria | 865 |
| 395 | Ga0496102_1957750 | 3300048905 | Bacteria | 502 |
| 396 | Ga0496103_0076550 | 3300048906 | Bacteria | 2100 |
| 397 | Ga0496104_0001655 | 3300048907 | Bacteria | 19236 |
| 398 | Ga0496104_0158818 | 3300048907 | Bacteria | 2169 |
| 399 | Ga0496104_0165528 | 3300048907 | Bacteria | 2120 |
| 400 | Ga0496105_0015424 | 3300048908 | Bacteria | 6089 |
| 401 | Ga0496105_0116057 | 3300048908 | Bacteria | 2208 |
| 402 | Ga0496106_0181806 | 3300048909 | Bacteria | 1669 |
| 403 | Ga0496107_0072888 | 3300048910 | Bacteria | 2497 |
| 404 | Ga0496110_1007957 | 3300048913 | Bacteria | 740 |
| 405 | Ga0496111_1254508 | 3300048914 | Bacteria | 524 |
| 406 | Ga0496112_0081338 | 3300048915 | Bacteria | 3203 |
| 407 | Ga0496113_0050256 | 3300048916 | Bacteria | 3108 |
| 408 | Ga0496113_0162699 | 3300048916 | Bacteria | 1765 |
| 409 | Ga0496114_0150263 | 3300048917 | Bacteria | 2020 |
| 410 | Ga0496114_0342206 | 3300048917 | Bacteria | 1323 |
| 411 | Ga0496114_0975142 | 3300048917 | Bacteria | 730 |
| 412 | Ga0496115_0027286 | 3300048918 | Bacteria | 4465 |
| 413 | Ga0496115_0327399 | 3300048918 | Bacteria | 1252 |
| 414 | Ga0496116_0009012 | 3300048919 | Bacteria | 8574 |
| 415 | Ga0496116_0348644 | 3300048919 | Bacteria | 679 |
| 416 | Ga0496116_0392700 | 3300048919 | Bacteria | 617 |
| 417 | Ga0496117_0055992 | 3300048920 | Bacteria | 2751 |
| 418 | Ga0496117_0060417 | 3300048920 | Bacteria | 2612 |
| 419 | Ga0496117_0226669 | 3300048920 | Bacteria | 1036 |
| 420 | Ga0496118_0039981 | 3300048921 | Bacteria | 3735 |
| 421 | Ga0496118_0061946 | 3300048921 | Bacteria | 2766 |
| 422 | Ga0496118_0168438 | 3300048921 | Bacteria | 1342 |
| 423 | Ga0496119_0007977 | 3300048922 | Bacteria | 9412 |
| 424 | Ga0496119_0244252 | 3300048922 | Bacteria | 908 |
| 425 | Ga0496119_0393461 | 3300048922 | Bacteria | 662 |
| 426 | Ga0496120_0003849 | 3300048923 | Bacteria | 13184 |
| 427 | Ga0496120_0224294 | 3300048923 | Bacteria | 896 |
| 428 | Ga0496121_0013561 | 3300048924 | Bacteria | 8740 |
| 429 | Ga0496121_0021475 | 3300048924 | Bacteria | 6319 |
| 430 | Ga0496121_0049950 | 3300048924 | Bacteria | 3539 |
| 431 | Ga0496121_0069873 | 3300048924 | Bacteria | 2831 |
| 432 | Ga0496121_0072664 | 3300048924 | Bacteria | 2761 |
| 433 | Ga0496121_0181866 | 3300048924 | Bacteria | 1516 |
| 434 | Ga0496121_0189658 | 3300048924 | Bacteria | 1475 |
| 435 | Ga0496121_0362266 | 3300048924 | Bacteria | 962 |
| 436 | Ga0496122_0021585 | 3300048925 | Bacteria | 5757 |
| 437 | Ga0496122_0320772 | 3300048925 | Bacteria | 824 |
| 438 | Ga0496123_0033056 | 3300048926 | Bacteria | 3730 |
| 439 | Ga0496125_0058251 | 3300048928 | Bacteria | 3122 |
| 440 | Ga0496126_0002980 | 3300048929 | Bacteria | 21982 |
| 441 | Ga0496126_0016467 | 3300048929 | Bacteria | 7391 |
| 442 | Ga0496126_0030510 | 3300048929 | Bacteria | 5106 |
| 443 | Ga0496126_0060949 | 3300048929 | Bacteria | 3391 |
| 444 | Ga0496126_0073851 | 3300048929 | Bacteria | 3031 |
| 445 | Ga0496126_0109054 | 3300048929 | Bacteria | 2413 |
| 446 | Ga0496126_0132174 | 3300048929 | Bacteria | 2156 |
| 447 | Ga0496126_0145281 | 3300048929 | Bacteria | 2038 |
| 448 | Ga0496126_0209061 | 3300048929 | Bacteria | 1644 |
| 449 | Ga0496126_0258787 | 3300048929 | Bacteria | 1448 |
| 450 | Ga0496126_0331349 | 3300048929 | Bacteria | 1249 |
| 451 | Ga0496126_0459310 | 3300048929 | Bacteria | 1024 |
| 452 | Ga0501031_0006422 | 3300049568 | Bacteria | 7667 |
| 453 | Ga0501032_0000040 | 3300049569 | Bacteria | 115662 |
| 454 | Ga0501032_0586385 | 3300049569 | Bacteria | 710 |
| 455 | Ga0501033_0000128 | 3300049570 | Bacteria | 73419 |
| 456 | Ga0501033_0134409 | 3300049570 | Bacteria | 1790 |
| 457 | Ga0501034_0000254 | 3300049571 | Bacteria | 97896 |
| 458 | Ga0501034_0374992 | 3300049571 | Bacteria | 1348 |
| 459 | Ga0501036_0000375 | 3300049572 | Bacteria | 31541 |
| 460 | Ga0501036_0240258 | 3300049572 | Bacteria | 1519 |
| 461 | Ga0501037_0000041 | 3300049573 | Bacteria | 118457 |
| 462 | Ga0501038_0000057 | 3300049574 | Bacteria | 92766 |
| 463 | Ga0501039_0000084 | 3300049575 | Bacteria | 71542 |
| 464 | Ga0501043_0000184 | 3300049579 | Bacteria | 56470 |
| 465 | Ga0501043_0311063 | 3300049579 | Bacteria | 1202 |
| 466 | Ga0501046_0000072 | 3300049580 | Bacteria | 106407 |
| 467 | Ga0501046_0136987 | 3300049580 | Bacteria | 1854 |
| 468 | Ga0501047_0000044 | 3300049581 | Bacteria | 174789 |
| 469 | Ga0501047_0009182 | 3300049581 | Bacteria | 9337 |
| 470 | Ga0501047_0098684 | 3300049581 | Bacteria | 2799 |
| 471 | Ga0501048_0000295 | 3300049582 | Bacteria | 33908 |
| 472 | Ga0501067_0004567 | 3300049583 | Bacteria | 7655 |
| 473 | Ga0501068_0000113 | 3300049584 | Bacteria | 34900 |
| 474 | Ga0501070_0000310 | 3300049586 | Bacteria | 44627 |
| 475 | Ga0501070_0098505 | 3300049586 | Bacteria | 2418 |
| 476 | Ga0501070_0170589 | 3300049586 | Bacteria | 1792 |
| 477 | Ga0501070_0748054 | 3300049586 | Bacteria | 770 |
| 478 | Ga0501071_0082831 | 3300049587 | Bacteria | 2350 |
| 479 | Ga0501073_0000043 | 3300049589 | Bacteria | 80142 |
| 480 | Ga0501073_0513768 | 3300049589 | Bacteria | 828 |
| 481 | Ga0501074_0000035 | 3300049590 | Bacteria | 64770 |
| 482 | Ga0501079_0000839 | 3300049741 | Bacteria | 20917 |
| 483 | Ga0501080_0000600 | 3300049742 | Bacteria | 28483 |
| 484 | Ga0501080_0238726 | 3300049742 | Bacteria | 1659 |
| 485 | Ga0501035_0000128 | 3300049822 | Bacteria | 92297 |
| 486 | Ga0501035_0168456 | 3300049822 | Bacteria | 1893 |
| 487 | Ga0501035_0190594 | 3300049822 | Bacteria | 1763 |
| 488 | Ga0501044_0000108 | 3300049823 | Bacteria | 100968 |
| 489 | Ga0501044_0168054 | 3300049823 | Bacteria | 2166 |
| 490 | Ga0501044_0192957 | 3300049823 | Bacteria | 1998 |
| 491 | nmdc:mga03n38_72610_c1 | 3300050490 | Bacteria | 1596 |
| 492 | nmdc:mga00v17_120618_c1 | 3300050491 | Bacteria | 1669 |
| 493 | nmdc:mga00v17_84895_c1 | 3300050491 | Bacteria | 1982 |
| 494 | nmdc:mga0yw44_17645_c1 | 3300050492 | Bacteria | 3890 |
| 495 | nmdc:mga0yw44_181061_c1 | 3300050492 | Bacteria | 1387 |
| 496 | nmdc:mga0yw44_3454_c1 | 3300050492 | Bacteria | 7016 |
| 497 | nmdc:mga0k408_11705_c1 | 3300050493 | Bacteria | 4783 |
| 498 | nmdc:mga06z11_36518_c1 | 3300050494 | Bacteria | 2426 |
| 499 | nmdc:mga06z11_84947_c1 | 3300050494 | Bacteria | 1707 |
| 500 | nmdc:mga04h51_243680_c1 | 3300050495 | Bacteria | 718 |
| 501 | nmdc:mga07m45_70978_c1 | 3300050496 | Bacteria | 1982 |
| 502 | nmdc:mga0sz30_19353_c1 | 3300050516 | Bacteria | 2736 |
| 503 | nmdc:mga0sz30_336207_c1 | 3300050516 | Bacteria | 675 |
| 504 | Ga0500610_0089377 | 3300053079 | Bacteria | 1601 |
| 505 | Ga0500578_0088963 | 3300053086 | Bacteria | 1961 |
| 506 | Ga0500578_0174854 | 3300053086 | Bacteria | 1326 |
| 507 | Ga0500643_000095 | 3300053087 | Bacteria | 92535 |
| 508 | Ga0500647_0069478 | 3300053091 | Bacteria | 1694 |
| 509 | Ga0500583_0128213 | 3300053092 | Bacteria | 1258 |
| 510 | Ga0500651_0001437 | 3300053093 | Bacteria | 11972 |
| 511 | Ga0500651_0071348 | 3300053093 | Bacteria | 2161 |
| 512 | Ga0500566_0000123 | 3300053094 | Bacteria | 40138 |
| 513 | Ga0500566_0129947 | 3300053094 | Bacteria | 1349 |
| 514 | Ga0500556_0033572 | 3300053104 | Bacteria | 1760 |
| 515 | Ga0500557_000036 | 3300053105 | Bacteria | 71169 |
| 516 | Ga0500572_000007 | 3300053111 | Bacteria | 75901 |
| 517 | Ga0500572_036657 | 3300053111 | Bacteria | 1401 |
| 518 | Ga0500572_057420 | 3300053111 | Bacteria | 1175 |
| 519 | Ga0500594_0005223 | 3300053118 | Bacteria | 2879 |
| 520 | Ga0500595_000839 | 3300053119 | Bacteria | 17559 |
| 521 | Ga0500595_001859 | 3300053119 | Bacteria | 10918 |
| 522 | Ga0500595_006961 | 3300053119 | Bacteria | 4743 |
| 523 | Ga0500595_041418 | 3300053119 | Bacteria | 1480 |
| 524 | Ga0500607_181938 | 3300053121 | Bacteria | 930 |
| 525 | Ga0500608_012042 | 3300053122 | Bacteria | 3777 |
| 526 | Ga0500621_201449 | 3300053126 | Bacteria | 705 |
| 527 | Ga0500642_0000103 | 3300053130 | Bacteria | 40846 |
| 528 | Ga0500642_0001828 | 3300053130 | Bacteria | 6142 |
| 529 | Ga0500642_0101505 | 3300053130 | Bacteria | 1338 |
| 530 | Ga0500655_010875 | 3300053133 | Bacteria | 1646 |
| 531 | Ga0500658_0092770 | 3300053134 | Bacteria | 1308 |
| 532 | Ga0500559_0000725 | 3300053136 | Bacteria | 21721 |
| 533 | Ga0500564_054697 | 3300053138 | Bacteria | 1820 |
| 534 | Ga0500568_0053111 | 3300053139 | Bacteria | 1589 |
| 535 | Ga0500568_0072323 | 3300053139 | Bacteria | 1319 |
| 536 | Ga0500568_0080945 | 3300053139 | Bacteria | 1233 |
| 537 | Ga0500588_0109433 | 3300053146 | Bacteria | 962 |
| 538 | Ga0500588_0323879 | 3300053146 | Bacteria | 584 |
| 539 | Ga0500590_040973 | 3300053148 | Bacteria | 2383 |
| 540 | Ga0500590_080638 | 3300053148 | Bacteria | 1599 |
| 541 | Ga0500604_0029379 | 3300053151 | Bacteria | 1602 |
| 542 | Ga0500604_0079330 | 3300053151 | Bacteria | 1058 |
| 543 | Ga0500616_0034464 | 3300053153 | Bacteria | 2757 |
| 544 | Ga0500619_098566 | 3300053154 | Bacteria | 990 |
| 545 | Ga0500622_0012724 | 3300053156 | Bacteria | 4551 |
| 546 | Ga0500622_0012726 | 3300053156 | Bacteria | 4550 |
| 547 | Ga0500624_007628 | 3300053157 | Bacteria | 1494 |
| 548 | Ga0500627_0032148 | 3300053158 | Bacteria | 2210 |
| 549 | Ga0500639_019994 | 3300053163 | Bacteria | 3531 |
| 550 | Ga0500636_0000807 | 3300053177 | Bacteria | 16914 |
| 551 | Ga0500636_0283208 | 3300053177 | Bacteria | 826 |
| 552 | Ga0500637_0515247 | 3300053178 | Bacteria | 589 |
| 553 | Ga0500625_000325 | 3300053729 | Bacteria | 11897 |
| 554 | Ga0500645_061521 | 3300053730 | Bacteria | 1085 |
| 555 | Ga0500609_028446 | 3300053731 | Bacteria | 766 |
| 556 | Ga0500552_003879 | 3300053733 | Bacteria | 1546 |
| 557 | Ga0500596_036145 | 3300053735 | Bacteria | 778 |
| 558 | Ga0500599_002149 | 3300053736 | Bacteria | 2343 |
| 559 | Ga0500601_000390 | 3300053737 | Bacteria | 7562 |
| 560 | Ga0501084_0195524 | 3300054114 | Bacteria | 1706 |
| 561 | Ga0500661_010231 | 3300055283 | Bacteria | 1709 |
| 562 | Ga0501082_0005614 | 3300060353 | Bacteria | 10889 |
| 563 | Ga0466962_0085716 | 3300061719 | Bacteria | 1508 |
| 564 | Ga0466962_0211067 | 3300061719 | Bacteria | 950 |
| 565 | Ga0466962_0226512 | 3300061719 | Bacteria | 916 |
| 566 | Ga0466962_0570726 | 3300061719 | Bacteria | 575 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8016539877 | 8016546196 | 119 |
| 2 | iso_pu_bacteria | 8016522445 | 8016527847 | 136 |
| 3 | iso_pu_bacteria | 8016548790 | 8016555931 | 136 |
| 4 | 3300044684 | Ga0466966_0033392 | Ga0466966_0033392_2871_3293 | 137 |
| 5 | 3300021361 | Ga0213872_10132161 | Ga0213872_101321612 | 139 |
| 6 | 3300021441 | Ga0213871_10000466 | Ga0213871_100004664 | 139 |
| 7 | 3300028794 | Ga0307515_10483755 | Ga0307515_104837552 | 139 |
| 8 | 3300039447 | Ga0436361_0603673 | Ga0436361_0603673_738_1208 | 139 |
| 9 | 3300053156 | Ga0500622_0012724 | Ga0500622_0012724_469_951 | 139 |
| 10 | 3300005329 | Ga0070683_100380517 | Ga0070683_1003805172 | 140 |
| 11 | 3300037853 | Ga0436364_0702767 | Ga0436364_0702767_1601_2023 | 140 |
| 12 | 3300044842 | Ga0466957_0740681 | Ga0466957_0740681_257_679 | 140 |
| 13 | 3300046455 | Ga0495603_0740761 | Ga0495603_0740761_21_443 | 140 |
| 14 | 3300047472 | Ga0495686_0730236 | Ga0495686_0730236_70_492 | 140 |
| 15 | 3300048905 | Ga0496102_1957750 | Ga0496102_1957750_67_489 | 140 |
| 16 | 3300048919 | Ga0496116_0348644 | Ga0496116_0348644_234_656 | 140 |
| 17 | 3300048929 | Ga0496126_0060949 | Ga0496126_0060949_2957_3379 | 140 |
| 18 | 3300049569 | Ga0501032_0586385 | Ga0501032_0586385_18_440 | 140 |
| 19 | 3300050516 | nmdc:mga0sz30_336207_c1 | nmdc:mga0sz30_336207_c1_22_444 | 140 |
| 20 | 3300053134 | Ga0500658_0092770 | Ga0500658_0092770_29_451 | 140 |
| 21 | 3300053139 | Ga0500568_0080945 | Ga0500568_0080945_783_1205 | 140 |
| 22 | 3300053177 | Ga0500636_0283208 | Ga0500636_0283208_383_805 | 140 |
| 23 | iso_pu_bacteria | 3003665799 | 3003667354 | 143 |
| 24 | iso_pu_bacteria | 2513237102 | 2513701343 | 144 |
| 25 | iso_pu_bacteria | 2824617872 | 2824620558 | 144 |
| 26 | iso_pu_bacteria | 2824626560 | 2824630154 | 144 |
| 27 | iso_pu_bacteria | 2824635225 | 2824636354 | 144 |
| 28 | iso_pu_bacteria | 2824644064 | 2824644889 | 144 |
| 29 | iso_pu_bacteria | 2824714736 | 2824715246 | 144 |
| 30 | iso_pu_bacteria | 2824723954 | 2824724677 | 144 |
| 31 | iso_pu_bacteria | 2902330777 | 2902334651 | 144 |
| 32 | iso_pu_bacteria | 8054002106 | 8054008571 | 144 |
| 33 | 3300044712 | Ga0453684_0016148 | Ga0453684_0016148_7730_8173 | 145 |
| 34 | iso_pu_bacteria | 2841911363 | 2841914104 | 145 |
| 35 | iso_pu_bacteria | 2841917233 | 2841919595 | 145 |
| 36 | iso_pu_bacteria | 2891088606 | 2891089765 | 145 |
| 37 | 3300005327 | Ga0070658_11232645 | Ga0070658_112326451 | 146 |
| 38 | 3300045049 | Ga0466959_0471538 | Ga0466959_0471538_194_667 | 146 |
| 39 | 3300031711 | Ga0265314_10521539 | Ga0265314_105215391 | 147 |
| 40 | 3300031712 | Ga0265342_10443944 | Ga0265342_104439442 | 147 |
| 41 | iso_pu_bacteria | 2528768022 | 2528853153 | 147 |
| 42 | iso_pu_bacteria | 2929615660 | 2929621377 | 147 |
| 43 | iso_pu_bacteria | 2929624759 | 2929631809 | 147 |
| 44 | iso_pu_bacteria | 2933577622 | 2933583596 | 147 |
| 45 | iso_pu_bacteria | 8055742211 | 8055744418 | 147 |
| 46 | 3300005614 | Ga0068856_100946365 | Ga0068856_1009463652 | 148 |
| 47 | 3300031235 | Ga0265330_10023908 | Ga0265330_100239082 | 148 |
| 48 | 3300031235 | Ga0265330_10032553 | Ga0265330_100325532 | 148 |
| 49 | 3300031235 | Ga0265330_10350038 | Ga0265330_103500381 | 148 |
| 50 | 3300031239 | Ga0265328_10027924 | Ga0265328_100279242 | 148 |
| 51 | 3300031241 | Ga0265325_10014457 | Ga0265325_100144574 | 148 |
| 52 | 3300031241 | Ga0265325_10029818 | Ga0265325_100298182 | 148 |
| 53 | 3300031241 | Ga0265325_10096818 | Ga0265325_100968181 | 148 |
| 54 | 3300031247 | Ga0265340_10009354 | Ga0265340_100093542 | 148 |
| 55 | 3300031249 | Ga0265339_10021233 | Ga0265339_100212332 | 148 |
| 56 | 3300031344 | Ga0265316_10839484 | Ga0265316_108394842 | 148 |
| 57 | 3300031711 | Ga0265314_10199694 | Ga0265314_101996942 | 148 |
| 58 | 3300031712 | Ga0265342_10312167 | Ga0265342_103121672 | 148 |
| 59 | 3300044693 | Ga0466961_0180738 | Ga0466961_0180738_105_554 | 148 |
| 60 | 3300045049 | Ga0466959_0002151 | Ga0466959_0002151_6748_7197 | 148 |
| 61 | 3300045836 | Ga0466958_0102453 | Ga0466958_0102453_897_1346 | 148 |
| 62 | 3300053178 | Ga0500637_0515247 | Ga0500637_0515247_96_557 | 148 |
| 63 | 3300061719 | Ga0466962_0085716 | Ga0466962_0085716_192_641 | 148 |
| 64 | iso_pu_bacteria | 2824704595 | 2824709412 | 148 |
| 65 | iso_pu_bacteria | 2824753945 | 2824762061 | 148 |
| 66 | iso_pu_bacteria | 2824763712 | 2824768076 | 148 |
| 67 | iso_pu_bacteria | 2844315083 | 2844320721 | 148 |
| 68 | iso_pu_bacteria | 2902405164 | 2902408637 | 148 |
| 69 | iso_pu_bacteria | 2903727486 | 2903728166 | 148 |
| 70 | iso_pu_bacteria | 2904711408 | 2904712879 | 148 |
| 71 | iso_pu_bacteria | 2906602504 | 2906605918 | 148 |
| 72 | iso_pu_bacteria | 3005718088 | 3005723806 | 148 |
| 73 | 3300025906 | Ga0207699_10105039 | Ga0207699_101050392 | 149 |
| 74 | 3300044712 | Ga0453684_0033684 | Ga0453684_0033684_2322_2777 | 149 |
| 75 | 3300044735 | Ga0466968_0101386 | Ga0466968_0101386_252_716 | 149 |
| 76 | 3300049586 | Ga0501070_0748054 | Ga0501070_0748054_115_579 | 149 |
| 77 | iso_pu_bacteria | 2508501128 | 2509153011 | 149 |
| 78 | iso_pu_bacteria | 2511231028 | 2511399992 | 149 |
| 79 | iso_pu_bacteria | 2513237092 | 2513623785 | 149 |
| 80 | iso_pu_bacteria | 2513237094 | 2513641520 | 149 |
| 81 | iso_pu_bacteria | 2513237095 | 2513650529 | 149 |
| 82 | iso_pu_bacteria | 2513237098 | 2513677471 | 149 |
| 83 | iso_pu_bacteria | 2513237139 | 2513877445 | 149 |
| 84 | iso_pu_bacteria | 2513237161 | 2514013123 | 149 |
| 85 | iso_pu_bacteria | 2517093001 | 2517106411 | 149 |
| 86 | iso_pu_bacteria | 2524023205 | 2524439432 | 149 |
| 87 | iso_pu_bacteria | 2524023210 | 2524466213 | 149 |
| 88 | iso_pu_bacteria | 2617270735 | 2617348171 | 149 |
| 89 | iso_pu_bacteria | 2643221733 | 2644732485 | 149 |
| 90 | iso_pu_bacteria | 2744054633 | 2745078143 | 149 |
| 91 | iso_pu_bacteria | 2791355196 | 2793064298 | 149 |
| 92 | iso_pu_bacteria | 2802429603 | 2805918904 | 149 |
| 93 | iso_pu_bacteria | 2816332527 | 2818242125 | 149 |
| 94 | iso_pu_bacteria | 2824600985 | 2824603156 | 149 |
| 95 | iso_pu_bacteria | 2824609381 | 2824613648 | 149 |
| 96 | iso_pu_bacteria | 2824653114 | 2824655961 | 149 |
| 97 | iso_pu_bacteria | 2824661429 | 2824664370 | 149 |
| 98 | iso_pu_bacteria | 2824671348 | 2824674635 | 149 |
| 99 | iso_pu_bacteria | 2824679649 | 2824683390 | 149 |
| 100 | iso_pu_bacteria | 2824687955 | 2824689389 | 149 |
| 101 | iso_pu_bacteria | 2824696289 | 2824699104 | 149 |
| 102 | iso_pu_bacteria | 2824773399 | 2824778677 | 149 |
| 103 | iso_pu_bacteria | 2838122688 | 2838126857 | 149 |
| 104 | iso_pu_bacteria | 2841941048 | 2841945670 | 149 |
| 105 | iso_pu_bacteria | 2841949485 | 2841954864 | 149 |
| 106 | iso_pu_bacteria | 2841957949 | 2841963289 | 149 |
| 107 | iso_pu_bacteria | 2841966195 | 2841972334 | 149 |
| 108 | iso_pu_bacteria | 2841974524 | 2841980416 | 149 |
| 109 | iso_pu_bacteria | 2841983080 | 2841988581 | 149 |
| 110 | iso_pu_bacteria | 2842038055 | 2842044883 | 149 |
| 111 | iso_pu_bacteria | 2842045827 | 2842052931 | 149 |
| 112 | iso_pu_bacteria | 2847939898 | 2847940165 | 149 |
| 113 | iso_pu_bacteria | 2849076700 | 2849077636 | 149 |
| 114 | iso_pu_bacteria | 2857509624 | 2857510864 | 149 |
| 115 | iso_pu_bacteria | 2874612657 | 2874618884 | 149 |
| 116 | iso_pu_bacteria | 2874628541 | 2874630729 | 149 |
| 117 | iso_pu_bacteria | 2876761206 | 2876761902 | 149 |
| 118 | iso_pu_bacteria | 2879099564 | 2879104795 | 149 |
| 119 | iso_pu_bacteria | 2881364244 | 2881364367 | 149 |
| 120 | iso_pu_bacteria | 2881665667 | 2881666727 | 149 |
| 121 | iso_pu_bacteria | 2885383462 | 2885384811 | 149 |
| 122 | iso_pu_bacteria | 2885409591 | 2885414658 | 149 |
| 123 | iso_pu_bacteria | 2888378607 | 2888386123 | 149 |
| 124 | iso_pu_bacteria | 2888388044 | 2888392154 | 149 |
| 125 | iso_pu_bacteria | 2888419890 | 2888426265 | 149 |
| 126 | iso_pu_bacteria | 2903768456 | 2903771324 | 149 |
| 127 | iso_pu_bacteria | 2906643746 | 2906645311 | 149 |
| 128 | iso_pu_bacteria | 2922368715 | 2922370431 | 149 |
| 129 | iso_pu_bacteria | 2922393267 | 2922399758 | 149 |
| 130 | iso_pu_bacteria | 2932809354 | 2932815329 | 149 |
| 131 | iso_pu_bacteria | 2932818245 | 2932824391 | 149 |
| 132 | iso_pu_bacteria | 2932828146 | 2932832209 | 149 |
| 133 | iso_pu_bacteria | 2935616580 | 2935622147 | 149 |
| 134 | iso_pu_bacteria | 2935638405 | 2935646405 | 149 |
| 135 | iso_pu_bacteria | 2935665750 | 2935669242 | 149 |
| 136 | iso_pu_bacteria | 2935675223 | 2935683199 | 149 |
| 137 | iso_pu_bacteria | 2935684952 | 2935692141 | 149 |
| 138 | iso_pu_bacteria | 2935694250 | 2935702454 | 149 |
| 139 | iso_pu_bacteria | 2935703347 | 2935708682 | 149 |
| 140 | iso_pu_bacteria | 2935713505 | 2935720620 | 149 |
| 141 | iso_pu_bacteria | 2935722832 | 2935729901 | 149 |
| 142 | iso_pu_bacteria | 2935732158 | 2935739116 | 149 |
| 143 | iso_pu_bacteria | 2935741537 | 2935748343 | 149 |
| 144 | iso_pu_bacteria | 2935750917 | 2935758545 | 149 |
| 145 | iso_pu_bacteria | 2935760218 | 2935766027 | 149 |
| 146 | iso_pu_bacteria | 2935777560 | 2935784496 | 149 |
| 147 | iso_pu_bacteria | 2935785616 | 2935787683 | 149 |
| 148 | iso_pu_bacteria | 2935793552 | 2935793760 | 149 |
| 149 | iso_pu_bacteria | 2935801545 | 2935805958 | 149 |
| 150 | iso_pu_bacteria | 2935810662 | 2935815482 | 149 |
| 151 | iso_pu_bacteria | 2935827899 | 2935835558 | 149 |
| 152 | iso_pu_bacteria | 2935837841 | 2935843335 | 149 |
| 153 | iso_pu_bacteria | 2935855204 | 2935860394 | 149 |
| 154 | iso_pu_bacteria | 2935864058 | 2935867792 | 149 |
| 155 | iso_pu_bacteria | 2935873716 | 2935878399 | 149 |
| 156 | iso_pu_bacteria | 2935959822 | 2935964841 | 149 |
| 157 | iso_pu_bacteria | 2935992306 | 2935998718 | 149 |
| 158 | iso_pu_bacteria | 2936002035 | 2936007023 | 149 |
| 159 | iso_pu_bacteria | 2936037263 | 2936040720 | 149 |
| 160 | iso_pu_bacteria | 2940556831 | 2940564449 | 149 |
| 161 | iso_pu_bacteria | 2941531003 | 2941536547 | 149 |
| 162 | iso_pu_bacteria | 2941538514 | 2941544881 | 149 |
| 163 | iso_pu_bacteria | 3005483717 | 3005485302 | 149 |
| 164 | iso_pu_bacteria | 3005594810 | 3005601036 | 149 |
| 165 | iso_pu_bacteria | 3005710791 | 3005716503 | 149 |
| 166 | iso_pu_bacteria | 8006926726 | 8006932991 | 149 |
| 167 | iso_pu_bacteria | 8016511872 | 8016519946 | 149 |
| 168 | iso_pu_bacteria | 8016530956 | 8016532960 | 149 |
| 169 | iso_pu_bacteria | 8016557553 | 8016564284 | 149 |
| 170 | iso_pu_bacteria | 8016566248 | 8016571273 | 149 |
| 171 | iso_pu_bacteria | 8016575299 | 8016583751 | 149 |
| 172 | iso_pu_bacteria | 8016595262 | 8016601972 | 149 |
| 173 | iso_pu_bacteria | 8016603502 | 8016608255 | 149 |
| 174 | iso_pu_bacteria | 8016613128 | 8016616613 | 149 |
| 175 | iso_pu_bacteria | 8017057580 | 8017065601 | 149 |
| 176 | iso_pu_bacteria | 8019530166 | 8019532758 | 149 |
| 177 | iso_pu_bacteria | 8019576017 | 8019585007 | 149 |
| 178 | iso_pu_bacteria | 8019586578 | 8019592967 | 149 |
| 179 | iso_pu_bacteria | 8019597564 | 8019598494 | 149 |
| 180 | iso_pu_bacteria | 8019608314 | 8019609881 | 149 |
| 181 | iso_pu_bacteria | 8056681323 | 8056687058 | 149 |
| 182 | iso_pu_bacteria | 8056967851 | 8056969270 | 149 |
| 183 | 3300044706 | Ga0466964_0354482 | Ga0466964_0354482_269_733 | 150 |
| 184 | 3300053146 | Ga0500588_0323879 | Ga0500588_0323879_100_552 | 150 |
| 185 | iso_pu_bacteria | 2595698237 | 2596374851 | 150 |
| 186 | iso_pu_bacteria | 2928125067 | 2928125562 | 150 |
| 187 | 3300005347 | Ga0070668_101912293 | Ga0070668_1019122931 | 151 |
| 188 | 3300005455 | Ga0070663_100864258 | Ga0070663_1008642582 | 151 |
| 189 | 3300005455 | Ga0070663_101258972 | Ga0070663_1012589721 | 151 |
| 190 | 3300005459 | Ga0068867_100590894 | Ga0068867_1005908942 | 151 |
| 191 | 3300014497 | Ga0182008_10302064 | Ga0182008_103020641 | 151 |
| 192 | 3300026118 | Ga0207675_100398490 | Ga0207675_1003984902 | 151 |
| 193 | 3300026142 | Ga0207698_12321642 | Ga0207698_123216421 | 151 |
| 194 | 3300044842 | Ga0466957_0065030 | Ga0466957_0065030_188_658 | 151 |
| 195 | 3300046507 | Ga0495606_0302646 | Ga0495606_0302646_380_835 | 151 |
| 196 | 3300046542 | Ga0495597_0160761 | Ga0495597_0160761_452_907 | 151 |
| 197 | 3300048917 | Ga0496114_0975142 | Ga0496114_0975142_24_491 | 151 |
| 198 | 3300048918 | Ga0496115_0327399 | Ga0496115_0327399_658_1125 | 151 |
| 199 | 3300003771 | Ga0055526_1000173 | Ga0055526_10001732 | 152 |
| 200 | 3300005435 | Ga0070714_100100248 | Ga0070714_1001002482 | 152 |
| 201 | 3300005436 | Ga0070713_100003456 | Ga0070713_10000345610 | 152 |
| 202 | 3300005530 | Ga0070679_101252965 | Ga0070679_1012529651 | 152 |
| 203 | 3300005535 | Ga0070684_100467275 | Ga0070684_1004672751 | 152 |
| 204 | 3300005614 | Ga0068856_100136993 | Ga0068856_1001369932 | 152 |
| 205 | 3300005616 | Ga0068852_100563397 | Ga0068852_1005633972 | 152 |
| 206 | 3300006028 | Ga0070717_10304191 | Ga0070717_103041912 | 152 |
| 207 | 3300009093 | Ga0105240_10020641 | Ga0105240_100206418 | 152 |
| 208 | 3300009545 | Ga0105237_10351814 | Ga0105237_103518142 | 152 |
| 209 | 3300013105 | Ga0157369_10009352 | Ga0157369_100093528 | 152 |
| 210 | 3300013307 | Ga0157372_10091432 | Ga0157372_100914322 | 152 |
| 211 | 3300025295 | Ga0209564_1000044 | Ga0209564_1000044157 | 152 |
| 212 | 3300025913 | Ga0207695_10019551 | Ga0207695_100195512 | 152 |
| 213 | 3300025914 | Ga0207671_10193140 | Ga0207671_101931402 | 152 |
| 214 | 3300025921 | Ga0207652_10773751 | Ga0207652_107737511 | 152 |
| 215 | 3300025928 | Ga0207700_10004852 | Ga0207700_100048526 | 152 |
| 216 | 3300025929 | Ga0207664_10078418 | Ga0207664_100784182 | 152 |
| 217 | 3300025944 | Ga0207661_10308980 | Ga0207661_103089802 | 152 |
| 218 | 3300025949 | Ga0207667_10202524 | Ga0207667_102025242 | 152 |
| 219 | 3300026078 | Ga0207702_10048849 | Ga0207702_100488492 | 152 |
| 220 | 3300026116 | Ga0207674_10287691 | Ga0207674_102876911 | 152 |
| 221 | 3300028379 | Ga0268266_10413922 | Ga0268266_104139222 | 152 |
| 222 | 3300033180 | Ga0307510_10020579 | Ga0307510_100205792 | 152 |
| 223 | 3300037418 | Ga0395900_0033307 | Ga0395900_0033307_918_1394 | 152 |
| 224 | 3300044694 | Ga0466963_0960950 | Ga0466963_0960950_99_566 | 152 |
| 225 | 3300045976 | Ga0466967_1372642 | Ga0466967_1372642_154_630 | 152 |
| 226 | 3300046460 | Ga0495638_0105506 | Ga0495638_0105506_817_1275 | 152 |
| 227 | 3300046524 | Ga0495648_0033175 | Ga0495648_0033175_342_800 | 152 |
| 228 | 3300046616 | Ga0495668_0222339 | Ga0495668_0222339_499_957 | 152 |
| 229 | 3300046660 | Ga0495625_0126219 | Ga0495625_0126219_187_645 | 152 |
| 230 | 3300046692 | Ga0495671_0271837 | Ga0495671_0271837_152_610 | 152 |
| 231 | 3300048917 | Ga0496114_0342206 | Ga0496114_0342206_94_576 | 152 |
| 232 | 3300048920 | Ga0496117_0055992 | Ga0496117_0055992_76_549 | 152 |
| 233 | 3300048921 | Ga0496118_0168438 | Ga0496118_0168438_168_641 | 152 |
| 234 | 3300048923 | Ga0496120_0224294 | Ga0496120_0224294_42_515 | 152 |
| 235 | 3300048924 | Ga0496121_0189658 | Ga0496121_0189658_985_1443 | 152 |
| 236 | 3300048929 | Ga0496126_0016467 | Ga0496126_0016467_2664_3128 | 152 |
| 237 | 3300048929 | Ga0496126_0132174 | Ga0496126_0132174_409_879 | 152 |
| 238 | 3300048929 | Ga0496126_0209061 | Ga0496126_0209061_499_957 | 152 |
| 239 | 3300049580 | Ga0501046_0136987 | Ga0501046_0136987_134_601 | 152 |
| 240 | 3300049581 | Ga0501047_0009182 | Ga0501047_0009182_7740_8207 | 152 |
| 241 | 3300049586 | Ga0501070_0098505 | Ga0501070_0098505_778_1245 | 152 |
| 242 | 3300049589 | Ga0501073_0513768 | Ga0501073_0513768_128_595 | 152 |
| 243 | 3300049742 | Ga0501080_0238726 | Ga0501080_0238726_1177_1644 | 152 |
| 244 | 3300049822 | Ga0501035_0190594 | Ga0501035_0190594_913_1380 | 152 |
| 245 | 3300049823 | Ga0501044_0192957 | Ga0501044_0192957_1267_1734 | 152 |
| 246 | 3300053104 | Ga0500556_0033572 | Ga0500556_0033572_1069_1527 | 152 |
| 247 | 3300053111 | Ga0500572_057420 | Ga0500572_057420_532_996 | 152 |
| 248 | 3300053126 | Ga0500621_201449 | Ga0500621_201449_232_690 | 152 |
| 249 | 3300053153 | Ga0500616_0034464 | Ga0500616_0034464_1558_2016 | 152 |
| 250 | 3300053156 | Ga0500622_0012726 | Ga0500622_0012726_592_1050 | 152 |
| 251 | 3300053736 | Ga0500599_002149 | Ga0500599_002149_1477_1935 | 152 |
| 252 | 3300003215 | JGI25153J46596_10000633 | JGI25153J46596_1000063319 | 153 |
| 253 | 3300003215 | JGI25153J46596_10000651 | JGI25153J46596_100006514 | 153 |
| 254 | 3300003215 | JGI25153J46596_10006525 | JGI25153J46596_100065254 | 153 |
| 255 | 3300003215 | JGI25153J46596_10011915 | JGI25153J46596_100119153 | 153 |
| 256 | 3300003320 | rootH2_10071434 | rootH2_100714342 | 153 |
| 257 | 3300003320 | rootH2_10142191 | rootH2_101421912 | 153 |
| 258 | 3300003323 | rootH1_10210164 | rootH1_102101642 | 153 |
| 259 | 3300003354 | JGI25160J50197_1003702 | JGI25160J50197_10037025 | 153 |
| 260 | 3300003354 | JGI25160J50197_1020379 | JGI25160J50197_10203792 | 153 |
| 261 | 3300003354 | JGI25160J50197_1034445 | JGI25160J50197_10344452 | 153 |
| 262 | 3300003354 | JGI25160J50197_1052554 | JGI25160J50197_10525542 | 153 |
| 263 | 3300003762 | Ga0055542_1012336 | Ga0055542_10123361 | 153 |
| 264 | 3300003771 | Ga0055526_1039695 | Ga0055526_10396951 | 153 |
| 265 | 3300003775 | Ga0055524_1007998 | Ga0055524_10079985 | 153 |
| 266 | 3300003775 | Ga0055524_1038238 | Ga0055524_10382382 | 153 |
| 267 | 3300003794 | Ga0055531_10012438 | Ga0055531_100124383 | 153 |
| 268 | 3300004625 | Ga0055543_1018854 | Ga0055543_10188542 | 153 |
| 269 | 3300005262 | Ga0065165_1000054 | Ga0065165_1000054114 | 153 |
| 270 | 3300005262 | Ga0065165_1001857 | Ga0065165_100185718 | 153 |
| 271 | 3300005262 | Ga0065165_1002497 | Ga0065165_10024974 | 153 |
| 272 | 3300005262 | Ga0065165_1012017 | Ga0065165_10120172 | 153 |
| 273 | 3300005262 | Ga0065165_1028496 | Ga0065165_10284962 | 153 |
| 274 | 3300005262 | Ga0065165_1146310 | Ga0065165_11463101 | 153 |
| 275 | 3300005327 | Ga0070658_10286870 | Ga0070658_102868702 | 153 |
| 276 | 3300005329 | Ga0070683_100016869 | Ga0070683_1000168692 | 153 |
| 277 | 3300005329 | Ga0070683_100057527 | Ga0070683_1000575274 | 153 |
| 278 | 3300005334 | Ga0068869_100629538 | Ga0068869_1006295382 | 153 |
| 279 | 3300005339 | Ga0070660_100356866 | Ga0070660_1003568662 | 153 |
| 280 | 3300005344 | Ga0070661_100496948 | Ga0070661_1004969481 | 153 |
| 281 | 3300005347 | Ga0070668_100067353 | Ga0070668_1000673531 | 153 |
| 282 | 3300005355 | Ga0070671_100664452 | Ga0070671_1006644522 | 153 |
| 283 | 3300005355 | Ga0070671_100671638 | Ga0070671_1006716382 | 153 |
| 284 | 3300005434 | Ga0070709_10001267 | Ga0070709_100012672 | 153 |
| 285 | 3300005435 | Ga0070714_100074581 | Ga0070714_1000745812 | 153 |
| 286 | 3300005436 | Ga0070713_100012930 | Ga0070713_1000129302 | 153 |
| 287 | 3300005437 | Ga0070710_10001610 | Ga0070710_100016106 | 153 |
| 288 | 3300005439 | Ga0070711_100002880 | Ga0070711_1000028804 | 153 |
| 289 | 3300005455 | Ga0070663_100028242 | Ga0070663_1000282421 | 153 |
| 290 | 3300005455 | Ga0070663_100205671 | Ga0070663_1002056711 | 153 |
| 291 | 3300005455 | Ga0070663_100303255 | Ga0070663_1003032552 | 153 |
| 292 | 3300005457 | Ga0070662_100116916 | Ga0070662_1001169162 | 153 |
| 293 | 3300005457 | Ga0070662_100957630 | Ga0070662_1009576301 | 153 |
| 294 | 3300005458 | Ga0070681_10490107 | Ga0070681_104901072 | 153 |
| 295 | 3300005458 | Ga0070681_10764613 | Ga0070681_107646132 | 153 |
| 296 | 3300005530 | Ga0070679_100644478 | Ga0070679_1006444781 | 153 |
| 297 | 3300005535 | Ga0070684_100119361 | Ga0070684_1001193611 | 153 |
| 298 | 3300005539 | Ga0068853_100094938 | Ga0068853_1000949382 | 153 |
| 299 | 3300005563 | Ga0068855_100406802 | Ga0068855_1004068022 | 153 |
| 300 | 3300005578 | Ga0068854_100182894 | Ga0068854_1001828942 | 153 |
| 301 | 3300005578 | Ga0068854_101294770 | Ga0068854_1012947702 | 153 |
| 302 | 3300005616 | Ga0068852_100004911 | Ga0068852_1000049118 | 153 |
| 303 | 3300005719 | Ga0068861_100482891 | Ga0068861_1004828912 | 153 |
| 304 | 3300005843 | Ga0068860_101160816 | Ga0068860_1011608162 | 153 |
| 305 | 3300005983 | Ga0081540_1024700 | Ga0081540_10247003 | 153 |
| 306 | 3300005983 | Ga0081540_1042065 | Ga0081540_10420652 | 153 |
| 307 | 3300006038 | Ga0075365_10112608 | Ga0075365_101126082 | 153 |
| 308 | 3300006038 | Ga0075365_10391558 | Ga0075365_103915581 | 153 |
| 309 | 3300006042 | Ga0075368_10012228 | Ga0075368_100122282 | 153 |
| 310 | 3300006048 | Ga0075363_100053622 | Ga0075363_1000536222 | 153 |
| 311 | 3300006051 | Ga0075364_10052421 | Ga0075364_100524212 | 153 |
| 312 | 3300006051 | Ga0075364_10231929 | Ga0075364_102319291 | 153 |
| 313 | 3300006051 | Ga0075364_10284209 | Ga0075364_102842092 | 153 |
| 314 | 3300006163 | Ga0070715_10300045 | Ga0070715_103000452 | 153 |
| 315 | 3300006173 | Ga0070716_100001907 | Ga0070716_1000019077 | 153 |
| 316 | 3300006177 | Ga0075362_10130019 | Ga0075362_101300192 | 153 |
| 317 | 3300006178 | Ga0075367_10019153 | Ga0075367_100191532 | 153 |
| 318 | 3300006186 | Ga0075369_10041495 | Ga0075369_100414952 | 153 |
| 319 | 3300006195 | Ga0075366_10008786 | Ga0075366_100087862 | 153 |
| 320 | 3300006353 | Ga0075370_10035459 | Ga0075370_100354592 | 153 |
| 321 | 3300006353 | Ga0075370_10077807 | Ga0075370_100778072 | 153 |
| 322 | 3300006353 | Ga0075370_10115486 | Ga0075370_101154862 | 153 |
| 323 | 3300006941 | Ga0099825_1035136 | Ga0099825_10351362 | 153 |
| 324 | 3300006942 | Ga0099824_1024667 | Ga0099824_10246673 | 153 |
| 325 | 3300006944 | Ga0099823_1035448 | Ga0099823_10354482 | 153 |
| 326 | 3300009093 | Ga0105240_10008853 | Ga0105240_100088535 | 153 |
| 327 | 3300009093 | Ga0105240_10529580 | Ga0105240_105295802 | 153 |
| 328 | 3300009098 | Ga0105245_10018245 | Ga0105245_100182455 | 153 |
| 329 | 3300009101 | Ga0105247_10240037 | Ga0105247_102400372 | 153 |
| 330 | 3300009101 | Ga0105247_11130622 | Ga0105247_111306221 | 153 |
| 331 | 3300009148 | Ga0105243_10163201 | Ga0105243_101632012 | 153 |
| 332 | 3300009174 | Ga0105241_10026075 | Ga0105241_100260753 | 153 |
| 333 | 3300009177 | Ga0105248_10174632 | Ga0105248_101746322 | 153 |
| 334 | 3300009177 | Ga0105248_11778212 | Ga0105248_117782122 | 153 |
| 335 | 3300009545 | Ga0105237_10000457 | Ga0105237_100004572 | 153 |
| 336 | 3300009545 | Ga0105237_10233149 | Ga0105237_102331492 | 153 |
| 337 | 3300009545 | Ga0105237_10299996 | Ga0105237_102999962 | 153 |
| 338 | 3300009551 | Ga0105238_10112481 | Ga0105238_101124812 | 153 |
| 339 | 3300009551 | Ga0105238_10246878 | Ga0105238_102468782 | 153 |
| 340 | 3300009553 | Ga0105249_11111616 | Ga0105249_111116162 | 153 |
| 341 | 3300010375 | Ga0105239_10039622 | Ga0105239_100396222 | 153 |
| 342 | 3300010375 | Ga0105239_10967885 | Ga0105239_109678852 | 153 |
| 343 | 3300011119 | Ga0105246_10663090 | Ga0105246_106630902 | 153 |
| 344 | 3300012503 | Ga0157313_1033209 | Ga0157313_10332091 | 153 |
| 345 | 3300013104 | Ga0157370_10255697 | Ga0157370_102556972 | 153 |
| 346 | 3300013104 | Ga0157370_11778291 | Ga0157370_117782911 | 153 |
| 347 | 3300013105 | Ga0157369_10007758 | Ga0157369_100077582 | 153 |
| 348 | 3300013105 | Ga0157369_11298813 | Ga0157369_112988132 | 153 |
| 349 | 3300013105 | Ga0157369_11712365 | Ga0157369_117123651 | 153 |
| 350 | 3300014969 | Ga0157376_10772014 | Ga0157376_107720142 | 153 |
| 351 | 3300017792 | Ga0163161_10857756 | Ga0163161_108577561 | 153 |
| 352 | 3300021377 | Ga0213874_10185445 | Ga0213874_101854452 | 153 |
| 353 | 3300021384 | Ga0213876_10101179 | Ga0213876_101011792 | 153 |
| 354 | 3300025230 | Ga0209563_108109 | Ga0209563_1081092 | 153 |
| 355 | 3300025245 | Ga0207425_1011633 | Ga0207425_10116332 | 153 |
| 356 | 3300025253 | Ga0209677_102436 | Ga0209677_1024362 | 153 |
| 357 | 3300025254 | Ga0209148_1000421 | Ga0209148_100042127 | 153 |
| 358 | 3300025254 | Ga0209148_1027802 | Ga0209148_10278022 | 153 |
| 359 | 3300025261 | Ga0209233_1002484 | Ga0209233_10024846 | 153 |
| 360 | 3300025261 | Ga0209233_1054776 | Ga0209233_10547761 | 153 |
| 361 | 3300025272 | Ga0209455_1002493 | Ga0209455_10024931 | 153 |
| 362 | 3300025272 | Ga0209455_1006416 | Ga0209455_10064163 | 153 |
| 363 | 3300025272 | Ga0209455_1026778 | Ga0209455_10267782 | 153 |
| 364 | 3300025273 | Ga0209673_1017159 | Ga0209673_10171592 | 153 |
| 365 | 3300025294 | Ga0209025_1068474 | Ga0209025_10684742 | 153 |
| 366 | 3300025295 | Ga0209564_1004705 | Ga0209564_10047058 | 153 |
| 367 | 3300025295 | Ga0209564_1014807 | Ga0209564_10148072 | 153 |
| 368 | 3300025297 | Ga0209758_1000117 | Ga0209758_100011747 | 153 |
| 369 | 3300025297 | Ga0209758_1000506 | Ga0209758_100050643 | 153 |
| 370 | 3300025297 | Ga0209758_1001068 | Ga0209758_100106813 | 153 |
| 371 | 3300025297 | Ga0209758_1001793 | Ga0209758_100179313 | 153 |
| 372 | 3300025297 | Ga0209758_1003491 | Ga0209758_10034918 | 153 |
| 373 | 3300025297 | Ga0209758_1007058 | Ga0209758_10070585 | 153 |
| 374 | 3300025297 | Ga0209758_1025207 | Ga0209758_10252072 | 153 |
| 375 | 3300025298 | Ga0209050_1103381 | Ga0209050_11033811 | 153 |
| 376 | 3300025299 | Ga0209256_1000740 | Ga0209256_100074036 | 153 |
| 377 | 3300025299 | Ga0209256_1007255 | Ga0209256_10072554 | 153 |
| 378 | 3300025299 | Ga0209256_1010920 | Ga0209256_10109203 | 153 |
| 379 | 3300025299 | Ga0209256_1052785 | Ga0209256_10527852 | 153 |
| 380 | 3300025302 | Ga0207426_1000467 | Ga0207426_100046753 | 153 |
| 381 | 3300025302 | Ga0207426_1000508 | Ga0207426_100050834 | 153 |
| 382 | 3300025302 | Ga0207426_1004734 | Ga0207426_10047342 | 153 |
| 383 | 3300025302 | Ga0207426_1004808 | Ga0207426_10048085 | 153 |
| 384 | 3300025302 | Ga0207426_1007596 | Ga0207426_10075962 | 153 |
| 385 | 3300025302 | Ga0207426_1028439 | Ga0207426_10284392 | 153 |
| 386 | 3300025304 | Ga0209257_1000158 | Ga0209257_1000158140 | 153 |
| 387 | 3300025304 | Ga0209257_1010490 | Ga0209257_10104902 | 153 |
| 388 | 3300025304 | Ga0209257_1024526 | Ga0209257_10245262 | 153 |
| 389 | 3300025898 | Ga0207692_10001796 | Ga0207692_100017962 | 153 |
| 390 | 3300025904 | Ga0207647_10049933 | Ga0207647_100499332 | 153 |
| 391 | 3300025904 | Ga0207647_10062038 | Ga0207647_100620382 | 153 |
| 392 | 3300025906 | Ga0207699_10000749 | Ga0207699_100007499 | 153 |
| 393 | 3300025909 | Ga0207705_10207755 | Ga0207705_102077552 | 153 |
| 394 | 3300025912 | Ga0207707_10387110 | Ga0207707_103871101 | 153 |
| 395 | 3300025912 | Ga0207707_10483173 | Ga0207707_104831732 | 153 |
| 396 | 3300025913 | Ga0207695_10000136 | Ga0207695_1000013656 | 153 |
| 397 | 3300025913 | Ga0207695_10588513 | Ga0207695_105885132 | 153 |
| 398 | 3300025914 | Ga0207671_10000202 | Ga0207671_1000020229 | 153 |
| 399 | 3300025914 | Ga0207671_10460633 | Ga0207671_104606332 | 153 |
| 400 | 3300025914 | Ga0207671_10739685 | Ga0207671_107396851 | 153 |
| 401 | 3300025916 | Ga0207663_10001805 | Ga0207663_100018054 | 153 |
| 402 | 3300025919 | Ga0207657_10327332 | Ga0207657_103273321 | 153 |
| 403 | 3300025920 | Ga0207649_10182781 | Ga0207649_101827812 | 153 |
| 404 | 3300025921 | Ga0207652_10096788 | Ga0207652_100967882 | 153 |
| 405 | 3300025924 | Ga0207694_10108605 | Ga0207694_101086052 | 153 |
| 406 | 3300025924 | Ga0207694_10423569 | Ga0207694_104235692 | 153 |
| 407 | 3300025924 | Ga0207694_10509732 | Ga0207694_105097321 | 153 |
| 408 | 3300025928 | Ga0207700_10230989 | Ga0207700_102309892 | 153 |
| 409 | 3300025929 | Ga0207664_10012842 | Ga0207664_100128422 | 153 |
| 410 | 3300025931 | Ga0207644_10345515 | Ga0207644_103455152 | 153 |
| 411 | 3300025932 | Ga0207690_10995139 | Ga0207690_109951392 | 153 |
| 412 | 3300025933 | Ga0207706_10239609 | Ga0207706_102396092 | 153 |
| 413 | 3300025938 | Ga0207704_11071255 | Ga0207704_110712552 | 153 |
| 414 | 3300025939 | Ga0207665_10002001 | Ga0207665_100020017 | 153 |
| 415 | 3300025940 | Ga0207691_10406959 | Ga0207691_104069592 | 153 |
| 416 | 3300025944 | Ga0207661_10009082 | Ga0207661_1000908210 | 153 |
| 417 | 3300025944 | Ga0207661_10013432 | Ga0207661_100134326 | 153 |
| 418 | 3300025945 | Ga0207679_10280192 | Ga0207679_102801922 | 153 |
| 419 | 3300025949 | Ga0207667_10680242 | Ga0207667_106802422 | 153 |
| 420 | 3300025949 | Ga0207667_11341324 | Ga0207667_113413241 | 153 |
| 421 | 3300025961 | Ga0207712_11504045 | Ga0207712_115040451 | 153 |
| 422 | 3300025981 | Ga0207640_10132607 | Ga0207640_101326072 | 153 |
| 423 | 3300025981 | Ga0207640_10598478 | Ga0207640_105984782 | 153 |
| 424 | 3300026035 | Ga0207703_10614328 | Ga0207703_106143282 | 153 |
| 425 | 3300026067 | Ga0207678_10142454 | Ga0207678_101424542 | 153 |
| 426 | 3300026067 | Ga0207678_10288099 | Ga0207678_102880992 | 153 |
| 427 | 3300026078 | Ga0207702_11329397 | Ga0207702_113293972 | 153 |
| 428 | 3300026089 | Ga0207648_10091226 | Ga0207648_100912262 | 153 |
| 429 | 3300026121 | Ga0207683_10201072 | Ga0207683_102010722 | 153 |
| 430 | 3300026142 | Ga0207698_10130247 | Ga0207698_101302472 | 153 |
| 431 | 3300027296 | Ga0209389_1000056 | Ga0209389_100005637 | 153 |
| 432 | 3300027296 | Ga0209389_1000206 | Ga0209389_100020631 | 153 |
| 433 | 3300027357 | Ga0209589_1000034 | Ga0209589_1000034111 | 153 |
| 434 | 3300027361 | Ga0209489_100009 | Ga0209489_10000973 | 153 |
| 435 | 3300027361 | Ga0209489_103071 | Ga0209489_10307120 | 153 |
| 436 | 3300027363 | Ga0209700_100471 | Ga0209700_10047115 | 153 |
| 437 | 3300028379 | Ga0268266_11116163 | Ga0268266_111161631 | 153 |
| 438 | 3300028380 | Ga0268265_11200562 | Ga0268265_112005622 | 153 |
| 439 | 3300028380 | Ga0268265_11312664 | Ga0268265_113126642 | 153 |
| 440 | 3300028381 | Ga0268264_10377387 | Ga0268264_103773872 | 153 |
| 441 | 3300028556 | Ga0265337_1011803 | Ga0265337_10118033 | 153 |
| 442 | 3300028563 | Ga0265319_1020457 | Ga0265319_10204572 | 153 |
| 443 | 3300028573 | Ga0265334_10019060 | Ga0265334_100190602 | 153 |
| 444 | 3300028653 | Ga0265323_10003447 | Ga0265323_100034472 | 153 |
| 445 | 3300028654 | Ga0265322_10010245 | Ga0265322_100102452 | 153 |
| 446 | 3300028666 | Ga0265336_10001603 | Ga0265336_100016038 | 153 |
| 447 | 3300028794 | Ga0307515_10356520 | Ga0307515_103565202 | 153 |
| 448 | 3300028800 | Ga0265338_10000119 | Ga0265338_10000119134 | 153 |
| 449 | 3300029957 | Ga0265324_10003043 | Ga0265324_100030435 | 153 |
| 450 | 3300031235 | Ga0265330_10013665 | Ga0265330_100136654 | 153 |
| 451 | 3300031247 | Ga0265340_10005088 | Ga0265340_100050882 | 153 |
| 452 | 3300031249 | Ga0265339_10104739 | Ga0265339_101047392 | 153 |
| 453 | 3300031344 | Ga0265316_10236920 | Ga0265316_102369202 | 153 |
| 454 | 3300031616 | Ga0307508_10000002 | Ga0307508_10000002354 | 153 |
| 455 | 3300031901 | Ga0307406_10072735 | Ga0307406_100727352 | 153 |
| 456 | 3300031995 | Ga0307409_100297943 | Ga0307409_1002979432 | 153 |
| 457 | 3300033180 | Ga0307510_10079893 | Ga0307510_100798932 | 153 |
| 458 | 3300033544 | Ga0316215_1003229 | Ga0316215_10032292 | 153 |
| 459 | 3300036459 | Ga0372808_022651 | Ga0372808_022651_303_779 | 153 |
| 460 | 3300037068 | Ga0373925_0232094 | Ga0373925_0232094_690_1151 | 153 |
| 461 | 3300037418 | Ga0395900_0003815 | Ga0395900_0003815_2681_3148 | 153 |
| 462 | 3300037466 | Ga0395898_0007171 | Ga0395898_0007171_5651_6124 | 153 |
| 463 | 3300037466 | Ga0395898_0022885 | Ga0395898_0022885_2325_2792 | 153 |
| 464 | 3300037471 | Ga0395905_0396858 | Ga0395905_0396858_294_761 | 153 |
| 465 | 3300037471 | Ga0395905_0431446 | Ga0395905_0431446_434_895 | 153 |
| 466 | 3300037853 | Ga0436364_0992294 | Ga0436364_0992294_534_1004 | 153 |
| 467 | 3300037853 | Ga0436364_1006809 | Ga0436364_1006809_474_947 | 153 |
| 468 | 3300038443 | Ga0395901_0017745 | Ga0395901_0017745_1172_1645 | 153 |
| 469 | 3300038443 | Ga0395901_0086930 | Ga0395901_0086930_1520_1987 | 153 |
| 470 | 3300039437 | Ga0436365_0328373 | Ga0436365_0328373_180_641 | 153 |
| 471 | 3300039437 | Ga0436365_0877926 | Ga0436365_0877926_271_741 | 153 |
| 472 | 3300039438 | Ga0436360_0048231 | Ga0436360_0048231_311_802 | 153 |
| 473 | 3300039438 | Ga0436360_0210980 | Ga0436360_0210980_158_646 | 153 |
| 474 | 3300039438 | Ga0436360_0517490 | Ga0436360_0517490_33_503 | 153 |
| 475 | 3300039447 | Ga0436361_0856172 | Ga0436361_0856172_1075_1545 | 153 |
| 476 | 3300039450 | Ga0436363_0369931 | Ga0436363_0369931_159_653 | 153 |
| 477 | 3300041456 | Ga0451795_0607088 | Ga0451795_0607088_125_586 | 153 |
| 478 | 3300041512 | Ga0451853_0276558 | Ga0451853_0276558_270_731 | 153 |
| 479 | 3300042005 | Ga0439448_0305875 | Ga0439448_0305875_38_499 | 153 |
| 480 | 3300042012 | Ga0439455_0061018 | Ga0439455_0061018_56_517 | 153 |
| 481 | 3300044656 | Ga0466969_0058336 | Ga0466969_0058336_242_703 | 153 |
| 482 | 3300044658 | Ga0466972_0064349 | Ga0466972_0064349_759_1220 | 153 |
| 483 | 3300044658 | Ga0466972_0530824 | Ga0466972_0530824_54_515 | 153 |
| 484 | 3300044683 | Ga0466965_0059710 | Ga0466965_0059710_730_1191 | 153 |
| 485 | 3300044684 | Ga0466966_0000101 | Ga0466966_0000101_2999_3460 | 153 |
| 486 | 3300044684 | Ga0466966_0097463 | Ga0466966_0097463_305_775 | 153 |
| 487 | 3300044693 | Ga0466961_0000031 | Ga0466961_0000031_40470_40931 | 153 |
| 488 | 3300044693 | Ga0466961_0180775 | Ga0466961_0180775_314_784 | 153 |
| 489 | 3300044694 | Ga0466963_0093654 | Ga0466963_0093654_1017_1478 | 153 |
| 490 | 3300044706 | Ga0466964_0021841 | Ga0466964_0021841_1668_2138 | 153 |
| 491 | 3300044706 | Ga0466964_0155474 | Ga0466964_0155474_148_609 | 153 |
| 492 | 3300044706 | Ga0466964_0299213 | Ga0466964_0299213_280_747 | 153 |
| 493 | 3300044719 | Ga0466971_0042632 | Ga0466971_0042632_1304_1765 | 153 |
| 494 | 3300044735 | Ga0466968_0006726 | Ga0466968_0006726_358_819 | 153 |
| 495 | 3300044765 | Ga0466970_0228919 | Ga0466970_0228919_524_994 | 153 |
| 496 | 3300044765 | Ga0466970_0297872 | Ga0466970_0297872_239_709 | 153 |
| 497 | 3300044765 | Ga0466970_0452917 | Ga0466970_0452917_97_567 | 153 |
| 498 | 3300044842 | Ga0466957_0066288 | Ga0466957_0066288_68_538 | 153 |
| 499 | 3300044842 | Ga0466957_0272704 | Ga0466957_0272704_589_1050 | 153 |
| 500 | 3300044901 | Ga0466960_0124246 | Ga0466960_0124246_230_691 | 153 |
| 501 | 3300045049 | Ga0466959_0002988 | Ga0466959_0002988_7296_7757 | 153 |
| 502 | 3300045049 | Ga0466959_0031213 | Ga0466959_0031213_2164_2634 | 153 |
| 503 | 3300045049 | Ga0466959_0057353 | Ga0466959_0057353_647_1117 | 153 |
| 504 | 3300045049 | Ga0466959_0070341 | Ga0466959_0070341_36_506 | 153 |
| 505 | 3300045836 | Ga0466958_0070371 | Ga0466958_0070371_1432_1893 | 153 |
| 506 | 3300045836 | Ga0466958_0150623 | Ga0466958_0150623_867_1337 | 153 |
| 507 | 3300045976 | Ga0466967_0203868 | Ga0466967_0203868_1135_1605 | 153 |
| 508 | 3300045976 | Ga0466967_0498506 | Ga0466967_0498506_344_808 | 153 |
| 509 | 3300045976 | Ga0466967_1056145 | Ga0466967_1056145_272_742 | 153 |
| 510 | 3300046452 | Ga0495617_108299 | Ga0495617_108299_180_641 | 153 |
| 511 | 3300046455 | Ga0495603_0202146 | Ga0495603_0202146_85_546 | 153 |
| 512 | 3300046459 | Ga0495629_0002586 | Ga0495629_0002586_6786_7247 | 153 |
| 513 | 3300046460 | Ga0495638_0126783 | Ga0495638_0126783_662_1135 | 153 |
| 514 | 3300046462 | Ga0495651_0167439 | Ga0495651_0167439_979_1440 | 153 |
| 515 | 3300046463 | Ga0495653_0060377 | Ga0495653_0060377_1206_1667 | 153 |
| 516 | 3300046474 | Ga0495605_0041048 | Ga0495605_0041048_490_951 | 153 |
| 517 | 3300046492 | Ga0495585_0068543 | Ga0495585_0068543_1044_1505 | 153 |
| 518 | 3300046499 | Ga0495594_0403405 | Ga0495594_0403405_149_610 | 153 |
| 519 | 3300046500 | Ga0495596_0131895 | Ga0495596_0131895_217_678 | 153 |
| 520 | 3300046511 | Ga0495608_0054448 | Ga0495608_0054448_533_994 | 153 |
| 521 | 3300046513 | Ga0495616_0099956 | Ga0495616_0099956_406_867 | 153 |
| 522 | 3300046513 | Ga0495616_0235884 | Ga0495616_0235884_179_640 | 153 |
| 523 | 3300046515 | Ga0495620_0092671 | Ga0495620_0092671_398_859 | 153 |
| 524 | 3300046520 | Ga0495637_0188466 | Ga0495637_0188466_254_736 | 153 |
| 525 | 3300046522 | Ga0495643_0014632 | Ga0495643_0014632_495_956 | 153 |
| 526 | 3300046524 | Ga0495648_0140871 | Ga0495648_0140871_380_841 | 153 |
| 527 | 3300046524 | Ga0495648_0366692 | Ga0495648_0366692_124_597 | 153 |
| 528 | 3300046528 | Ga0495642_0329594 | Ga0495642_0329594_74_535 | 153 |
| 529 | 3300046529 | Ga0495652_0008977 | Ga0495652_0008977_2041_2502 | 153 |
| 530 | 3300046533 | Ga0495640_0172724 | Ga0495640_0172724_64_525 | 153 |
| 531 | 3300046538 | Ga0495609_0084811 | Ga0495609_0084811_778_1239 | 153 |
| 532 | 3300046557 | Ga0495622_0026692 | Ga0495622_0026692_367_828 | 153 |
| 533 | 3300046557 | Ga0495622_0126479 | Ga0495622_0126479_98_559 | 153 |
| 534 | 3300046616 | Ga0495668_0079416 | Ga0495668_0079416_470_931 | 153 |
| 535 | 3300046616 | Ga0495668_0257753 | Ga0495668_0257753_113_580 | 153 |
| 536 | 3300046642 | Ga0495634_0068687 | Ga0495634_0068687_466_927 | 153 |
| 537 | 3300046648 | Ga0495611_0158863 | Ga0495611_0158863_571_1032 | 153 |
| 538 | 3300046660 | Ga0495625_0179116 | Ga0495625_0179116_218_679 | 153 |
| 539 | 3300046663 | Ga0495635_0031284 | Ga0495635_0031284_1036_1497 | 153 |
| 540 | 3300046665 | Ga0495661_0080164 | Ga0495661_0080164_1270_1731 | 153 |
| 541 | 3300046665 | Ga0495661_0335685 | Ga0495661_0335685_185_646 | 153 |
| 542 | 3300046674 | Ga0495588_0053235 | Ga0495588_0053235_547_1008 | 153 |
| 543 | 3300046674 | Ga0495588_0653229 | Ga0495588_0653229_64_525 | 153 |
| 544 | 3300046675 | Ga0495657_0013301 | Ga0495657_0013301_2888_3349 | 153 |
| 545 | 3300046680 | Ga0495646_0336735 | Ga0495646_0336735_268_729 | 153 |
| 546 | 3300046689 | Ga0495613_0049718 | Ga0495613_0049718_1406_1867 | 153 |
| 547 | 3300046690 | Ga0495624_0048352 | Ga0495624_0048352_2117_2578 | 153 |
| 548 | 3300046690 | Ga0495624_0418800 | Ga0495624_0418800_223_684 | 153 |
| 549 | 3300046691 | Ga0495670_0140923 | Ga0495670_0140923_430_891 | 153 |
| 550 | 3300046694 | Ga0495649_0119544 | Ga0495649_0119544_246_707 | 153 |
| 551 | 3300046694 | Ga0495649_0228765 | Ga0495649_0228765_336_797 | 153 |
| 552 | 3300047315 | Ga0495581_0061631 | Ga0495581_0061631_1091_1552 | 153 |
| 553 | 3300047320 | Ga0495672_0097648 | Ga0495672_0097648_99_572 | 153 |
| 554 | 3300047320 | Ga0495672_0184032 | Ga0495672_0184032_269_739 | 153 |
| 555 | 3300047320 | Ga0495672_0265729 | Ga0495672_0265729_343_816 | 153 |
| 556 | 3300047321 | Ga0495676_0052331 | Ga0495676_0052331_1611_2072 | 153 |
| 557 | 3300047323 | Ga0495683_0155259 | Ga0495683_0155259_82_543 | 153 |
| 558 | 3300047443 | Ga0495687_040179 | Ga0495687_040179_1454_1915 | 153 |
| 559 | 3300047469 | Ga0495673_0030706 | Ga0495673_0030706_1343_1804 | 153 |
| 560 | 3300047472 | Ga0495686_0090430 | Ga0495686_0090430_1084_1554 | 153 |
| 561 | 3300047472 | Ga0495686_0325725 | Ga0495686_0325725_283_744 | 153 |
| 562 | 3300047472 | Ga0495686_0436442 | Ga0495686_0436442_109_582 | 153 |
| 563 | 3300047673 | Ga0495593_0079090 | Ga0495593_0079090_1157_1618 | 153 |
| 564 | 3300048903 | Ga0496100_0073149 | Ga0496100_0073149_1243_1704 | 153 |
| 565 | 3300048903 | Ga0496100_0625779 | Ga0496100_0625779_208_669 | 153 |
| 566 | 3300048903 | Ga0496100_0766154 | Ga0496100_0766154_240_701 | 153 |
| 567 | 3300048904 | Ga0496101_0141782 | Ga0496101_0141782_1064_1525 | 153 |
| 568 | 3300048905 | Ga0496102_0799958 | Ga0496102_0799958_91_552 | 153 |
| 569 | 3300048906 | Ga0496103_0076550 | Ga0496103_0076550_516_977 | 153 |
| 570 | 3300048907 | Ga0496104_0001655 | Ga0496104_0001655_6969_7430 | 153 |
| 571 | 3300048907 | Ga0496104_0158818 | Ga0496104_0158818_155_616 | 153 |
| 572 | 3300048907 | Ga0496104_0165528 | Ga0496104_0165528_1273_1734 | 153 |
| 573 | 3300048908 | Ga0496105_0015424 | Ga0496105_0015424_3142_3603 | 153 |
| 574 | 3300048908 | Ga0496105_0116057 | Ga0496105_0116057_755_1216 | 153 |
| 575 | 3300048909 | Ga0496106_0181806 | Ga0496106_0181806_619_1080 | 153 |
| 576 | 3300048910 | Ga0496107_0072888 | Ga0496107_0072888_1887_2348 | 153 |
| 577 | 3300048913 | Ga0496110_1007957 | Ga0496110_1007957_122_583 | 153 |
| 578 | 3300048914 | Ga0496111_1254508 | Ga0496111_1254508_16_477 | 153 |
| 579 | 3300048915 | Ga0496112_0081338 | Ga0496112_0081338_117_578 | 153 |
| 580 | 3300048916 | Ga0496113_0050256 | Ga0496113_0050256_133_594 | 153 |
| 581 | 3300048916 | Ga0496113_0162699 | Ga0496113_0162699_128_589 | 153 |
| 582 | 3300048917 | Ga0496114_0150263 | Ga0496114_0150263_1417_1878 | 153 |
| 583 | 3300048918 | Ga0496115_0027286 | Ga0496115_0027286_2770_3231 | 153 |
| 584 | 3300048919 | Ga0496116_0009012 | Ga0496116_0009012_3391_3852 | 153 |
| 585 | 3300048919 | Ga0496116_0392700 | Ga0496116_0392700_133_606 | 153 |
| 586 | 3300048920 | Ga0496117_0060417 | Ga0496117_0060417_1291_1764 | 153 |
| 587 | 3300048920 | Ga0496117_0226669 | Ga0496117_0226669_312_773 | 153 |
| 588 | 3300048921 | Ga0496118_0039981 | Ga0496118_0039981_3208_3669 | 153 |
| 589 | 3300048921 | Ga0496118_0061946 | Ga0496118_0061946_1879_2340 | 153 |
| 590 | 3300048922 | Ga0496119_0007977 | Ga0496119_0007977_7571_8032 | 153 |
| 591 | 3300048922 | Ga0496119_0244252 | Ga0496119_0244252_330_803 | 153 |
| 592 | 3300048922 | Ga0496119_0393461 | Ga0496119_0393461_100_561 | 153 |
| 593 | 3300048923 | Ga0496120_0003849 | Ga0496120_0003849_8166_8627 | 153 |
| 594 | 3300048924 | Ga0496121_0013561 | Ga0496121_0013561_7396_7869 | 153 |
| 595 | 3300048924 | Ga0496121_0021475 | Ga0496121_0021475_5528_6001 | 153 |
| 596 | 3300048924 | Ga0496121_0049950 | Ga0496121_0049950_2455_2916 | 153 |
| 597 | 3300048924 | Ga0496121_0069873 | Ga0496121_0069873_218_679 | 153 |
| 598 | 3300048924 | Ga0496121_0072664 | Ga0496121_0072664_758_1219 | 153 |
| 599 | 3300048924 | Ga0496121_0181866 | Ga0496121_0181866_219_680 | 153 |
| 600 | 3300048924 | Ga0496121_0362266 | Ga0496121_0362266_370_840 | 153 |
| 601 | 3300048925 | Ga0496122_0021585 | Ga0496122_0021585_2146_2628 | 153 |
| 602 | 3300048925 | Ga0496122_0320772 | Ga0496122_0320772_285_770 | 153 |
| 603 | 3300048926 | Ga0496123_0033056 | Ga0496123_0033056_2125_2607 | 153 |
| 604 | 3300048928 | Ga0496125_0058251 | Ga0496125_0058251_1398_1859 | 153 |
| 605 | 3300048929 | Ga0496126_0002980 | Ga0496126_0002980_11710_12180 | 153 |
| 606 | 3300048929 | Ga0496126_0030510 | Ga0496126_0030510_515_1006 | 153 |
| 607 | 3300048929 | Ga0496126_0073851 | Ga0496126_0073851_794_1255 | 153 |
| 608 | 3300048929 | Ga0496126_0109054 | Ga0496126_0109054_596_1057 | 153 |
| 609 | 3300048929 | Ga0496126_0145281 | Ga0496126_0145281_566_1027 | 153 |
| 610 | 3300048929 | Ga0496126_0258787 | Ga0496126_0258787_859_1320 | 153 |
| 611 | 3300048929 | Ga0496126_0331349 | Ga0496126_0331349_523_984 | 153 |
| 612 | 3300048929 | Ga0496126_0459310 | Ga0496126_0459310_296_766 | 153 |
| 613 | 3300049568 | Ga0501031_0006422 | Ga0501031_0006422_448_921 | 153 |
| 614 | 3300049569 | Ga0501032_0000040 | Ga0501032_0000040_67681_68154 | 153 |
| 615 | 3300049570 | Ga0501033_0000128 | Ga0501033_0000128_69855_70328 | 153 |
| 616 | 3300049570 | Ga0501033_0134409 | Ga0501033_0134409_553_1026 | 153 |
| 617 | 3300049571 | Ga0501034_0000254 | Ga0501034_0000254_35421_35894 | 153 |
| 618 | 3300049571 | Ga0501034_0374992 | Ga0501034_0374992_339_812 | 153 |
| 619 | 3300049572 | Ga0501036_0000375 | Ga0501036_0000375_3092_3565 | 153 |
| 620 | 3300049572 | Ga0501036_0240258 | Ga0501036_0240258_963_1436 | 153 |
| 621 | 3300049573 | Ga0501037_0000041 | Ga0501037_0000041_67581_68054 | 153 |
| 622 | 3300049574 | Ga0501038_0000057 | Ga0501038_0000057_43869_44342 | 153 |
| 623 | 3300049575 | Ga0501039_0000084 | Ga0501039_0000084_41714_42187 | 153 |
| 624 | 3300049579 | Ga0501043_0000184 | Ga0501043_0000184_41313_41786 | 153 |
| 625 | 3300049579 | Ga0501043_0311063 | Ga0501043_0311063_607_1080 | 153 |
| 626 | 3300049580 | Ga0501046_0000072 | Ga0501046_0000072_38230_38703 | 153 |
| 627 | 3300049581 | Ga0501047_0000044 | Ga0501047_0000044_67663_68136 | 153 |
| 628 | 3300049581 | Ga0501047_0098684 | Ga0501047_0098684_1170_1643 | 153 |
| 629 | 3300049582 | Ga0501048_0000295 | Ga0501048_0000295_6522_6995 | 153 |
| 630 | 3300049583 | Ga0501067_0004567 | Ga0501067_0004567_337_810 | 153 |
| 631 | 3300049584 | Ga0501068_0000113 | Ga0501068_0000113_7100_7573 | 153 |
| 632 | 3300049586 | Ga0501070_0000310 | Ga0501070_0000310_15808_16281 | 153 |
| 633 | 3300049586 | Ga0501070_0170589 | Ga0501070_0170589_181_657 | 153 |
| 634 | 3300049587 | Ga0501071_0082831 | Ga0501071_0082831_924_1397 | 153 |
| 635 | 3300049589 | Ga0501073_0000043 | Ga0501073_0000043_25351_25824 | 153 |
| 636 | 3300049590 | Ga0501074_0000035 | Ga0501074_0000035_3569_4042 | 153 |
| 637 | 3300049741 | Ga0501079_0000839 | Ga0501079_0000839_6508_6981 | 153 |
| 638 | 3300049742 | Ga0501080_0000600 | Ga0501080_0000600_1100_1573 | 153 |
| 639 | 3300049822 | Ga0501035_0000128 | Ga0501035_0000128_31665_32138 | 153 |
| 640 | 3300049822 | Ga0501035_0168456 | Ga0501035_0168456_481_954 | 153 |
| 641 | 3300049823 | Ga0501044_0000108 | Ga0501044_0000108_884_1357 | 153 |
| 642 | 3300049823 | Ga0501044_0168054 | Ga0501044_0168054_768_1241 | 153 |
| 643 | 3300050490 | nmdc:mga03n38_72610_c1 | nmdc:mga03n38_72610_c1_520_981 | 153 |
| 644 | 3300050491 | nmdc:mga00v17_120618_c1 | nmdc:mga00v17_120618_c1_1117_1626 | 153 |
| 645 | 3300050491 | nmdc:mga00v17_84895_c1 | nmdc:mga00v17_84895_c1_321_782 | 153 |
| 646 | 3300050492 | nmdc:mga0yw44_17645_c1 | nmdc:mga0yw44_17645_c1_1934_2395 | 153 |
| 647 | 3300050492 | nmdc:mga0yw44_181061_c1 | nmdc:mga0yw44_181061_c1_409_870 | 153 |
| 648 | 3300050492 | nmdc:mga0yw44_3454_c1 | nmdc:mga0yw44_3454_c1_1915_2376 | 153 |
| 649 | 3300050493 | nmdc:mga0k408_11705_c1 | nmdc:mga0k408_11705_c1_2858_3319 | 153 |
| 650 | 3300050494 | nmdc:mga06z11_36518_c1 | nmdc:mga06z11_36518_c1_1806_2267 | 153 |
| 651 | 3300050494 | nmdc:mga06z11_84947_c1 | nmdc:mga06z11_84947_c1_1013_1474 | 153 |
| 652 | 3300050495 | nmdc:mga04h51_243680_c1 | nmdc:mga04h51_243680_c1_30_491 | 153 |
| 653 | 3300050496 | nmdc:mga07m45_70978_c1 | nmdc:mga07m45_70978_c1_1268_1729 | 153 |
| 654 | 3300050516 | nmdc:mga0sz30_19353_c1 | nmdc:mga0sz30_19353_c1_1834_2295 | 153 |
| 655 | 3300053079 | Ga0500610_0089377 | Ga0500610_0089377_603_1064 | 153 |
| 656 | 3300053086 | Ga0500578_0088963 | Ga0500578_0088963_649_1122 | 153 |
| 657 | 3300053086 | Ga0500578_0174854 | Ga0500578_0174854_339_821 | 153 |
| 658 | 3300053087 | Ga0500643_000095 | Ga0500643_000095_53079_53540 | 153 |
| 659 | 3300053091 | Ga0500647_0069478 | Ga0500647_0069478_707_1168 | 153 |
| 660 | 3300053092 | Ga0500583_0128213 | Ga0500583_0128213_300_773 | 153 |
| 661 | 3300053093 | Ga0500651_0001437 | Ga0500651_0001437_3881_4354 | 153 |
| 662 | 3300053093 | Ga0500651_0071348 | Ga0500651_0071348_792_1253 | 153 |
| 663 | 3300053094 | Ga0500566_0000123 | Ga0500566_0000123_16331_16792 | 153 |
| 664 | 3300053094 | Ga0500566_0129947 | Ga0500566_0129947_602_1063 | 153 |
| 665 | 3300053105 | Ga0500557_000036 | Ga0500557_000036_48915_49376 | 153 |
| 666 | 3300053111 | Ga0500572_000007 | Ga0500572_000007_2741_3217 | 153 |
| 667 | 3300053111 | Ga0500572_036657 | Ga0500572_036657_902_1363 | 153 |
| 668 | 3300053118 | Ga0500594_0005223 | Ga0500594_0005223_799_1272 | 153 |
| 669 | 3300053119 | Ga0500595_000839 | Ga0500595_000839_1170_1643 | 153 |
| 670 | 3300053119 | Ga0500595_001859 | Ga0500595_001859_3565_4038 | 153 |
| 671 | 3300053119 | Ga0500595_006961 | Ga0500595_006961_3310_3783 | 153 |
| 672 | 3300053119 | Ga0500595_041418 | Ga0500595_041418_915_1376 | 153 |
| 673 | 3300053121 | Ga0500607_181938 | Ga0500607_181938_378_839 | 153 |
| 674 | 3300053122 | Ga0500608_012042 | Ga0500608_012042_2008_2469 | 153 |
| 675 | 3300053130 | Ga0500642_0000103 | Ga0500642_0000103_13900_14361 | 153 |
| 676 | 3300053130 | Ga0500642_0001828 | Ga0500642_0001828_90_563 | 153 |
| 677 | 3300053130 | Ga0500642_0101505 | Ga0500642_0101505_428_889 | 153 |
| 678 | 3300053133 | Ga0500655_010875 | Ga0500655_010875_858_1319 | 153 |
| 679 | 3300053136 | Ga0500559_0000725 | Ga0500559_0000725_20026_20502 | 153 |
| 680 | 3300053138 | Ga0500564_054697 | Ga0500564_054697_477_938 | 153 |
| 681 | 3300053139 | Ga0500568_0053111 | Ga0500568_0053111_316_777 | 153 |
| 682 | 3300053139 | Ga0500568_0072323 | Ga0500568_0072323_244_717 | 153 |
| 683 | 3300053146 | Ga0500588_0109433 | Ga0500588_0109433_191_664 | 153 |
| 684 | 3300053148 | Ga0500590_040973 | Ga0500590_040973_1083_1544 | 153 |
| 685 | 3300053148 | Ga0500590_080638 | Ga0500590_080638_33_494 | 153 |
| 686 | 3300053151 | Ga0500604_0029379 | Ga0500604_0029379_194_655 | 153 |
| 687 | 3300053151 | Ga0500604_0079330 | Ga0500604_0079330_235_708 | 153 |
| 688 | 3300053154 | Ga0500619_098566 | Ga0500619_098566_70_531 | 153 |
| 689 | 3300053157 | Ga0500624_007628 | Ga0500624_007628_694_1155 | 153 |
| 690 | 3300053158 | Ga0500627_0032148 | Ga0500627_0032148_1027_1488 | 153 |
| 691 | 3300053163 | Ga0500639_019994 | Ga0500639_019994_2337_2813 | 153 |
| 692 | 3300053177 | Ga0500636_0000807 | Ga0500636_0000807_15261_15722 | 153 |
| 693 | 3300053729 | Ga0500625_000325 | Ga0500625_000325_11260_11721 | 153 |
| 694 | 3300053730 | Ga0500645_061521 | Ga0500645_061521_430_891 | 153 |
| 695 | 3300053731 | Ga0500609_028446 | Ga0500609_028446_195_656 | 153 |
| 696 | 3300053733 | Ga0500552_003879 | Ga0500552_003879_648_1109 | 153 |
| 697 | 3300053735 | Ga0500596_036145 | Ga0500596_036145_102_563 | 153 |
| 698 | 3300053737 | Ga0500601_000390 | Ga0500601_000390_6419_6880 | 153 |
| 699 | 3300054114 | Ga0501084_0195524 | Ga0501084_0195524_258_731 | 153 |
| 700 | 3300055283 | Ga0500661_010231 | Ga0500661_010231_939_1400 | 153 |
| 701 | 3300060353 | Ga0501082_0005614 | Ga0501082_0005614_2098_2571 | 153 |
| 702 | 3300061719 | Ga0466962_0211067 | Ga0466962_0211067_256_726 | 153 |
| 703 | 3300061719 | Ga0466962_0226512 | Ga0466962_0226512_341_802 | 153 |
| 704 | 3300061719 | Ga0466962_0570726 | Ga0466962_0570726_64_534 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jpb-assembly1.cif.gz_W | the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. | 0.8658 | 11 | 152 |
| 2qdl-assembly2.cif.gz_B | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.8592 | 12 | 151 |
| 1b3q-assembly1.cif.gz_B | crystal structure of chea-289, a signal transducing histidine kinase | 0.8348 | 12 | 148 |
| 3ja6-assembly1.cif.gz_F | cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling | 0.8342 | 12 | 152 |
| 2ho9-assembly1.cif.gz_A | solution structure of chemotaxi protein chew from escherichia coli | 0.832 | 8 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IXI1_282_473_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.869 | 85 | 101 | 1.10.238.10 |
| af_Q8IMX7_308_504_1.10.238.10 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand | 0.8672 | 85 | 101 | 1.10.238.10 |
| 2ch4W02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.7986 | 33 | 104 | 2.40.50.180 |
| 2ch4A02 | Mainly Beta;Roll;SH3 type barrels.;SH3 Domains | 0.7963 | 13 | 148 | 2.30.30.40 |
| 1b3qA04 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.7918 | 34 | 103 | 2.40.50.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A147I783-F1-model_v4 | Chemotaxis protein CheW | 0.9619 | 13 | 152 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A3Q9IPZ2-F1-model_v4 | Chemotaxis protein CheW | 0.9447 | 11 | 152 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A1Y5R7R6-F1-model_v4 | Chemotaxis protein CheW | 0.933 | 7 | 151 |
GO:0005829
GO:0006935 GO:0007165 |
| AF-A0A2E6UDM5-F1-model_v4 | deleted | 0.9313 | 12 | 153 |
|
| AF-K6DQV2-F1-model_v4 | Chemotaxis protein CheA (EC 2.7.13.3) | 0.9272 | 12 | 153 |
GO:0000155
GO:0005524 GO:0005737 GO:0006935 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar