F476333

General Info

Members Datasets Scaffolds Average Seq Length
704 236 1408 161

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100573882|Ga0068869_1005738822
Length 179
Sequence VVSTTTNSRALPTRGSGRVPAARLRLTALAGMAVLLGGCSGLHVSPLAPPPYQVEVAARYDAAWSALVRALARENVPIRAIARDSGVIASDDFIAPIGVYADCGRVGGELVEGEALVAFTLFAEPNGTWTRVLVNSKMRTHMQRKGSSGKLRPMPVYQCASTGRFEANLLDAVRELVKE

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
156 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
172 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
176 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
177 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
210 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
218 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.85
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 19.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100573882 3300005334 Unclassified 950
2 JGI26141J51220_1000198 3300003503 Bacteria 3178
3 Ga0065715_10274615 3300005293 Bacteria 1102
4 Ga0065707_10150645 3300005295 Bacteria 1662
5 Ga0070676_10000427 3300005328 Bacteria 19946
6 Ga0070676_10116002 3300005328 Unclassified 1674
7 Ga0070676_10580017 3300005328 Unclassified 806
8 Ga0070690_100020675 3300005330 Bacteria 4011
9 Ga0070690_100156567 3300005330 Bacteria 1558
10 Ga0070670_100039023 3300005331 Bacteria 4083
11 Ga0068869_100002472 3300005334 Bacteria 11149
12 Ga0068869_100931955 3300005334 Unclassified 753
13 Ga0070666_10190398 3300005335 Bacteria 1441
14 Ga0070680_100000568 3300005336 Bacteria 25347
15 Ga0070680_100430646 3300005336 Unclassified 1126
16 Ga0070682_100000700 3300005337 Bacteria 20170
17 Ga0068868_100231574 3300005338 Bacteria 1550
18 Ga0070660_100000101 3300005339 Bacteria 52337
19 Ga0070689_100685240 3300005340 Bacteria 894
20 Ga0070691_10197692 3300005341 Bacteria 1055
21 Ga0070691_10281709 3300005341 Unclassified 902
22 Ga0070691_10472904 3300005341 Bacteria 720
23 Ga0070687_100060320 3300005343 Bacteria 2000
24 Ga0070687_100503069 3300005343 Bacteria 816
25 Ga0070661_100048938 3300005344 Bacteria 3095
26 Ga0070692_10000220 3300005345 Bacteria 15611
27 Ga0070692_10628277 3300005345 Unclassified 714
28 Ga0070668_100341157 3300005347 Bacteria 1266
29 Ga0070668_100857192 3300005347 Bacteria 810
30 Ga0070669_100928921 3300005353 Bacteria 744
31 Ga0070673_100015384 3300005364 Bacteria 5373
32 Ga0070659_100002337 3300005366 Bacteria 13492
33 Ga0070703_10012675 3300005406 Bacteria 2389
34 Ga0070703_10048993 3300005406 Bacteria 1343
35 Ga0070703_10275564 3300005406 Unclassified 692
36 Ga0070709_10349565 3300005434 Bacteria 1092
37 Ga0070701_10037527 3300005438 Bacteria 2447
38 Ga0070701_10308088 3300005438 Unclassified 976
39 Ga0070711_100795492 3300005439 Bacteria 802
40 Ga0070705_100003111 3300005440 Bacteria 8160
41 Ga0070705_100023736 3300005440 Bacteria 3299
42 Ga0070705_100113411 3300005440 Bacteria 1737
43 Ga0070705_100176398 3300005440 Bacteria 1443
44 Ga0070705_100768380 3300005440 Unclassified 763
45 Ga0070700_100139784 3300005441 Unclassified 1644
46 Ga0070694_100006751 3300005444 Bacteria 6970
47 Ga0070694_100031699 3300005444 Bacteria 3466
48 Ga0070694_100091683 3300005444 Bacteria 2133
49 Ga0070694_100130690 3300005444 Unclassified 1813
50 Ga0070694_100545412 3300005444 Unclassified 928
51 Ga0070708_100006068 3300005445 Bacteria 9610
52 Ga0070708_100006507 3300005445 Bacteria 9295
53 Ga0070708_100073757 3300005445 Bacteria 3076
54 Ga0070708_100087157 3300005445 Bacteria 2837
55 Ga0070708_100099831 3300005445 Bacteria 2656
56 Ga0070708_100134439 3300005445 Bacteria 2290
57 Ga0070708_100135083 3300005445 Bacteria 2284
58 Ga0070708_100258272 3300005445 Bacteria 1637
59 Ga0070708_100304866 3300005445 Bacteria 1500
60 Ga0070708_100511760 3300005445 Bacteria 1132
61 Ga0070663_100281233 3300005455 Bacteria 1326
62 Ga0070663_100314584 3300005455 Bacteria 1257
63 Ga0070662_100003056 3300005457 Bacteria 10389
64 Ga0070662_100110817 3300005457 Bacteria 2091
65 Ga0070662_100236313 3300005457 Bacteria 1464
66 Ga0070662_100440349 3300005457 Unclassified 1080
67 Ga0070681_10009774 3300005458 Bacteria 9438
68 Ga0070681_10279625 3300005458 Unclassified 1580
69 Ga0068867_100731507 3300005459 Unclassified 876
70 Ga0068867_101350471 3300005459 Unclassified 659
71 Ga0070706_100002601 3300005467 Bacteria 18092
72 Ga0070706_100006322 3300005467 Bacteria 11193
73 Ga0070706_100017157 3300005467 Bacteria 6688
74 Ga0070706_100061390 3300005467 Bacteria 3471
75 Ga0070706_100081072 3300005467 Bacteria 3005
76 Ga0070706_100098465 3300005467 Plasmid 2717
77 Ga0070706_100133692 3300005467 Bacteria 2315
78 Ga0070706_100362574 3300005467 Bacteria 1350
79 Ga0070706_100374037 3300005467 Bacteria 1327
80 Ga0070706_100427214 3300005467 Bacteria 1233
81 Ga0070706_100751805 3300005467 Bacteria 903
82 Ga0070706_100754627 3300005467 Unclassified 901
83 Ga0070706_100866830 3300005467 Bacteria 835
84 Ga0070707_100005734 3300005468 Bacteria 11584
85 Ga0070707_100011887 3300005468 Bacteria 8125
86 Ga0070707_100018063 3300005468 Bacteria 6634
87 Ga0070707_100045085 3300005468 Bacteria 4220
88 Ga0070707_100047505 3300005468 Bacteria 4109
89 Ga0070707_100064162 3300005468 Plasmid 3526
90 Ga0070707_100098161 3300005468 Bacteria 2837
91 Ga0070707_100190722 3300005468 Bacteria 1998
92 Ga0070707_100196509 3300005468 Bacteria 1966
93 Ga0070707_100370472 3300005468 Bacteria 1391
94 Ga0070707_100838300 3300005468 Bacteria 883
95 Ga0070707_101234921 3300005468 Bacteria 713
96 Ga0070707_101593189 3300005468 Unclassified 620
97 Ga0070698_100011572 3300005471 Bacteria 9362
98 Ga0070698_100017069 3300005471 Bacteria 7654
99 Ga0070698_100090233 3300005471 Bacteria 3048
100 Ga0070698_100131472 3300005471 Unclassified 2458
101 Ga0070698_100163998 3300005471 Bacteria 2165
102 Ga0070698_100187612 3300005471 Bacteria 2005
103 Ga0070698_100204902 3300005471 Bacteria 1908
104 Ga0070698_100457206 3300005471 Bacteria 1212
105 Ga0070698_100561473 3300005471 Bacteria 1081
106 Ga0070698_101189693 3300005471 Bacteria 711
107 Ga0070699_100001744 3300005518 Bacteria 19865
108 Ga0070699_100003803 3300005518 Bacteria 13341
109 Ga0070699_100008044 3300005518 Bacteria 9155
110 Ga0070699_100026181 3300005518 Bacteria 5031
111 Ga0070699_100072054 3300005518 Bacteria 3005
112 Ga0070699_100128348 3300005518 Bacteria 2234
113 Ga0070699_100144300 3300005518 Bacteria 2103
114 Ga0070699_100145838 3300005518 Unclassified 2091
115 Ga0070699_100163042 3300005518 Bacteria 1973
116 Ga0070699_100190774 3300005518 Bacteria 1820
117 Ga0070699_100429295 3300005518 Bacteria 1197
118 Ga0070699_101126453 3300005518 Bacteria 720
119 Ga0070679_100000816 3300005530 Bacteria 27011
120 Ga0070684_100048192 3300005535 Bacteria 3696
121 Ga0070697_100009975 3300005536 Bacteria 7412
122 Ga0070697_100038624 3300005536 Plasmid 3858
123 Ga0070697_100067928 3300005536 Bacteria 2917
124 Ga0070697_100075394 3300005536 Bacteria 2772
125 Ga0070697_100110264 3300005536 Bacteria 2292
126 Ga0070697_100110501 3300005536 Bacteria 2290
127 Ga0070697_100243646 3300005536 Bacteria 1536
128 Ga0070697_100446249 3300005536 Bacteria 1127
129 Ga0070697_100538171 3300005536 Bacteria 1023
130 Ga0070697_100588213 3300005536 Unclassified 978
131 Ga0070697_100874404 3300005536 Bacteria 797
132 Ga0070697_100933172 3300005536 Unclassified 770
133 Ga0068853_100002651 3300005539 Bacteria 13494
134 Ga0068853_100776840 3300005539 Unclassified 916
135 Ga0070672_100045809 3300005543 Bacteria 3386
136 Ga0070672_100578977 3300005543 Bacteria 976
137 Ga0070695_100001364 3300005545 Bacteria 13550
138 Ga0070695_100004949 3300005545 Bacteria 7855
139 Ga0070695_100178587 3300005545 Unclassified 1503
140 Ga0070695_100499501 3300005545 Bacteria 940
141 Ga0070696_100002144 3300005546 Bacteria 12984
142 Ga0070696_100031770 3300005546 Bacteria 3620
143 Ga0070696_100035639 3300005546 Bacteria 3427
144 Ga0070693_100048986 3300005547 Bacteria 2408
145 Ga0070693_100220993 3300005547 Unclassified 1241
146 Ga0070704_100000362 3300005549 Bacteria 20622
147 Ga0070704_100048816 3300005549 Unclassified 2965
148 Ga0070704_100060290 3300005549 Bacteria 2710
149 Ga0070704_100306208 3300005549 Unclassified 1326
150 Ga0068855_100136491 3300005563 Bacteria 2798
151 Ga0070664_100072267 3300005564 Bacteria 2958
152 Ga0068857_100140873 3300005577 Bacteria 2180
153 Ga0068854_100000477 3300005578 Bacteria 24535
154 Ga0068856_100005420 3300005614 Bacteria 12570
155 Ga0070702_100121798 3300005615 Unclassified 1634
156 Ga0070702_100135932 3300005615 Bacteria 1559
157 Ga0068859_100013971 3300005617 Bacteria 8052
158 Ga0068859_101953179 3300005617 Unclassified 648
159 Ga0068864_100051655 3300005618 Bacteria 3542
160 Ga0068866_10413383 3300005718 Bacteria 873
161 Ga0068861_100002177 3300005719 Bacteria 12724
162 Ga0068861_100073489 3300005719 Unclassified 2657
163 Ga0068861_100390459 3300005719 Bacteria 1232
164 Ga0068863_100028702 3300005841 Bacteria 5312
165 Ga0068863_100101383 3300005841 Bacteria 2737
166 Ga0068863_100405497 3300005841 Bacteria 1334
167 Ga0068858_100186999 3300005842 Bacteria 1957
168 Ga0068860_100076527 3300005843 Bacteria 3183
169 Ga0068860_100098241 3300005843 Bacteria 2792
170 Ga0068860_100111023 3300005843 Bacteria 2621
171 Ga0068860_100251019 3300005843 Bacteria 1723
172 Ga0068860_100721093 3300005843 Unclassified 1008
173 Ga0068860_101012427 3300005843 Bacteria 849
174 Ga0068862_100167082 3300005844 Bacteria 1967
175 Ga0068862_100568277 3300005844 Bacteria 1085
176 Ga0068862_101476336 3300005844 Unclassified 685
177 Ga0081455_10100520 3300005937 Bacteria 2323
178 Ga0081538_10012463 3300005981 Bacteria 6814
179 Ga0081540_1007550 3300005983 Bacteria 7738
180 Ga0081540_1049169 3300005983 Bacteria 2105
181 Ga0081539_10000035 3300005985 Bacteria 302689
182 Ga0070715_10102066 3300006163 Bacteria 1340
183 Ga0070712_100002745 3300006175 Bacteria 10882
184 Ga0097621_100230701 3300006237 Bacteria 1616
185 Ga0068871_100098746 3300006358 Bacteria 2443
186 Ga0075428_100003585 3300006844 Bacteria 17012
187 Ga0075428_100032117 3300006844 Bacteria 5800
188 Ga0075428_100064279 3300006844 Bacteria 4018
189 Ga0075428_100095254 3300006844 Bacteria 3245
190 Ga0075428_100100628 3300006844 Bacteria 3151
191 Ga0075428_100163936 3300006844 Bacteria 2411
192 Ga0075428_100177101 3300006844 Bacteria 2309
193 Ga0075428_100320178 3300006844 Bacteria 1666
194 Ga0075428_100378632 3300006844 Bacteria 1517
195 Ga0075428_100535570 3300006844 Bacteria 1252
196 Ga0075428_100796160 3300006844 Unclassified 1005
197 Ga0075430_100024998 3300006846 Bacteria 5080
198 Ga0075430_100037869 3300006846 Bacteria 4089
199 Ga0075430_100087304 3300006846 Bacteria 2610
200 Ga0075430_100367742 3300006846 Bacteria 1187
201 Ga0075431_100000281 3300006847 Bacteria 39748
202 Ga0075431_100002429 3300006847 Bacteria 17932
203 Ga0075431_100014398 3300006847 Bacteria 7999
204 Ga0075431_100058678 3300006847 Bacteria 3972
205 Ga0075431_100085717 3300006847 Bacteria 3251
206 Ga0075431_100538463 3300006847 Unclassified 1156
207 Ga0075431_100555686 3300006847 Bacteria 1135
208 Ga0075431_101058628 3300006847 Unclassified 777
209 Ga0075433_10013309 3300006852 Bacteria 6684
210 Ga0075433_10014472 3300006852 Bacteria 6446
211 Ga0075433_10030473 3300006852 Bacteria 4603
212 Ga0075433_10031802 3300006852 Bacteria 4514
213 Ga0075433_10033144 3300006852 Bacteria 4427
214 Ga0075433_10079989 3300006852 Bacteria 2880
215 Ga0075433_10158905 3300006852 Bacteria 2011
216 Ga0075433_10170721 3300006852 Bacteria 1935
217 Ga0075433_10250022 3300006852 Bacteria 1573
218 Ga0075433_10319970 3300006852 Bacteria 1372
219 Ga0075433_10330283 3300006852 Bacteria 1348
220 Ga0075433_10394820 3300006852 Bacteria 1220
221 Ga0075433_10654128 3300006852 Unclassified 921
222 Ga0075434_100004151 3300006871 Bacteria 12975
223 Ga0075434_100010732 3300006871 Bacteria 8601
224 Ga0075434_100013305 3300006871 Bacteria 7825
225 Ga0075434_100013629 3300006871 Bacteria 7749
226 Ga0075434_100018515 3300006871 Bacteria 6729
227 Ga0075434_100150648 3300006871 Bacteria 2346
228 Ga0075434_100198953 3300006871 Bacteria 2023
229 Ga0075434_100233083 3300006871 Bacteria 1861
230 Ga0075434_100254318 3300006871 Bacteria 1776
231 Ga0075434_100329915 3300006871 Bacteria 1546
232 Ga0075429_100003301 3300006880 Bacteria 13736
233 Ga0075429_100022572 3300006880 Bacteria 5456
234 Ga0075429_100024831 3300006880 Bacteria 5201
235 Ga0075429_100026501 3300006880 Bacteria 5034
236 Ga0075429_100089818 3300006880 Bacteria 2679
237 Ga0075429_100093255 3300006880 Bacteria 2626
238 Ga0068865_100144759 3300006881 Bacteria 1796
239 Ga0068865_100297989 3300006881 Unclassified 1289
240 Ga0075436_100005719 3300006914 Bacteria 8540
241 Ga0075436_100075747 3300006914 Bacteria 2330
242 Ga0075436_100158618 3300006914 Bacteria 1594
243 Ga0097620_100013971 3300006931 Bacteria 8052
244 Ga0097620_101952995 3300006931 Unclassified 648
245 Ga0075435_100001409 3300007076 Bacteria 15484
246 Ga0075435_100005296 3300007076 Bacteria 8982
247 Ga0075435_100010735 3300007076 Bacteria 6708
248 Ga0075435_100014134 3300007076 Bacteria 5957
249 Ga0075435_100090489 3300007076 Bacteria 2524
250 Ga0075435_100122757 3300007076 Bacteria 2168
251 Ga0075435_100139064 3300007076 Bacteria 2036
252 Ga0075435_100141236 3300007076 Unclassified 2020
253 Ga0075435_100189285 3300007076 Bacteria 1741
254 Ga0075435_100425950 3300007076 Unclassified 1143
255 Ga0099794_10028005 3300007265 Bacteria 2617
256 Ga0099794_10050049 3300007265 Bacteria 2010
257 Ga0099794_10076322 3300007265 Bacteria 1647
258 Ga0099794_10174750 3300007265 Bacteria 1095
259 Ga0111539_10004706 3300009094 Bacteria 17835
260 Ga0111539_10011917 3300009094 Bacteria 10899
261 Ga0111539_10018298 3300009094 Bacteria 8679
262 Ga0111539_10357083 3300009094 Bacteria 1701
263 Ga0111539_10527790 3300009094 Bacteria 1375
264 Ga0111539_11118696 3300009094 Bacteria 915
265 Ga0114129_10002411 3300009147 Bacteria 25977
266 Ga0114129_10003566 3300009147 Bacteria 21911
267 Ga0114129_10004971 3300009147 Bacteria 18736
268 Ga0114129_10006448 3300009147 Bacteria 16640
269 Ga0114129_10010991 3300009147 Bacteria 12897
270 Ga0114129_10031245 3300009147 Bacteria 7531
271 Ga0114129_10032196 3300009147 Bacteria 7411
272 Ga0114129_10039712 3300009147 Bacteria 6637
273 Ga0114129_10073936 3300009147 Bacteria 4748
274 Ga0114129_10112489 3300009147 Bacteria 3755
275 Ga0114129_10145563 3300009147 Unclassified 3246
276 Ga0114129_10207829 3300009147 Bacteria 2648
277 Ga0114129_10219610 3300009147 Bacteria 2565
278 Ga0114129_10238747 3300009147 Bacteria 2444
279 Ga0114129_10352432 3300009147 Bacteria 1949
280 Ga0114129_10417258 3300009147 Bacteria 1766
281 Ga0114129_10569876 3300009147 Bacteria 1470
282 Ga0114129_10941509 3300009147 Bacteria 1092
283 Ga0114129_11489697 3300009147 Unclassified 832
284 Ga0105243_10094286 3300009148 Bacteria 2471
285 Ga0105243_10186634 3300009148 Bacteria 1808
286 Ga0105243_10215189 3300009148 Bacteria 1695
287 Ga0105241_10000707 3300009174 Bacteria 25256
288 Ga0105241_10642705 3300009174 Bacteria 963
289 Ga0105241_10791655 3300009174 Unclassified 873
290 Ga0105242_10198890 3300009176 Unclassified 1779
291 Ga0105249_10204587 3300009553 Bacteria 1934
292 Ga0105249_10555408 3300009553 Unclassified 1199
293 Ga0099796_10073693 3300010159 Bacteria 1238
294 Ga0105239_11208425 3300010375 Unclassified 871
295 Ga0157373_10000135 3300013100 Bacteria 58081
296 Ga0157371_10128201 3300013102 Bacteria 1805
297 Ga0157371_10468814 3300013102 Unclassified 927
298 Ga0157370_10303625 3300013104 Bacteria 1473
299 Ga0157369_10055994 3300013105 Bacteria 4255
300 Ga0157378_10134758 3300013297 Unclassified 2289
301 Ga0157378_10234794 3300013297 Bacteria 1749
302 Ga0163162_10009195 3300013306 Bacteria 9619
303 Ga0163162_10858131 3300013306 Unclassified 1023
304 Ga0157372_10001621 3300013307 Bacteria 24404
305 Ga0157380_10197952 3300014326 Bacteria 1780
306 Ga0157380_10324885 3300014326 Bacteria 1428
307 Ga0157377_10067451 3300014745 Bacteria 2060
308 Ga0182007_10020127 3300015262 Bacteria 2391
309 Ga0163161_10687721 3300017792 Bacteria 851
310 Ga0207653_10000907 3300025885 Bacteria 9848
311 Ga0207653_10072504 3300025885 Unclassified 1179
312 Ga0207653_10099180 3300025885 Bacteria 1028
313 Ga0207688_10072047 3300025901 Bacteria 1962
314 Ga0207680_10223666 3300025903 Bacteria 1291
315 Ga0207645_10000639 3300025907 Bacteria 29117
316 Ga0207645_10102558 3300025907 Unclassified 1847
317 Ga0207643_10000110 3300025908 Bacteria 56123
318 Ga0207684_10000400 3300025910 Bacteria 57952
319 Ga0207684_10004604 3300025910 Bacteria 12954
320 Ga0207684_10004776 3300025910 Bacteria 12693
321 Ga0207684_10007572 3300025910 Bacteria 9759
322 Ga0207684_10009149 3300025910 Bacteria 8767
323 Ga0207684_10028939 3300025910 Bacteria 4719
324 Ga0207684_10354894 3300025910 Bacteria 1262
325 Ga0207684_10405034 3300025910 Unclassified 1173
326 Ga0207684_10412020 3300025910 Bacteria 1161
327 Ga0207684_10748528 3300025910 Bacteria 828
328 Ga0207654_10000471 3300025911 Bacteria 22997
329 Ga0207707_10000019 3300025912 Bacteria 206008
330 Ga0207707_10590479 3300025912 Unclassified 941
331 Ga0207693_10006029 3300025915 Bacteria 10048
332 Ga0207663_10109755 3300025916 Bacteria 1870
333 Ga0207660_10000163 3300025917 Bacteria 41683
334 Ga0207660_10267487 3300025917 Unclassified 1353
335 Ga0207662_10034183 3300025918 Bacteria 2967
336 Ga0207657_10000233 3300025919 Bacteria 58450
337 Ga0207649_10004694 3300025920 Bacteria 7392
338 Ga0207652_10000357 3300025921 Bacteria 47346
339 Ga0207646_10003573 3300025922 Bacteria 17447
340 Ga0207646_10006091 3300025922 Bacteria 12563
341 Ga0207646_10007089 3300025922 Bacteria 11466
342 Ga0207646_10019129 3300025922 Bacteria 6369
343 Ga0207646_10057144 3300025922 Bacteria 3486
344 Ga0207646_10081240 3300025922 Bacteria 2898
345 Ga0207646_10246929 3300025922 Bacteria 1612
346 Ga0207646_10318572 3300025922 Bacteria 1405
347 Ga0207646_10435669 3300025922 Unclassified 1183
348 Ga0207681_10211061 3300025923 Bacteria 1496
349 Ga0207681_10313011 3300025923 Bacteria 1246
350 Ga0207650_10050838 3300025925 Bacteria 3066
351 Ga0207690_10002423 3300025932 Bacteria 11285
352 Ga0207706_10003062 3300025933 Bacteria 16102
353 Ga0207706_10043271 3300025933 Bacteria 3992
354 Ga0207706_10159510 3300025933 Bacteria 1983
355 Ga0207706_10208294 3300025933 Bacteria 1714
356 Ga0207686_11641931 3300025934 Unclassified 531
357 Ga0207709_10081656 3300025935 Bacteria 2085
358 Ga0207709_10117543 3300025935 Bacteria 1789
359 Ga0207709_10130455 3300025935 Bacteria 1712
360 Ga0207670_10558183 3300025936 Bacteria 936
361 Ga0207670_10691411 3300025936 Bacteria 844
362 Ga0207704_10206994 3300025938 Bacteria 1441
363 Ga0207704_10272928 3300025938 Bacteria 1281
364 Ga0207704_10594719 3300025938 Bacteria 905
365 Ga0207665_10001755 3300025939 Bacteria 14551
366 Ga0207691_10044077 3300025940 Bacteria 4108
367 Ga0207691_10519216 3300025940 Bacteria 1011
368 Ga0207689_10001778 3300025942 Bacteria 20355
369 Ga0207689_10028586 3300025942 Bacteria 4662
370 Ga0207689_10780964 3300025942 Bacteria 806
371 Ga0207679_10000555 3300025945 Bacteria 25070
372 Ga0207667_10008234 3300025949 Bacteria 12407
373 Ga0207651_10011120 3300025960 Bacteria 5022
374 Ga0207712_10252006 3300025961 Bacteria 1427
375 Ga0207712_10543864 3300025961 Unclassified 998
376 Ga0207712_10872638 3300025961 Unclassified 794
377 Ga0207668_10915537 3300025972 Unclassified 781
378 Ga0207668_11425833 3300025972 Bacteria 624
379 Ga0207640_10022558 3300025981 Bacteria 3770
380 Ga0207677_10206466 3300026023 Bacteria 1565
381 Ga0207703_10079357 3300026035 Bacteria 2731
382 Ga0207639_10000989 3300026041 Bacteria 19361
383 Ga0207639_10965172 3300026041 Unclassified 798
384 Ga0207678_10001255 3300026067 Bacteria 23409
385 Ga0207678_10214446 3300026067 Bacteria 1647
386 Ga0207708_10159163 3300026075 Unclassified 1783
387 Ga0207702_10002481 3300026078 Bacteria 17427
388 Ga0207641_10170596 3300026088 Bacteria 1985
389 Ga0207641_10220289 3300026088 Bacteria 1759
390 Ga0207641_10619068 3300026088 Unclassified 1061
391 Ga0207648_10003307 3300026089 Bacteria 16930
392 Ga0207648_10079720 3300026089 Bacteria 2856
393 Ga0207648_11327902 3300026089 Unclassified 676
394 Ga0207676_10315136 3300026095 Bacteria 1433
395 Ga0207674_10007180 3300026116 Bacteria 13003
396 Ga0207674_10336148 3300026116 Unclassified 1460
397 Ga0207675_100001759 3300026118 Bacteria 21671
398 Ga0207675_100309501 3300026118 Bacteria 1540
399 Ga0207675_100410434 3300026118 Bacteria 1336
400 Ga0209995_1001462 3300027471 Bacteria 3647
401 Ga0209982_1004078 3300027552 Bacteria 2084
402 Ga0209588_1005245 3300027671 Unclassified 3701
403 Ga0209588_1065205 3300027671 Unclassified 1177
404 Ga0209971_1000032 3300027682 Bacteria 49849
405 Ga0209966_1000076 3300027695 Bacteria 42927
406 Ga0209998_10000053 3300027717 Bacteria 47292
407 Ga0209998_10087008 3300027717 Unclassified 762
408 Ga0209974_10001014 3300027876 Bacteria 9914
409 Ga0207428_10000299 3300027907 Bacteria 65352
410 Ga0207428_10000326 3300027907 Bacteria 61788
411 Ga0207428_10035468 3300027907 Bacteria 4077
412 Ga0207428_10097985 3300027907 Bacteria 2269
413 Ga0207428_10312232 3300027907 Bacteria 1162
414 Ga0207428_10477999 3300027907 Unclassified 906
415 Ga0268265_10008238 3300028380 Bacteria 7041
416 Ga0268265_10502198 3300028380 Bacteria 1143
417 Ga0268265_10828426 3300028380 Unclassified 904
418 Ga0268264_10002911 3300028381 Bacteria 14867
419 Ga0268264_10106000 3300028381 Unclassified 2453
420 Ga0268264_10295650 3300028381 Bacteria 1522
421 Ga0373930_0037832 3300034816 Unclassified 1017
422 Ga0373948_0131787 3300034817 Bacteria 612
423 Ga0373950_0041756 3300034818 Bacteria 880
424 Ga0373938_0130772 3300034957 Bacteria 654
425 Ga0373928_0079597 3300035084 Bacteria 824
426 Ga0373940_0030524 3300035088 Bacteria 1434
427 Ga0373940_0049642 3300035088 Bacteria 1175
428 Ga0373949_0003264 3300035090 Bacteria 3906
429 Ga0373951_0184251 3300035091 Unclassified 601
430 Ga0373952_0112737 3300035092 Unclassified 729
431 Ga0373932_0014139 3300035112 Bacteria 2001
432 Ga0373932_0022361 3300035112 Bacteria 1679
433 Ga0373960_0012799 3300035121 Bacteria 2090
434 Ga0373960_0252310 3300035121 Bacteria 641
435 Ga0373961_0010470 3300035241 Bacteria 2285
436 Ga0373962_0027286 3300035242 Bacteria 1544
437 Ga0373962_0075917 3300035242 Unclassified 1012
438 Ga0373931_0020296 3300035691 Bacteria 3323
439 Ga0373931_0044923 3300035691 Bacteria 2331
440 Ga0395899_0122760 3300037312 Bacteria 1859
441 Ga0395900_0011204 3300037418 Bacteria 9168
442 Ga0395898_0012625 3300037466 Bacteria 8733
443 Ga0395901_0001281 3300038443 Bacteria 26655
444 Ga0242420_060637 3300038996 Unclassified 754
445 Ga0439443_063675 3300042003 Bacteria 664
446 Ga0439448_0064558 3300042005 Bacteria 1213
447 Ga0439450_160011 3300042008 Bacteria 593
448 Ga0450913_001826 3300042117 Unclassified 1234
449 Ga0450892_019183 3300042130 Bacteria 661
450 Ga0439444_0073507 3300042437 Unclassified 736
451 Ga0451577_0001992 3300042876 Bacteria 25513
452 Ga0451577_0133574 3300042876 Bacteria 2227
453 Ga0439440_0070406 3300042993 Bacteria 909
454 Ga0453683_0009320 3300044673 Bacteria 6559
455 Ga0453683_0036088 3300044673 Bacteria 3113
456 Ga0453683_0121764 3300044673 Bacteria 1642
457 Ga0453683_0333487 3300044673 Bacteria 973
458 Ga0453683_0341068 3300044673 Bacteria 962
459 Ga0453684_0074986 3300044712 Bacteria 4255
460 Ga0453684_0138984 3300044712 Bacteria 2904
461 Ga0453684_0201363 3300044712 Bacteria 2321
462 Ga0453684_0463434 3300044712 Bacteria 1409
463 Ga0451576_0019032 3300045051 Bacteria 7503
464 Ga0451576_0059042 3300045051 Unclassified 4005
465 Ga0451576_0059757 3300045051 Bacteria 3978
466 Ga0451576_0235212 3300045051 Bacteria 1913
467 Ga0451576_0268191 3300045051 Bacteria 1784
468 Ga0451576_0289365 3300045051 Bacteria 1713
469 Ga0451576_0302464 3300045051 Bacteria 1673
470 Ga0451576_0468060 3300045051 Bacteria 1323
471 Ga0451576_0634726 3300045051 Bacteria 1122
472 Ga0451576_1457165 3300045051 Unclassified 712
473 Ga0451576_1874574 3300045051 Bacteria 619
474 Ga0495603_0260975 3300046455 Bacteria 997
475 Ga0495603_0486432 3300046455 Unclassified 707
476 Ga0495580_0015200 3300046472 Bacteria 5818
477 Ga0495594_0151144 3300046499 Unclassified 1318
478 Ga0495594_0243238 3300046499 Bacteria 1025
479 Ga0495642_0047466 3300046528 Bacteria 1759
480 Ga0495659_0072587 3300046664 Bacteria 1292
481 Ga0495669_0155910 3300046684 Bacteria 1082
482 Ga0495670_0088607 3300046691 Unclassified 1582
483 Ga0495670_0148365 3300046691 Unclassified 1229
484 Ga0495636_0117825 3300047318 Bacteria 1173
485 Ga0496102_0118122 3300048905 Bacteria 2475
486 Ga0496103_0546930 3300048906 Unclassified 739
487 Ga0496106_0139087 3300048909 Bacteria 1909
488 Ga0496108_0507473 3300048911 Bacteria 1053
489 Ga0496110_0211809 3300048913 Bacteria 1762
490 Ga0496113_0177334 3300048916 Bacteria 1689
491 Ga0501032_0223879 3300049569 Unclassified 1224
492 Ga0501033_0135068 3300049570 Unclassified 1785
493 Ga0501036_0045123 3300049572 Bacteria 3735
494 Ga0501036_0194148 3300049572 Bacteria 1708
495 Ga0501036_0423942 3300049572 Unclassified 1109
496 Ga0501036_0525641 3300049572 Bacteria 984
497 Ga0501037_0264606 3300049573 Unclassified 1201
498 Ga0501038_0298631 3300049574 Unclassified 1264
499 Ga0501038_0815310 3300049574 Unclassified 693
500 Ga0501039_0158319 3300049575 Bacteria 1780
501 Ga0501040_0000438 3300049576 Bacteria 24760
502 Ga0501040_0001237 3300049576 Bacteria 16226
503 Ga0501040_0025157 3300049576 Bacteria 4001
504 Ga0501040_0106090 3300049576 Bacteria 1963
505 Ga0501040_0211937 3300049576 Bacteria 1377
506 Ga0501040_0229695 3300049576 Unclassified 1321
507 Ga0501041_0014540 3300049577 Bacteria 4673
508 Ga0501041_0059968 3300049577 Bacteria 2329
509 Ga0501041_0147678 3300049577 Unclassified 1467
510 Ga0501041_0256258 3300049577 Bacteria 1100
511 Ga0501042_0002328 3300049578 Bacteria 11626
512 Ga0501042_0042981 3300049578 Unclassified 3217
513 Ga0501046_0000662 3300049580 Bacteria 33426
514 Ga0501046_0079436 3300049580 Bacteria 2536
515 Ga0501046_0157614 3300049580 Unclassified 1709
516 Ga0501046_0191523 3300049580 Unclassified 1525
517 Ga0501047_0089835 3300049581 Bacteria 2949
518 Ga0501048_0073413 3300049582 Bacteria 2414
519 Ga0501048_0150013 3300049582 Unclassified 1649
520 Ga0501048_0528837 3300049582 Bacteria 846
521 Ga0501048_0622586 3300049582 Unclassified 775
522 Ga0501067_0137511 3300049583 Unclassified 1360
523 Ga0501068_0070783 3300049584 Unclassified 2128
524 Ga0501068_0077317 3300049584 Bacteria 2038
525 Ga0501068_0210200 3300049584 Bacteria 1235
526 Ga0501069_0325454 3300049585 Unclassified 904
527 Ga0501071_0146657 3300049587 Bacteria 1759
528 Ga0501071_0338580 3300049587 Bacteria 1144
529 Ga0501071_0535816 3300049587 Unclassified 899
530 Ga0501071_0536168 3300049587 Bacteria 898
531 Ga0501071_1359092 3300049587 Bacteria 549
532 Ga0501072_0030571 3300049588 Bacteria 4213
533 Ga0501072_0045657 3300049588 Bacteria 3446
534 Ga0501072_0285928 3300049588 Bacteria 1311
535 Ga0501072_0317195 3300049588 Bacteria 1239
536 Ga0501072_0696562 3300049588 Unclassified 798
537 Ga0501073_0238804 3300049589 Unclassified 1255
538 Ga0501074_0002847 3300049590 Bacteria 12111
539 Ga0501074_0039519 3300049590 Bacteria 3417
540 Ga0501075_0096732 3300049591 Bacteria 2241
541 Ga0501075_0098769 3300049591 Bacteria 2216
542 Ga0501075_0102600 3300049591 Bacteria 2173
543 Ga0501075_0110849 3300049591 Bacteria 2086
544 Ga0501075_0165267 3300049591 Bacteria 1688
545 Ga0501075_0205456 3300049591 Bacteria 1502
546 Ga0501076_0004545 3300049592 Bacteria 9882
547 Ga0501076_0038636 3300049592 Bacteria 3748
548 Ga0501076_0091126 3300049592 Unclassified 2452
549 Ga0501076_0138473 3300049592 Unclassified 1977
550 Ga0501076_0147859 3300049592 Bacteria 1911
551 Ga0501076_0213382 3300049592 Unclassified 1577
552 Ga0501076_0312772 3300049592 Bacteria 1288
553 Ga0501076_0739343 3300049592 Unclassified 812
554 Ga0501076_1695650 3300049592 Unclassified 518
555 Ga0501077_0017325 3300049593 Bacteria 4545
556 Ga0501077_0037521 3300049593 Bacteria 3085
557 Ga0501077_0062598 3300049593 Bacteria 2360
558 Ga0501077_0365761 3300049593 Bacteria 921
559 Ga0501077_0431015 3300049593 Bacteria 844
560 Ga0501077_0435799 3300049593 Unclassified 839
561 Ga0501077_0551118 3300049593 Unclassified 740
562 Ga0501079_0000183 3300049741 Bacteria 35711
563 Ga0501079_0011962 3300049741 Bacteria 6623
564 Ga0501079_0160039 3300049741 Bacteria 1755
565 Ga0501079_0294697 3300049741 Unclassified 1269
566 Ga0501079_0340961 3300049741 Unclassified 1174
567 Ga0501079_0704738 3300049741 Bacteria 795
568 Ga0501079_0874091 3300049741 Bacteria 708
569 Ga0501080_0012830 3300049742 Bacteria 7686
570 Ga0501080_0097884 3300049742 Bacteria 2723
571 Ga0501080_0610904 3300049742 Unclassified 967
572 Ga0501080_0628053 3300049742 Unclassified 952
573 Ga0501080_0684378 3300049742 Unclassified 905
574 Ga0501081_0006799 3300049743 Bacteria 7436
575 Ga0501081_0007833 3300049743 Bacteria 6926
576 Ga0501081_0058645 3300049743 Bacteria 2664
577 Ga0501081_0067748 3300049743 Bacteria 2484
578 Ga0501081_0140921 3300049743 Bacteria 1728
579 Ga0501081_0152084 3300049743 Unclassified 1663
580 Ga0501081_0258053 3300049743 Bacteria 1273
581 Ga0501083_0011808 3300049744 Bacteria 6121
582 Ga0501083_0156202 3300049744 Unclassified 1493
583 Ga0501083_0188467 3300049744 Bacteria 1346
584 Ga0501083_0222948 3300049744 Unclassified 1228
585 Ga0501035_0128574 3300049822 Bacteria 2210
586 Ga0501035_0617358 3300049822 Bacteria 882
587 Ga0501045_0004182 3300049824 Bacteria 9965
588 Ga0501045_0085439 3300049824 Bacteria 2329
589 Ga0501045_0128110 3300049824 Unclassified 1886
590 Ga0501045_0187980 3300049824 Bacteria 1539
591 Ga0501045_0412804 3300049824 Unclassified 1004
592 Ga0501045_0745435 3300049824 Unclassified 722
593 nmdc:mga05p37_105119_c1 3300050507 Bacteria 3474
594 nmdc:mga05p37_119585_c1 3300050507 Bacteria 3237
595 nmdc:mga05p37_15506_c1 3300050507 Bacteria 9162
596 nmdc:mga05p37_160102_c1 3300050507 Bacteria 2750
597 nmdc:mga05p37_166735_c1 3300050507 Unclassified 2688
598 nmdc:mga05p37_20273_c1 3300050507 Bacteria 8045
599 nmdc:mga05p37_2101_c1 3300050507 Bacteria 23260
600 nmdc:mga05p37_226210_c1 3300050507 Bacteria 2256
601 nmdc:mga05p37_253303_c1 3300050507 Unclassified 2111
602 nmdc:mga05p37_266516_c1 3300050507 Bacteria 2048
603 nmdc:mga05p37_267165_c1 3300050507 Bacteria 2045
604 nmdc:mga05p37_55964_c1 3300050507 Bacteria 4856
605 nmdc:mga05p37_56743_c1 3300050507 Bacteria 4822
606 nmdc:mga05p37_803395_c1 3300050507 Unclassified 1029
607 nmdc:mga05p37_9634_c1 3300050507 Bacteria 11444
608 nmdc:mga09592_104981_c1 3300050508 Bacteria 2422
609 nmdc:mga09592_107205_c1 3300050508 Bacteria 2396
610 nmdc:mga09592_20111_c1 3300050508 Bacteria 5487
611 nmdc:mga09592_221399_c1 3300050508 Unclassified 1639
612 nmdc:mga09592_29224_c1 3300050508 Bacteria 4584
613 nmdc:mga09592_360213_c1 3300050508 Bacteria 1259
614 nmdc:mga09592_60660_c1 3300050508 Bacteria 3198
615 nmdc:mga09592_91987_c1 3300050508 Bacteria 2593
616 nmdc:mga0qj67_132617_c1 3300050509 Bacteria 2018
617 nmdc:mga0qj67_146505_c1 3300050509 Unclassified 1915
618 nmdc:mga0qj67_155409_c1 3300050509 Bacteria 1856
619 nmdc:mga0qj67_662383_c1 3300050509 Bacteria 832
620 nmdc:mga0qj67_66400_c1 3300050509 Bacteria 2873
621 nmdc:mga0qj67_67370_c1 3300050509 Bacteria 2852
622 nmdc:mga0qj67_876736_c1 3300050509 Bacteria 708
623 nmdc:mga06r32_101718_c1 3300050510 Bacteria 2821
624 nmdc:mga06r32_177746_c1 3300050510 Bacteria 2113
625 nmdc:mga06r32_2190_c1 3300050510 Bacteria 17506
626 nmdc:mga06r32_272619_c1 3300050510 Bacteria 1679
627 nmdc:mga06r32_275681_c1 3300050510 Bacteria 1669
628 nmdc:mga06r32_328210_c1 3300050510 Bacteria 1515
629 nmdc:mga06r32_51424_c1 3300050510 Bacteria 3944
630 nmdc:mga06r32_5428_c1 3300050510 Bacteria 11472
631 nmdc:mga06r32_61754_c1 3300050510 Bacteria 3608
632 nmdc:mga06r32_683502_c1 3300050510 Bacteria 993
633 nmdc:mga06r32_768375_c1 3300050510 Unclassified 926
634 nmdc:mga08y16_127337_c1 3300050511 Bacteria 2649
635 nmdc:mga08y16_140004_c1 3300050511 Bacteria 2515
636 nmdc:mga08y16_141039_c1 3300050511 Bacteria 2506
637 nmdc:mga08y16_23619_c1 3300050511 Bacteria 6494
638 nmdc:mga08y16_365_c1 3300050511 Bacteria 40858
639 nmdc:mga08y16_401864_c1 3300050511 Bacteria 1402
640 nmdc:mga08y16_778933_c1 3300050511 Bacteria 951
641 nmdc:mga0n895_1080_c1 3300050512 Bacteria 19910
642 nmdc:mga0n895_11016_c1 3300050512 Bacteria 8038
643 nmdc:mga0n895_121849_c1 3300050512 Bacteria 2629
644 nmdc:mga0n895_159381_c1 3300050512 Bacteria 2288
645 nmdc:mga0n895_2013139_c1 3300050512 Bacteria 535
646 nmdc:mga0n895_4165_c1 3300050512 Bacteria 11803
647 nmdc:mga0n895_432592_c1 3300050512 Bacteria 1330
648 nmdc:mga0n895_45244_c1 3300050512 Bacteria 4295
649 nmdc:mga0n895_493124_c1 3300050512 Bacteria 1235
650 nmdc:mga0n895_59632_c1 3300050512 Bacteria 3765
651 nmdc:mga0n895_670889_c1 3300050512 Bacteria 1034
652 nmdc:mga0n895_80035_c1 3300050512 Bacteria 3255
653 nmdc:mga0n895_860722_c1 3300050512 Unclassified 894
654 nmdc:mga0n895_91946_c1 3300050512 Bacteria 3037
655 nmdc:mga0rr50_124399_c1 3300050513 Unclassified 2057
656 nmdc:mga0rr50_157050_c1 3300050513 Bacteria 1843
657 nmdc:mga0rr50_15709_c1 3300050513 Bacteria 5004
658 nmdc:mga0rr50_179528_c1 3300050513 Bacteria 1730
659 nmdc:mga0rr50_19388_c1 3300050513 Bacteria 4590
660 nmdc:mga0rr50_4859_c1 3300050513 Bacteria 7948
661 nmdc:mga0rr50_49038_c1 3300050513 Bacteria 3125
662 nmdc:mga0rr50_746031_c1 3300050513 Bacteria 836
663 nmdc:mga0rr50_781667_c1 3300050513 Unclassified 815
664 nmdc:mga0rr50_964681_c1 3300050513 Bacteria 727
665 nmdc:mga0rr50_99676_c1 3300050513 Bacteria 2280
666 nmdc:mga08x19_34109_c1 3300050514 Bacteria 3215
667 nmdc:mga08x19_51937_c1 3300050514 Bacteria 2635
668 nmdc:mga08x19_593854_c1 3300050514 Bacteria 784
669 nmdc:mga08x19_71253_c1 3300050514 Unclassified 2266
670 nmdc:mga0a205_118719_c1 3300050515 Bacteria 2543
671 nmdc:mga0a205_12274_c2 3300050515 Bacteria 6989
672 nmdc:mga0a205_16958_c1 3300050515 Bacteria 6818
673 nmdc:mga0a205_326175_c1 3300050515 Unclassified 1406
674 nmdc:mga0a205_4360_c1 3300050515 Bacteria 12691
675 nmdc:mga0a205_4600_c1 3300050515 Bacteria 12371
676 nmdc:mga0a205_512082_c1 3300050515 Unclassified 1057
677 nmdc:mga0a205_5168_c1 3300050515 Bacteria 11736
678 nmdc:mga0a205_58417_c1 3300050515 Bacteria 3726
679 nmdc:mga0a205_67244_c1 3300050515 Bacteria 3462
680 nmdc:mga0a205_68827_c1 3300050515 Bacteria 3418
681 nmdc:mga0a205_83377_c1 3300050515 Bacteria 3087
682 nmdc:mga0a205_87475_c1 3300050515 Bacteria 3010
683 Ga0501084_0004054 3300054114 Bacteria 11930
684 Ga0501084_0006016 3300054114 Bacteria 9976
685 Ga0501084_0218302 3300054114 Bacteria 1609
686 Ga0501084_0588127 3300054114 Unclassified 940
687 Ga0501084_0814681 3300054114 Unclassified 786
688 Ga0501082_0010601 3300060353 Bacteria 7932
689 Ga0501082_0021734 3300060353 Bacteria 5531
690 Ga0501082_0095998 3300060353 Bacteria 2562
691 Ga0501082_0148775 3300060353 Bacteria 2034
692 Ga0501082_0168266 3300060353 Bacteria 1905
693 Ga0501082_0447128 3300060353 Bacteria 1129
694 Ga0501082_0741910 3300060353 Bacteria 859
695 Ga0530510_0000647 3300061734 Bacteria 22479
696 Ga0530510_0038221 3300061734 Bacteria 3465
697 Ga0530510_0064170 3300061734 Bacteria 2660
698 Ga0530510_0072559 3300061734 Bacteria 2499
699 Ga0530510_0113088 3300061734 Unclassified 1989
700 Ga0530510_0113642 3300061734 Bacteria 1984
701 Ga0530510_0141497 3300061734 Unclassified 1773
702 Ga0530510_0200056 3300061734 Bacteria 1483
703 Ga0530510_0303237 3300061734 Bacteria 1195
704 Ga0530510_0566715 3300061734 Bacteria 863
705 Ga0068869_100573882
706 JGI26141J51220_1000198
707 Ga0065715_10274615
708 Ga0065707_10150645
709 Ga0070676_10000427
710 Ga0070676_10116002
711 Ga0070676_10580017
712 Ga0070690_100020675
713 Ga0070690_100156567
714 Ga0070670_100039023
715 Ga0068869_100002472
716 Ga0068869_100931955
717 Ga0070666_10190398
718 Ga0070680_100000568
719 Ga0070680_100430646
720 Ga0070682_100000700
721 Ga0068868_100231574
722 Ga0070660_100000101
723 Ga0070689_100685240
724 Ga0070691_10197692
725 Ga0070691_10281709
726 Ga0070691_10472904
727 Ga0070687_100060320
728 Ga0070687_100503069
729 Ga0070661_100048938
730 Ga0070692_10000220
731 Ga0070692_10628277
732 Ga0070668_100341157
733 Ga0070668_100857192
734 Ga0070669_100928921
735 Ga0070673_100015384
736 Ga0070659_100002337
737 Ga0070703_10012675
738 Ga0070703_10048993
739 Ga0070703_10275564
740 Ga0070709_10349565
741 Ga0070701_10037527
742 Ga0070701_10308088
743 Ga0070711_100795492
744 Ga0070705_100003111
745 Ga0070705_100023736
746 Ga0070705_100113411
747 Ga0070705_100176398
748 Ga0070705_100768380
749 Ga0070700_100139784
750 Ga0070694_100006751
751 Ga0070694_100031699
752 Ga0070694_100091683
753 Ga0070694_100130690
754 Ga0070694_100545412
755 Ga0070708_100006068
756 Ga0070708_100006507
757 Ga0070708_100073757
758 Ga0070708_100087157
759 Ga0070708_100099831
760 Ga0070708_100134439
761 Ga0070708_100135083
762 Ga0070708_100258272
763 Ga0070708_100304866
764 Ga0070708_100511760
765 Ga0070663_100281233
766 Ga0070663_100314584
767 Ga0070662_100003056
768 Ga0070662_100110817
769 Ga0070662_100236313
770 Ga0070662_100440349
771 Ga0070681_10009774
772 Ga0070681_10279625
773 Ga0068867_100731507
774 Ga0068867_101350471
775 Ga0070706_100002601
776 Ga0070706_100006322
777 Ga0070706_100017157
778 Ga0070706_100061390
779 Ga0070706_100081072
780 Ga0070706_100098465
781 Ga0070706_100133692
782 Ga0070706_100362574
783 Ga0070706_100374037
784 Ga0070706_100427214
785 Ga0070706_100751805
786 Ga0070706_100754627
787 Ga0070706_100866830
788 Ga0070707_100005734
789 Ga0070707_100011887
790 Ga0070707_100018063
791 Ga0070707_100045085
792 Ga0070707_100047505
793 Ga0070707_100064162
794 Ga0070707_100098161
795 Ga0070707_100190722
796 Ga0070707_100196509
797 Ga0070707_100370472
798 Ga0070707_100838300
799 Ga0070707_101234921
800 Ga0070707_101593189
801 Ga0070698_100011572
802 Ga0070698_100017069
803 Ga0070698_100090233
804 Ga0070698_100131472
805 Ga0070698_100163998
806 Ga0070698_100187612
807 Ga0070698_100204902
808 Ga0070698_100457206
809 Ga0070698_100561473
810 Ga0070698_101189693
811 Ga0070699_100001744
812 Ga0070699_100003803
813 Ga0070699_100008044
814 Ga0070699_100026181
815 Ga0070699_100072054
816 Ga0070699_100128348
817 Ga0070699_100144300
818 Ga0070699_100145838
819 Ga0070699_100163042
820 Ga0070699_100190774
821 Ga0070699_100429295
822 Ga0070699_101126453
823 Ga0070679_100000816
824 Ga0070684_100048192
825 Ga0070697_100009975
826 Ga0070697_100038624
827 Ga0070697_100067928
828 Ga0070697_100075394
829 Ga0070697_100110264
830 Ga0070697_100110501
831 Ga0070697_100243646
832 Ga0070697_100446249
833 Ga0070697_100538171
834 Ga0070697_100588213
835 Ga0070697_100874404
836 Ga0070697_100933172
837 Ga0068853_100002651
838 Ga0068853_100776840
839 Ga0070672_100045809
840 Ga0070672_100578977
841 Ga0070695_100001364
842 Ga0070695_100004949
843 Ga0070695_100178587
844 Ga0070695_100499501
845 Ga0070696_100002144
846 Ga0070696_100031770
847 Ga0070696_100035639
848 Ga0070693_100048986
849 Ga0070693_100220993
850 Ga0070704_100000362
851 Ga0070704_100048816
852 Ga0070704_100060290
853 Ga0070704_100306208
854 Ga0068855_100136491
855 Ga0070664_100072267
856 Ga0068857_100140873
857 Ga0068854_100000477
858 Ga0068856_100005420
859 Ga0070702_100121798
860 Ga0070702_100135932
861 Ga0068859_100013971
862 Ga0068859_101953179
863 Ga0068864_100051655
864 Ga0068866_10413383
865 Ga0068861_100002177
866 Ga0068861_100073489
867 Ga0068861_100390459
868 Ga0068863_100028702
869 Ga0068863_100101383
870 Ga0068863_100405497
871 Ga0068858_100186999
872 Ga0068860_100076527
873 Ga0068860_100098241
874 Ga0068860_100111023
875 Ga0068860_100251019
876 Ga0068860_100721093
877 Ga0068860_101012427
878 Ga0068862_100167082
879 Ga0068862_100568277
880 Ga0068862_101476336
881 Ga0081455_10100520
882 Ga0081538_10012463
883 Ga0081540_1007550
884 Ga0081540_1049169
885 Ga0081539_10000035
886 Ga0070715_10102066
887 Ga0070712_100002745
888 Ga0097621_100230701
889 Ga0068871_100098746
890 Ga0075428_100003585
891 Ga0075428_100032117
892 Ga0075428_100064279
893 Ga0075428_100095254
894 Ga0075428_100100628
895 Ga0075428_100163936
896 Ga0075428_100177101
897 Ga0075428_100320178
898 Ga0075428_100378632
899 Ga0075428_100535570
900 Ga0075428_100796160
901 Ga0075430_100024998
902 Ga0075430_100037869
903 Ga0075430_100087304
904 Ga0075430_100367742
905 Ga0075431_100000281
906 Ga0075431_100002429
907 Ga0075431_100014398
908 Ga0075431_100058678
909 Ga0075431_100085717
910 Ga0075431_100538463
911 Ga0075431_100555686
912 Ga0075431_101058628
913 Ga0075433_10013309
914 Ga0075433_10014472
915 Ga0075433_10030473
916 Ga0075433_10031802
917 Ga0075433_10033144
918 Ga0075433_10079989
919 Ga0075433_10158905
920 Ga0075433_10170721
921 Ga0075433_10250022
922 Ga0075433_10319970
923 Ga0075433_10330283
924 Ga0075433_10394820
925 Ga0075433_10654128
926 Ga0075434_100004151
927 Ga0075434_100010732
928 Ga0075434_100013305
929 Ga0075434_100013629
930 Ga0075434_100018515
931 Ga0075434_100150648
932 Ga0075434_100198953
933 Ga0075434_100233083
934 Ga0075434_100254318
935 Ga0075434_100329915
936 Ga0075429_100003301
937 Ga0075429_100022572
938 Ga0075429_100024831
939 Ga0075429_100026501
940 Ga0075429_100089818
941 Ga0075429_100093255
942 Ga0068865_100144759
943 Ga0068865_100297989
944 Ga0075436_100005719
945 Ga0075436_100075747
946 Ga0075436_100158618
947 Ga0097620_100013971
948 Ga0097620_101952995
949 Ga0075435_100001409
950 Ga0075435_100005296
951 Ga0075435_100010735
952 Ga0075435_100014134
953 Ga0075435_100090489
954 Ga0075435_100122757
955 Ga0075435_100139064
956 Ga0075435_100141236
957 Ga0075435_100189285
958 Ga0075435_100425950
959 Ga0099794_10028005
960 Ga0099794_10050049
961 Ga0099794_10076322
962 Ga0099794_10174750
963 Ga0111539_10004706
964 Ga0111539_10011917
965 Ga0111539_10018298
966 Ga0111539_10357083
967 Ga0111539_10527790
968 Ga0111539_11118696
969 Ga0114129_10002411
970 Ga0114129_10003566
971 Ga0114129_10004971
972 Ga0114129_10006448
973 Ga0114129_10010991
974 Ga0114129_10031245
975 Ga0114129_10032196
976 Ga0114129_10039712
977 Ga0114129_10073936
978 Ga0114129_10112489
979 Ga0114129_10145563
980 Ga0114129_10207829
981 Ga0114129_10219610
982 Ga0114129_10238747
983 Ga0114129_10352432
984 Ga0114129_10417258
985 Ga0114129_10569876
986 Ga0114129_10941509
987 Ga0114129_11489697
988 Ga0105243_10094286
989 Ga0105243_10186634
990 Ga0105243_10215189
991 Ga0105241_10000707
992 Ga0105241_10642705
993 Ga0105241_10791655
994 Ga0105242_10198890
995 Ga0105249_10204587
996 Ga0105249_10555408
997 Ga0099796_10073693
998 Ga0105239_11208425
999 Ga0157373_10000135
1000 Ga0157371_10128201
1001 Ga0157371_10468814
1002 Ga0157370_10303625
1003 Ga0157369_10055994
1004 Ga0157378_10134758
1005 Ga0157378_10234794
1006 Ga0163162_10009195
1007 Ga0163162_10858131
1008 Ga0157372_10001621
1009 Ga0157380_10197952
1010 Ga0157380_10324885
1011 Ga0157377_10067451
1012 Ga0182007_10020127
1013 Ga0163161_10687721
1014 Ga0207653_10000907
1015 Ga0207653_10072504
1016 Ga0207653_10099180
1017 Ga0207688_10072047
1018 Ga0207680_10223666
1019 Ga0207645_10000639
1020 Ga0207645_10102558
1021 Ga0207643_10000110
1022 Ga0207684_10000400
1023 Ga0207684_10004604
1024 Ga0207684_10004776
1025 Ga0207684_10007572
1026 Ga0207684_10009149
1027 Ga0207684_10028939
1028 Ga0207684_10354894
1029 Ga0207684_10405034
1030 Ga0207684_10412020
1031 Ga0207684_10748528
1032 Ga0207654_10000471
1033 Ga0207707_10000019
1034 Ga0207707_10590479
1035 Ga0207693_10006029
1036 Ga0207663_10109755
1037 Ga0207660_10000163
1038 Ga0207660_10267487
1039 Ga0207662_10034183
1040 Ga0207657_10000233
1041 Ga0207649_10004694
1042 Ga0207652_10000357
1043 Ga0207646_10003573
1044 Ga0207646_10006091
1045 Ga0207646_10007089
1046 Ga0207646_10019129
1047 Ga0207646_10057144
1048 Ga0207646_10081240
1049 Ga0207646_10246929
1050 Ga0207646_10318572
1051 Ga0207646_10435669
1052 Ga0207681_10211061
1053 Ga0207681_10313011
1054 Ga0207650_10050838
1055 Ga0207690_10002423
1056 Ga0207706_10003062
1057 Ga0207706_10043271
1058 Ga0207706_10159510
1059 Ga0207706_10208294
1060 Ga0207686_11641931
1061 Ga0207709_10081656
1062 Ga0207709_10117543
1063 Ga0207709_10130455
1064 Ga0207670_10558183
1065 Ga0207670_10691411
1066 Ga0207704_10206994
1067 Ga0207704_10272928
1068 Ga0207704_10594719
1069 Ga0207665_10001755
1070 Ga0207691_10044077
1071 Ga0207691_10519216
1072 Ga0207689_10001778
1073 Ga0207689_10028586
1074 Ga0207689_10780964
1075 Ga0207679_10000555
1076 Ga0207667_10008234
1077 Ga0207651_10011120
1078 Ga0207712_10252006
1079 Ga0207712_10543864
1080 Ga0207712_10872638
1081 Ga0207668_10915537
1082 Ga0207668_11425833
1083 Ga0207640_10022558
1084 Ga0207677_10206466
1085 Ga0207703_10079357
1086 Ga0207639_10000989
1087 Ga0207639_10965172
1088 Ga0207678_10001255
1089 Ga0207678_10214446
1090 Ga0207708_10159163
1091 Ga0207702_10002481
1092 Ga0207641_10170596
1093 Ga0207641_10220289
1094 Ga0207641_10619068
1095 Ga0207648_10003307
1096 Ga0207648_10079720
1097 Ga0207648_11327902
1098 Ga0207676_10315136
1099 Ga0207674_10007180
1100 Ga0207674_10336148
1101 Ga0207675_100001759
1102 Ga0207675_100309501
1103 Ga0207675_100410434
1104 Ga0209995_1001462
1105 Ga0209982_1004078
1106 Ga0209588_1005245
1107 Ga0209588_1065205
1108 Ga0209971_1000032
1109 Ga0209966_1000076
1110 Ga0209998_10000053
1111 Ga0209998_10087008
1112 Ga0209974_10001014
1113 Ga0207428_10000299
1114 Ga0207428_10000326
1115 Ga0207428_10035468
1116 Ga0207428_10097985
1117 Ga0207428_10312232
1118 Ga0207428_10477999
1119 Ga0268265_10008238
1120 Ga0268265_10502198
1121 Ga0268265_10828426
1122 Ga0268264_10002911
1123 Ga0268264_10106000
1124 Ga0268264_10295650
1125 Ga0373930_0037832
1126 Ga0373948_0131787
1127 Ga0373950_0041756
1128 Ga0373938_0130772
1129 Ga0373928_0079597
1130 Ga0373940_0030524
1131 Ga0373940_0049642
1132 Ga0373949_0003264
1133 Ga0373951_0184251
1134 Ga0373952_0112737
1135 Ga0373932_0014139
1136 Ga0373932_0022361
1137 Ga0373960_0012799
1138 Ga0373960_0252310
1139 Ga0373961_0010470
1140 Ga0373962_0027286
1141 Ga0373962_0075917
1142 Ga0373931_0020296
1143 Ga0373931_0044923
1144 Ga0395899_0122760
1145 Ga0395900_0011204
1146 Ga0395898_0012625
1147 Ga0395901_0001281
1148 Ga0242420_060637
1149 Ga0439443_063675
1150 Ga0439448_0064558
1151 Ga0439450_160011
1152 Ga0450913_001826
1153 Ga0450892_019183
1154 Ga0439444_0073507
1155 Ga0451577_0001992
1156 Ga0451577_0133574
1157 Ga0439440_0070406
1158 Ga0453683_0009320
1159 Ga0453683_0036088
1160 Ga0453683_0121764
1161 Ga0453683_0333487
1162 Ga0453683_0341068
1163 Ga0453684_0074986
1164 Ga0453684_0138984
1165 Ga0453684_0201363
1166 Ga0453684_0463434
1167 Ga0451576_0019032
1168 Ga0451576_0059042
1169 Ga0451576_0059757
1170 Ga0451576_0235212
1171 Ga0451576_0268191
1172 Ga0451576_0289365
1173 Ga0451576_0302464
1174 Ga0451576_0468060
1175 Ga0451576_0634726
1176 Ga0451576_1457165
1177 Ga0451576_1874574
1178 Ga0495603_0260975
1179 Ga0495603_0486432
1180 Ga0495580_0015200
1181 Ga0495594_0151144
1182 Ga0495594_0243238
1183 Ga0495642_0047466
1184 Ga0495659_0072587
1185 Ga0495669_0155910
1186 Ga0495670_0088607
1187 Ga0495670_0148365
1188 Ga0495636_0117825
1189 Ga0496102_0118122
1190 Ga0496103_0546930
1191 Ga0496106_0139087
1192 Ga0496108_0507473
1193 Ga0496110_0211809
1194 Ga0496113_0177334
1195 Ga0501032_0223879
1196 Ga0501033_0135068
1197 Ga0501036_0045123
1198 Ga0501036_0194148
1199 Ga0501036_0423942
1200 Ga0501036_0525641
1201 Ga0501037_0264606
1202 Ga0501038_0298631
1203 Ga0501038_0815310
1204 Ga0501039_0158319
1205 Ga0501040_0000438
1206 Ga0501040_0001237
1207 Ga0501040_0025157
1208 Ga0501040_0106090
1209 Ga0501040_0211937
1210 Ga0501040_0229695
1211 Ga0501041_0014540
1212 Ga0501041_0059968
1213 Ga0501041_0147678
1214 Ga0501041_0256258
1215 Ga0501042_0002328
1216 Ga0501042_0042981
1217 Ga0501046_0000662
1218 Ga0501046_0079436
1219 Ga0501046_0157614
1220 Ga0501046_0191523
1221 Ga0501047_0089835
1222 Ga0501048_0073413
1223 Ga0501048_0150013
1224 Ga0501048_0528837
1225 Ga0501048_0622586
1226 Ga0501067_0137511
1227 Ga0501068_0070783
1228 Ga0501068_0077317
1229 Ga0501068_0210200
1230 Ga0501069_0325454
1231 Ga0501071_0146657
1232 Ga0501071_0338580
1233 Ga0501071_0535816
1234 Ga0501071_0536168
1235 Ga0501071_1359092
1236 Ga0501072_0030571
1237 Ga0501072_0045657
1238 Ga0501072_0285928
1239 Ga0501072_0317195
1240 Ga0501072_0696562
1241 Ga0501073_0238804
1242 Ga0501074_0002847
1243 Ga0501074_0039519
1244 Ga0501075_0096732
1245 Ga0501075_0098769
1246 Ga0501075_0102600
1247 Ga0501075_0110849
1248 Ga0501075_0165267
1249 Ga0501075_0205456
1250 Ga0501076_0004545
1251 Ga0501076_0038636
1252 Ga0501076_0091126
1253 Ga0501076_0138473
1254 Ga0501076_0147859
1255 Ga0501076_0213382
1256 Ga0501076_0312772
1257 Ga0501076_0739343
1258 Ga0501076_1695650
1259 Ga0501077_0017325
1260 Ga0501077_0037521
1261 Ga0501077_0062598
1262 Ga0501077_0365761
1263 Ga0501077_0431015
1264 Ga0501077_0435799
1265 Ga0501077_0551118
1266 Ga0501079_0000183
1267 Ga0501079_0011962
1268 Ga0501079_0160039
1269 Ga0501079_0294697
1270 Ga0501079_0340961
1271 Ga0501079_0704738
1272 Ga0501079_0874091
1273 Ga0501080_0012830
1274 Ga0501080_0097884
1275 Ga0501080_0610904
1276 Ga0501080_0628053
1277 Ga0501080_0684378
1278 Ga0501081_0006799
1279 Ga0501081_0007833
1280 Ga0501081_0058645
1281 Ga0501081_0067748
1282 Ga0501081_0140921
1283 Ga0501081_0152084
1284 Ga0501081_0258053
1285 Ga0501083_0011808
1286 Ga0501083_0156202
1287 Ga0501083_0188467
1288 Ga0501083_0222948
1289 Ga0501035_0128574
1290 Ga0501035_0617358
1291 Ga0501045_0004182
1292 Ga0501045_0085439
1293 Ga0501045_0128110
1294 Ga0501045_0187980
1295 Ga0501045_0412804
1296 Ga0501045_0745435
1297 nmdc:mga05p37_105119_c1
1298 nmdc:mga05p37_119585_c1
1299 nmdc:mga05p37_15506_c1
1300 nmdc:mga05p37_160102_c1
1301 nmdc:mga05p37_166735_c1
1302 nmdc:mga05p37_20273_c1
1303 nmdc:mga05p37_2101_c1
1304 nmdc:mga05p37_226210_c1
1305 nmdc:mga05p37_253303_c1
1306 nmdc:mga05p37_266516_c1
1307 nmdc:mga05p37_267165_c1
1308 nmdc:mga05p37_55964_c1
1309 nmdc:mga05p37_56743_c1
1310 nmdc:mga05p37_803395_c1
1311 nmdc:mga05p37_9634_c1
1312 nmdc:mga09592_104981_c1
1313 nmdc:mga09592_107205_c1
1314 nmdc:mga09592_20111_c1
1315 nmdc:mga09592_221399_c1
1316 nmdc:mga09592_29224_c1
1317 nmdc:mga09592_360213_c1
1318 nmdc:mga09592_60660_c1
1319 nmdc:mga09592_91987_c1
1320 nmdc:mga0qj67_132617_c1
1321 nmdc:mga0qj67_146505_c1
1322 nmdc:mga0qj67_155409_c1
1323 nmdc:mga0qj67_662383_c1
1324 nmdc:mga0qj67_66400_c1
1325 nmdc:mga0qj67_67370_c1
1326 nmdc:mga0qj67_876736_c1
1327 nmdc:mga06r32_101718_c1
1328 nmdc:mga06r32_177746_c1
1329 nmdc:mga06r32_2190_c1
1330 nmdc:mga06r32_272619_c1
1331 nmdc:mga06r32_275681_c1
1332 nmdc:mga06r32_328210_c1
1333 nmdc:mga06r32_51424_c1
1334 nmdc:mga06r32_5428_c1
1335 nmdc:mga06r32_61754_c1
1336 nmdc:mga06r32_683502_c1
1337 nmdc:mga06r32_768375_c1
1338 nmdc:mga08y16_127337_c1
1339 nmdc:mga08y16_140004_c1
1340 nmdc:mga08y16_141039_c1
1341 nmdc:mga08y16_23619_c1
1342 nmdc:mga08y16_365_c1
1343 nmdc:mga08y16_401864_c1
1344 nmdc:mga08y16_778933_c1
1345 nmdc:mga0n895_1080_c1
1346 nmdc:mga0n895_11016_c1
1347 nmdc:mga0n895_121849_c1
1348 nmdc:mga0n895_159381_c1
1349 nmdc:mga0n895_2013139_c1
1350 nmdc:mga0n895_4165_c1
1351 nmdc:mga0n895_432592_c1
1352 nmdc:mga0n895_45244_c1
1353 nmdc:mga0n895_493124_c1
1354 nmdc:mga0n895_59632_c1
1355 nmdc:mga0n895_670889_c1
1356 nmdc:mga0n895_80035_c1
1357 nmdc:mga0n895_860722_c1
1358 nmdc:mga0n895_91946_c1
1359 nmdc:mga0rr50_124399_c1
1360 nmdc:mga0rr50_157050_c1
1361 nmdc:mga0rr50_15709_c1
1362 nmdc:mga0rr50_179528_c1
1363 nmdc:mga0rr50_19388_c1
1364 nmdc:mga0rr50_4859_c1
1365 nmdc:mga0rr50_49038_c1
1366 nmdc:mga0rr50_746031_c1
1367 nmdc:mga0rr50_781667_c1
1368 nmdc:mga0rr50_964681_c1
1369 nmdc:mga0rr50_99676_c1
1370 nmdc:mga08x19_34109_c1
1371 nmdc:mga08x19_51937_c1
1372 nmdc:mga08x19_593854_c1
1373 nmdc:mga08x19_71253_c1
1374 nmdc:mga0a205_118719_c1
1375 nmdc:mga0a205_12274_c2
1376 nmdc:mga0a205_16958_c1
1377 nmdc:mga0a205_326175_c1
1378 nmdc:mga0a205_4360_c1
1379 nmdc:mga0a205_4600_c1
1380 nmdc:mga0a205_512082_c1
1381 nmdc:mga0a205_5168_c1
1382 nmdc:mga0a205_58417_c1
1383 nmdc:mga0a205_67244_c1
1384 nmdc:mga0a205_68827_c1
1385 nmdc:mga0a205_83377_c1
1386 nmdc:mga0a205_87475_c1
1387 Ga0501084_0004054
1388 Ga0501084_0006016
1389 Ga0501084_0218302
1390 Ga0501084_0588127
1391 Ga0501084_0814681
1392 Ga0501082_0010601
1393 Ga0501082_0021734
1394 Ga0501082_0095998
1395 Ga0501082_0148775
1396 Ga0501082_0168266
1397 Ga0501082_0447128
1398 Ga0501082_0741910
1399 Ga0530510_0000647
1400 Ga0530510_0038221
1401 Ga0530510_0064170
1402 Ga0530510_0072559
1403 Ga0530510_0113088
1404 Ga0530510_0113642
1405 Ga0530510_0141497
1406 Ga0530510_0200056
1407 Ga0530510_0303237
1408 Ga0530510_0566715

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zfd-assembly1.cif.gz_B the crystal structure of plant specific calcium binding protein atcbl2 in complex with the regulatory domain of atcipk14 0.6942 37 137
4eal-assembly1.cif.gz_A co-crystal of ampk core with atp soaked with amp 0.6632 42 168
2yh6-assembly1.cif.gz_C structure of the n-terminal domain of bamc from e. coli 0.6421 39 168
4eal-assembly1.cif.gz_A co-crystal of ampk core with atp soaked with amp 0.6334 42 168
5wi2-assembly2.cif.gz_B crystal structure of the ka1 domain from human chk1 0.6301 41 167
ID Description Score Start End Superfamily
af_P08400_86_199_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8443 105 125 3.30.450.20
af_K7VCH4_344_468_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7078 39 125 3.30.310.80
af_I1MSU0_301_424_3.30.310.80 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.7008 38 168 3.30.310.80
2zfdB00 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.6942 37 137 3.30.310.80
2y94A03 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Kinase associated domain 1, KA1 0.6868 42 139 3.30.310.80
ID Description Score Start End GO Terms
AF-A0A1F7QIB0-F1-model_v4 Lipoprotein 0.9809 25 168
AF-A0A2V6YWG0-F1-model_v4 Uncharacterized protein 0.9758 24 168
AF-A0A1F7QIB0-F1-model_v4 Lipoprotein 0.9548 25 168
AF-A0A2V6YWG0-F1-model_v4 Uncharacterized protein 0.9313 24 168
AF-A0A538QYT7-F1-model_v4 Uncharacterized protein 0.9141 6 168

Map