F476322
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 703 | 386 | 699 | 330 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221603|2644028245 |
| Length | 344 |
| Sequence | HGIKQNKNLMQTLQISIYTLAFLILLALLFDFMNGFHDAANAIATVVSTGVLKPQHAVAMAAFFNVVAIFFFQLKVATTVGKGTIEPSVVDHYVVFGALVGAIFWNILTWYYGIPSSSSHALIGGLVGAAVAKAGTGALISSGLIKTIAFIVLSPLLGFVFGSIMMVVVSWLFVRSTPRRVDKWFRRAQLVSASMYSLGHGGNDAQKTMGIIWMLLIAAGYSSTTDPLPMWVVLSCYAAIGMGTLFGGWRIVKTMGQKITKLKPVGGFCAETGGAITLFLATALGVPVSTTHTITGAIVGVGSSRKMSAVRWGVAGNIVWAWIFTIPASAFVAAIAWWIGTKIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 3 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 4 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 5 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 82 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 83 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 84 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 85 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 89 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 90 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 91 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 192 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 198 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 200 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 202 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 214 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 215 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 216 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 221 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 241 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 242 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 246 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 247 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 248 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 249 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 338 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 339 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 340 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 341 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 364 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 369 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 381 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 382 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 384 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.43 |
| Metatranscriptomes | 0 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.23 |
| Nodule | 0.28 |
| Rhizoplane | 3.41 |
| Rhizosphere | 81.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_602634 | 2162886007 | Bacteria | 4965 |
| 2 | JGI25163J39215_1002284 | 3300002771 | Bacteria | 2083 |
| 3 | JGI25152J39213_1000839 | 3300002773 | Bacteria | 15259 |
| 4 | JGI25150J39212_1000639 | 3300002774 | Bacteria | 13223 |
| 5 | JGI25150J39212_1001574 | 3300002774 | Bacteria | 6236 |
| 6 | JGI25150J39212_1002946 | 3300002774 | Bacteria | 4106 |
| 7 | JGI25159J45721_1000701 | 3300002987 | Bacteria | 14633 |
| 8 | JGI25159J45721_1005270 | 3300002987 | Bacteria | 4085 |
| 9 | JGI25159J45721_1005657 | 3300002987 | Bacteria | 3886 |
| 10 | JGI25165J46597_1000064 | 3300003214 | Bacteria | 199878 |
| 11 | JGI25153J46596_10002118 | 3300003215 | Bacteria | 11612 |
| 12 | JGI25160J50197_1003074 | 3300003354 | Bacteria | 7610 |
| 13 | JGI25161J50226_1000500 | 3300003374 | Bacteria | 17353 |
| 14 | JGI25161J50226_1001505 | 3300003374 | Bacteria | 6908 |
| 15 | Ga0055538_1000031 | 3300003751 | Bacteria | 199878 |
| 16 | Ga0055539_1000041 | 3300003752 | Bacteria | 199878 |
| 17 | Ga0055533_1000051 | 3300003756 | Bacteria | 199878 |
| 18 | Ga0055525_1000061 | 3300003759 | Bacteria | 199878 |
| 19 | Ga0055526_1001572 | 3300003771 | Bacteria | 16064 |
| 20 | Ga0055526_1004107 | 3300003771 | Bacteria | 8885 |
| 21 | Ga0055526_1017481 | 3300003771 | Bacteria | 2734 |
| 22 | Ga0055537_1000041 | 3300003773 | Bacteria | 91422 |
| 23 | Ga0055537_1001581 | 3300003773 | Bacteria | 8639 |
| 24 | Ga0055524_1000007 | 3300003775 | Bacteria | 298766 |
| 25 | Ga0055524_1000153 | 3300003775 | Bacteria | 82019 |
| 26 | Ga0055524_1001204 | 3300003775 | Bacteria | 15355 |
| 27 | Ga0055524_1001786 | 3300003775 | Bacteria | 11814 |
| 28 | Ga0055524_1005089 | 3300003775 | Bacteria | 5947 |
| 29 | Ga0055524_1005404 | 3300003775 | Bacteria | 5713 |
| 30 | Ga0055534_1000505 | 3300003784 | Bacteria | 21272 |
| 31 | Ga0055534_1000540 | 3300003784 | Bacteria | 20263 |
| 32 | Ga0055528_1000984 | 3300003790 | Bacteria | 18916 |
| 33 | Ga0055528_1005770 | 3300003790 | Bacteria | 5704 |
| 34 | Ga0055531_10002277 | 3300003794 | Bacteria | 12991 |
| 35 | Ga0055541_1000028 | 3300003841 | Bacteria | 199878 |
| 36 | Ga0055543_1001582 | 3300004625 | Bacteria | 8779 |
| 37 | Ga0055543_1002113 | 3300004625 | Bacteria | 6896 |
| 38 | Ga0065165_1000404 | 3300005262 | Bacteria | 69447 |
| 39 | Ga0065704_10075032 | 3300005289 | Bacteria | 5833 |
| 40 | Ga0065707_10083624 | 3300005295 | Bacteria | 8615 |
| 41 | Ga0070658_10022476 | 3300005327 | Bacteria | 5061 |
| 42 | Ga0070658_10322430 | 3300005327 | Bacteria | 1319 |
| 43 | Ga0070676_10196668 | 3300005328 | Bacteria | 1319 |
| 44 | Ga0070683_100003534 | 3300005329 | Bacteria | 12724 |
| 45 | Ga0070690_100003271 | 3300005330 | Bacteria | 8849 |
| 46 | Ga0070690_100043334 | 3300005330 | Bacteria | 2854 |
| 47 | Ga0070690_100059421 | 3300005330 | Bacteria | 2458 |
| 48 | Ga0070670_100000139 | 3300005331 | Bacteria | 67826 |
| 49 | Ga0070670_100003576 | 3300005331 | Bacteria | 12933 |
| 50 | Ga0070670_100108857 | 3300005331 | Bacteria | 2388 |
| 51 | Ga0070677_10020732 | 3300005333 | Bacteria | 2399 |
| 52 | Ga0068869_100088247 | 3300005334 | Bacteria | 2327 |
| 53 | Ga0068869_100256851 | 3300005334 | Bacteria | 1398 |
| 54 | Ga0070666_10003050 | 3300005335 | Bacteria | 10170 |
| 55 | Ga0070666_10025974 | 3300005335 | Bacteria | 3822 |
| 56 | Ga0070680_100093012 | 3300005336 | Bacteria | 2497 |
| 57 | Ga0070680_100135048 | 3300005336 | Bacteria | 2066 |
| 58 | Ga0070680_100394606 | 3300005336 | Bacteria | 1179 |
| 59 | Ga0070682_100002647 | 3300005337 | Bacteria | 9897 |
| 60 | Ga0070682_100033530 | 3300005337 | Bacteria | 3121 |
| 61 | Ga0068868_100000052 | 3300005338 | Bacteria | 66081 |
| 62 | Ga0068868_100002988 | 3300005338 | Bacteria | 11748 |
| 63 | Ga0070689_100128831 | 3300005340 | Bacteria | 2028 |
| 64 | Ga0070691_10155354 | 3300005341 | Bacteria | 1176 |
| 65 | Ga0070687_100050223 | 3300005343 | Bacteria | 2153 |
| 66 | Ga0070661_100000828 | 3300005344 | Bacteria | 22256 |
| 67 | Ga0070661_100002567 | 3300005344 | Bacteria | 12450 |
| 68 | Ga0070692_10082506 | 3300005345 | Bacteria | 1734 |
| 69 | Ga0070668_100071999 | 3300005347 | Bacteria | 2693 |
| 70 | Ga0070669_100080225 | 3300005353 | Bacteria | 2428 |
| 71 | Ga0070669_100302158 | 3300005353 | Bacteria | 1287 |
| 72 | Ga0070675_100003157 | 3300005354 | Bacteria | 12471 |
| 73 | Ga0070671_100000380 | 3300005355 | Bacteria | 30594 |
| 74 | Ga0070671_100050568 | 3300005355 | Bacteria | 3457 |
| 75 | Ga0070671_100105151 | 3300005355 | Bacteria | 2369 |
| 76 | Ga0070674_100056233 | 3300005356 | Bacteria | 2728 |
| 77 | Ga0070674_100073256 | 3300005356 | Bacteria | 2427 |
| 78 | Ga0070673_100002472 | 3300005364 | Bacteria | 11280 |
| 79 | Ga0070673_100178659 | 3300005364 | Bacteria | 1816 |
| 80 | Ga0070688_100168924 | 3300005365 | Bacteria | 1508 |
| 81 | Ga0070659_100030020 | 3300005366 | Bacteria | 4205 |
| 82 | Ga0070667_100350038 | 3300005367 | Bacteria | 1337 |
| 83 | Ga0070710_10120125 | 3300005437 | Bacteria | 1590 |
| 84 | Ga0070701_10001290 | 3300005438 | Bacteria | 9205 |
| 85 | Ga0070701_10122015 | 3300005438 | Bacteria | 1470 |
| 86 | Ga0070701_10193367 | 3300005438 | Bacteria | 1198 |
| 87 | Ga0070705_100008425 | 3300005440 | Bacteria | 5107 |
| 88 | Ga0070700_100004593 | 3300005441 | Bacteria | 7227 |
| 89 | Ga0070700_100019740 | 3300005441 | Bacteria | 3893 |
| 90 | Ga0070694_100162890 | 3300005444 | Bacteria | 1638 |
| 91 | Ga0070694_100205254 | 3300005444 | Bacteria | 1471 |
| 92 | Ga0070708_100021116 | 3300005445 | Bacteria | 5500 |
| 93 | Ga0070663_100148234 | 3300005455 | Bacteria | 1797 |
| 94 | Ga0070678_100000133 | 3300005456 | Bacteria | 30071 |
| 95 | Ga0070662_100033372 | 3300005457 | Bacteria | 3623 |
| 96 | Ga0070662_100090976 | 3300005457 | Bacteria | 2291 |
| 97 | Ga0070681_10030525 | 3300005458 | Bacteria | 5408 |
| 98 | Ga0070681_10175455 | 3300005458 | Bacteria | 2065 |
| 99 | Ga0068867_100122275 | 3300005459 | Bacteria | 2013 |
| 100 | Ga0068867_100312042 | 3300005459 | Bacteria | 1300 |
| 101 | Ga0070685_10060074 | 3300005466 | Bacteria | 2221 |
| 102 | Ga0070685_10088092 | 3300005466 | Bacteria | 1874 |
| 103 | Ga0070679_100061976 | 3300005530 | Bacteria | 3728 |
| 104 | Ga0070684_100063093 | 3300005535 | Bacteria | 3247 |
| 105 | Ga0068853_100008911 | 3300005539 | Bacteria | 8076 |
| 106 | Ga0070672_100000161 | 3300005543 | Bacteria | 37259 |
| 107 | Ga0070672_100031713 | 3300005543 | Bacteria | 3981 |
| 108 | Ga0070672_100032446 | 3300005543 | Bacteria | 3941 |
| 109 | Ga0070672_100051544 | 3300005543 | Bacteria | 3210 |
| 110 | Ga0070686_100336735 | 3300005544 | Bacteria | 1130 |
| 111 | Ga0070695_100038851 | 3300005545 | Bacteria | 3006 |
| 112 | Ga0070696_100036088 | 3300005546 | Bacteria | 3407 |
| 113 | Ga0070665_100005913 | 3300005548 | Bacteria | 12535 |
| 114 | Ga0070665_100016957 | 3300005548 | Bacteria | 7303 |
| 115 | Ga0070665_100036349 | 3300005548 | Bacteria | 4954 |
| 116 | Ga0070704_100004455 | 3300005549 | Bacteria | 8087 |
| 117 | Ga0068855_100058882 | 3300005563 | Bacteria | 4496 |
| 118 | Ga0068855_100521708 | 3300005563 | Bacteria | 1289 |
| 119 | Ga0070664_100000778 | 3300005564 | Bacteria | 24605 |
| 120 | Ga0070664_100003400 | 3300005564 | Bacteria | 12849 |
| 121 | Ga0070664_100003658 | 3300005564 | Bacteria | 12383 |
| 122 | Ga0068857_100059943 | 3300005577 | Bacteria | 3382 |
| 123 | Ga0068854_100008869 | 3300005578 | Bacteria | 6473 |
| 124 | Ga0068856_100377364 | 3300005614 | Bacteria | 1437 |
| 125 | Ga0070702_100016569 | 3300005615 | Bacteria | 3784 |
| 126 | Ga0070702_100064864 | 3300005615 | Bacteria | 2137 |
| 127 | Ga0070702_100116174 | 3300005615 | Bacteria | 1668 |
| 128 | Ga0068852_100000154 | 3300005616 | Bacteria | 45758 |
| 129 | Ga0068859_100011998 | 3300005617 | Bacteria | 8703 |
| 130 | Ga0068859_100030344 | 3300005617 | Bacteria | 5425 |
| 131 | Ga0068859_100091196 | 3300005617 | Bacteria | 3098 |
| 132 | Ga0068859_100148137 | 3300005617 | Bacteria | 2422 |
| 133 | Ga0068864_100001323 | 3300005618 | Bacteria | 20596 |
| 134 | Ga0068864_100002108 | 3300005618 | Bacteria | 16440 |
| 135 | Ga0068861_100010878 | 3300005719 | Bacteria | 6322 |
| 136 | Ga0068861_100023338 | 3300005719 | Bacteria | 4461 |
| 137 | Ga0068861_100049514 | 3300005719 | Bacteria | 3181 |
| 138 | Ga0068861_100150614 | 3300005719 | Bacteria | 1908 |
| 139 | Ga0068861_100494959 | 3300005719 | Bacteria | 1104 |
| 140 | Ga0068851_10000654 | 3300005834 | Bacteria | 14796 |
| 141 | Ga0068870_10050469 | 3300005840 | Bacteria | 2198 |
| 142 | Ga0068863_100002243 | 3300005841 | Bacteria | 19184 |
| 143 | Ga0068863_100016337 | 3300005841 | Bacteria | 7121 |
| 144 | Ga0068863_100017176 | 3300005841 | Bacteria | 6940 |
| 145 | Ga0068858_100011447 | 3300005842 | Bacteria | 8375 |
| 146 | Ga0068858_100041294 | 3300005842 | Bacteria | 4277 |
| 147 | Ga0068860_100013959 | 3300005843 | Bacteria | 7875 |
| 148 | Ga0068860_100278273 | 3300005843 | Bacteria | 1635 |
| 149 | Ga0068862_100014237 | 3300005844 | Bacteria | 6597 |
| 150 | Ga0068862_100134794 | 3300005844 | Bacteria | 2188 |
| 151 | Ga0068862_100171490 | 3300005844 | Bacteria | 1942 |
| 152 | Ga0081455_10007076 | 3300005937 | Bacteria | 11903 |
| 153 | Ga0097621_100003402 | 3300006237 | Bacteria | 10956 |
| 154 | Ga0097621_100016958 | 3300006237 | Bacteria | 5521 |
| 155 | Ga0097621_100189541 | 3300006237 | Bacteria | 1780 |
| 156 | Ga0068871_100000092 | 3300006358 | Bacteria | 52522 |
| 157 | Ga0068871_100004973 | 3300006358 | Bacteria | 9284 |
| 158 | Ga0068871_100033056 | 3300006358 | Bacteria | 4092 |
| 159 | Ga0068871_100165764 | 3300006358 | Bacteria | 1891 |
| 160 | Ga0075428_100014644 | 3300006844 | Bacteria | 8709 |
| 161 | Ga0075430_100171165 | 3300006846 | Bacteria | 1807 |
| 162 | Ga0075430_100183365 | 3300006846 | Bacteria | 1741 |
| 163 | Ga0075433_10131112 | 3300006852 | Bacteria | 2227 |
| 164 | Ga0068865_100023112 | 3300006881 | Bacteria | 4067 |
| 165 | Ga0068865_100071985 | 3300006881 | Bacteria | 2454 |
| 166 | Ga0068865_100082743 | 3300006881 | Bacteria | 2308 |
| 167 | Ga0068865_100116468 | 3300006881 | Bacteria | 1979 |
| 168 | Ga0097620_100011997 | 3300006931 | Bacteria | 8703 |
| 169 | Ga0097620_100030344 | 3300006931 | Bacteria | 5425 |
| 170 | Ga0097620_100091197 | 3300006931 | Bacteria | 3098 |
| 171 | Ga0097620_100148128 | 3300006931 | Bacteria | 2422 |
| 172 | Ga0099826_10000052 | 3300006948 | Bacteria | 73156 |
| 173 | Ga0105240_10030806 | 3300009093 | Bacteria | 6969 |
| 174 | Ga0105240_10060144 | 3300009093 | Bacteria | 4737 |
| 175 | Ga0111539_10045433 | 3300009094 | Bacteria | 5258 |
| 176 | Ga0111539_10079217 | 3300009094 | Bacteria | 3864 |
| 177 | Ga0111539_10177614 | 3300009094 | Bacteria | 2487 |
| 178 | Ga0105245_10015255 | 3300009098 | Bacteria | 6694 |
| 179 | Ga0105245_10022419 | 3300009098 | Bacteria | 5544 |
| 180 | Ga0105243_10018590 | 3300009148 | Bacteria | 5267 |
| 181 | Ga0105243_10039431 | 3300009148 | Bacteria | 3682 |
| 182 | Ga0105241_10089072 | 3300009174 | Bacteria | 2431 |
| 183 | Ga0105242_10100504 | 3300009176 | Bacteria | 2450 |
| 184 | Ga0105242_10238775 | 3300009176 | Bacteria | 1633 |
| 185 | Ga0105248_10012985 | 3300009177 | Bacteria | 9181 |
| 186 | Ga0105248_10152064 | 3300009177 | Bacteria | 2611 |
| 187 | Ga0105249_10017231 | 3300009553 | Bacteria | 6411 |
| 188 | Ga0105249_10084809 | 3300009553 | Bacteria | 2951 |
| 189 | Ga0105246_10004725 | 3300011119 | Bacteria | 8295 |
| 190 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 191 | Ga0157369_10087190 | 3300013105 | Bacteria | 3333 |
| 192 | Ga0157374_10000136 | 3300013296 | Bacteria | 66574 |
| 193 | Ga0157374_10001696 | 3300013296 | Bacteria | 18451 |
| 194 | Ga0157374_10026122 | 3300013296 | Bacteria | 5251 |
| 195 | Ga0157378_10003595 | 3300013297 | Bacteria | 13723 |
| 196 | Ga0157378_10091651 | 3300013297 | Bacteria | 2764 |
| 197 | Ga0157378_10161023 | 3300013297 | Bacteria | 2099 |
| 198 | Ga0163162_10014976 | 3300013306 | Bacteria | 7575 |
| 199 | Ga0163162_10021750 | 3300013306 | Bacteria | 6317 |
| 200 | Ga0163162_10150181 | 3300013306 | Bacteria | 2447 |
| 201 | Ga0163162_10364065 | 3300013306 | Bacteria | 1579 |
| 202 | Ga0157372_10212810 | 3300013307 | Bacteria | 2240 |
| 203 | Ga0157375_10001678 | 3300013308 | Bacteria | 19062 |
| 204 | Ga0157375_10060726 | 3300013308 | Bacteria | 3751 |
| 205 | Ga0157375_10078315 | 3300013308 | Bacteria | 3338 |
| 206 | Ga0157375_10260077 | 3300013308 | Bacteria | 1897 |
| 207 | Ga0157375_10380112 | 3300013308 | Bacteria | 1579 |
| 208 | Ga0163163_10070857 | 3300014325 | Bacteria | 3472 |
| 209 | Ga0157380_10027648 | 3300014326 | Bacteria | 4315 |
| 210 | Ga0157380_10100428 | 3300014326 | Bacteria | 2409 |
| 211 | Ga0157380_10203224 | 3300014326 | Bacteria | 1759 |
| 212 | Ga0157380_10419890 | 3300014326 | Bacteria | 1275 |
| 213 | Ga0157377_10034022 | 3300014745 | Bacteria | 2786 |
| 214 | Ga0157379_10018785 | 3300014968 | Bacteria | 6095 |
| 215 | Ga0157379_10034303 | 3300014968 | Bacteria | 4524 |
| 216 | Ga0157379_10037078 | 3300014968 | Bacteria | 4347 |
| 217 | Ga0157379_10037907 | 3300014968 | Bacteria | 4300 |
| 218 | Ga0157376_10000389 | 3300014969 | Bacteria | 28637 |
| 219 | Ga0157376_10050231 | 3300014969 | Bacteria | 3459 |
| 220 | Ga0157376_10051163 | 3300014969 | Bacteria | 3431 |
| 221 | Ga0182006_1003516 | 3300015261 | Bacteria | 7995 |
| 222 | Ga0182007_10002481 | 3300015262 | Bacteria | 9145 |
| 223 | Ga0182007_10019825 | 3300015262 | Bacteria | 2411 |
| 224 | Ga0182005_1002989 | 3300015265 | Bacteria | 5851 |
| 225 | Ga0209436_100445 | 3300025208 | Bacteria | 18569 |
| 226 | Ga0209436_101852 | 3300025208 | Bacteria | 6855 |
| 227 | Ga0209436_113897 | 3300025208 | Bacteria | 1300 |
| 228 | Ga0209784_100039 | 3300025224 | Bacteria | 232021 |
| 229 | Ga0209566_100023 | 3300025225 | Bacteria | 396571 |
| 230 | Ga0209674_100040 | 3300025226 | Bacteria | 396571 |
| 231 | Ga0209563_100072 | 3300025230 | Bacteria | 232021 |
| 232 | Ga0207427_101009 | 3300025231 | Bacteria | 11777 |
| 233 | Ga0209437_100097 | 3300025233 | Bacteria | 232021 |
| 234 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 235 | Ga0207425_1003063 | 3300025245 | Bacteria | 5539 |
| 236 | Ga0209677_100041 | 3300025253 | Bacteria | 232021 |
| 237 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 238 | Ga0209129_1019142 | 3300025258 | Bacteria | 1300 |
| 239 | Ga0209233_1000122 | 3300025261 | Bacteria | 232021 |
| 240 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 241 | Ga0209565_1001365 | 3300025263 | Bacteria | 11005 |
| 242 | Ga0209565_1001610 | 3300025263 | Bacteria | 9548 |
| 243 | Ga0209565_1002049 | 3300025263 | Bacteria | 7742 |
| 244 | Ga0209565_1004635 | 3300025263 | Bacteria | 4144 |
| 245 | Ga0209565_1010335 | 3300025263 | Bacteria | 2316 |
| 246 | Ga0209673_1000019 | 3300025273 | Bacteria | 449094 |
| 247 | Ga0209673_1005407 | 3300025273 | Bacteria | 6434 |
| 248 | Ga0209130_1000179 | 3300025284 | Bacteria | 90126 |
| 249 | Ga0209130_1001179 | 3300025284 | Bacteria | 18686 |
| 250 | Ga0209130_1002928 | 3300025284 | Bacteria | 7800 |
| 251 | Ga0209675_1000028 | 3300025291 | Bacteria | 281253 |
| 252 | Ga0209675_1002184 | 3300025291 | Bacteria | 10263 |
| 253 | Ga0209675_1007135 | 3300025291 | Bacteria | 4337 |
| 254 | Ga0209564_1000058 | 3300025295 | Bacteria | 332955 |
| 255 | Ga0209564_1000376 | 3300025295 | Bacteria | 82120 |
| 256 | Ga0209564_1004759 | 3300025295 | Bacteria | 8116 |
| 257 | Ga0209564_1010338 | 3300025295 | Bacteria | 4311 |
| 258 | Ga0209758_1000166 | 3300025297 | Bacteria | 151104 |
| 259 | Ga0209050_1000446 | 3300025298 | Bacteria | 74770 |
| 260 | Ga0209050_1002114 | 3300025298 | Bacteria | 18120 |
| 261 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 262 | Ga0209256_1000052 | 3300025299 | Bacteria | 299374 |
| 263 | Ga0209256_1001352 | 3300025299 | Bacteria | 25972 |
| 264 | Ga0209256_1002086 | 3300025299 | Bacteria | 17544 |
| 265 | Ga0209256_1003952 | 3300025299 | Bacteria | 9749 |
| 266 | Ga0209256_1005512 | 3300025299 | Bacteria | 7242 |
| 267 | Ga0207426_1003167 | 3300025302 | Bacteria | 9303 |
| 268 | Ga0209257_1000107 | 3300025304 | Bacteria | 240937 |
| 269 | Ga0209257_1006960 | 3300025304 | Bacteria | 7046 |
| 270 | Ga0207656_10004985 | 3300025321 | Bacteria | 4663 |
| 271 | Ga0207655_1003226 | 3300025728 | Bacteria | 12257 |
| 272 | Ga0207682_10003680 | 3300025893 | Bacteria | 6607 |
| 273 | Ga0207682_10059372 | 3300025893 | Bacteria | 1598 |
| 274 | Ga0207692_10104170 | 3300025898 | Bacteria | 1563 |
| 275 | Ga0207680_10038250 | 3300025903 | Bacteria | 2777 |
| 276 | Ga0207645_10077657 | 3300025907 | Bacteria | 2127 |
| 277 | Ga0207645_10079070 | 3300025907 | Bacteria | 2108 |
| 278 | Ga0207645_10251852 | 3300025907 | Bacteria | 1168 |
| 279 | Ga0207705_10007611 | 3300025909 | Bacteria | 7964 |
| 280 | Ga0207654_10052489 | 3300025911 | Bacteria | 2350 |
| 281 | Ga0207707_10004822 | 3300025912 | Bacteria | 11829 |
| 282 | Ga0207707_10040451 | 3300025912 | Bacteria | 4071 |
| 283 | Ga0207707_10056798 | 3300025912 | Bacteria | 3406 |
| 284 | Ga0207695_10030443 | 3300025913 | Bacteria | 5940 |
| 285 | Ga0207660_10126896 | 3300025917 | Bacteria | 1938 |
| 286 | Ga0207660_10401874 | 3300025917 | Bacteria | 1103 |
| 287 | Ga0207662_10070866 | 3300025918 | Bacteria | 2109 |
| 288 | Ga0207662_10161066 | 3300025918 | Bacteria | 1433 |
| 289 | Ga0207662_10194293 | 3300025918 | Bacteria | 1311 |
| 290 | Ga0207657_10035388 | 3300025919 | Bacteria | 4478 |
| 291 | Ga0207649_10001756 | 3300025920 | Bacteria | 12435 |
| 292 | Ga0207649_10141915 | 3300025920 | Bacteria | 1645 |
| 293 | Ga0207646_10081660 | 3300025922 | Bacteria | 2890 |
| 294 | Ga0207681_10099904 | 3300025923 | Bacteria | 2090 |
| 295 | Ga0207650_10001124 | 3300025925 | Bacteria | 19682 |
| 296 | Ga0207650_10022663 | 3300025925 | Bacteria | 4447 |
| 297 | Ga0207650_10054076 | 3300025925 | Bacteria | 2977 |
| 298 | Ga0207650_10136255 | 3300025925 | Bacteria | 1926 |
| 299 | Ga0207650_10161299 | 3300025925 | Bacteria | 1777 |
| 300 | Ga0207659_10001282 | 3300025926 | Bacteria | 15015 |
| 301 | Ga0207644_10001590 | 3300025931 | Bacteria | 14666 |
| 302 | Ga0207644_10016901 | 3300025931 | Bacteria | 4915 |
| 303 | Ga0207690_10005703 | 3300025932 | Bacteria | 7354 |
| 304 | Ga0207690_10322267 | 3300025932 | Bacteria | 1215 |
| 305 | Ga0207706_10017591 | 3300025933 | Bacteria | 6441 |
| 306 | Ga0207686_10036749 | 3300025934 | Bacteria | 2951 |
| 307 | Ga0207686_10186863 | 3300025934 | Bacteria | 1474 |
| 308 | Ga0207709_10023687 | 3300025935 | Bacteria | 3497 |
| 309 | Ga0207709_10053600 | 3300025935 | Bacteria | 2482 |
| 310 | Ga0207670_10006847 | 3300025936 | Bacteria | 6343 |
| 311 | Ga0207670_10062351 | 3300025936 | Bacteria | 2548 |
| 312 | Ga0207669_10043114 | 3300025937 | Bacteria | 2640 |
| 313 | Ga0207669_10064597 | 3300025937 | Bacteria | 2266 |
| 314 | Ga0207704_10072158 | 3300025938 | Bacteria | 2193 |
| 315 | Ga0207691_10000043 | 3300025940 | Bacteria | 102398 |
| 316 | Ga0207691_10003270 | 3300025940 | Bacteria | 15785 |
| 317 | Ga0207691_10106928 | 3300025940 | Bacteria | 2491 |
| 318 | Ga0207691_10143671 | 3300025940 | Bacteria | 2101 |
| 319 | Ga0207711_10001630 | 3300025941 | Bacteria | 20705 |
| 320 | Ga0207711_10018943 | 3300025941 | Bacteria | 5725 |
| 321 | Ga0207711_10070604 | 3300025941 | Bacteria | 3029 |
| 322 | Ga0207689_10002924 | 3300025942 | Bacteria | 15766 |
| 323 | Ga0207689_10012333 | 3300025942 | Bacteria | 7312 |
| 324 | Ga0207689_10026317 | 3300025942 | Bacteria | 4871 |
| 325 | Ga0207689_10050097 | 3300025942 | Bacteria | 3444 |
| 326 | Ga0207689_10302794 | 3300025942 | Bacteria | 1325 |
| 327 | Ga0207689_10354906 | 3300025942 | Bacteria | 1219 |
| 328 | Ga0207661_10000832 | 3300025944 | Bacteria | 20212 |
| 329 | Ga0207679_10000574 | 3300025945 | Bacteria | 24632 |
| 330 | Ga0207679_10002762 | 3300025945 | Bacteria | 10865 |
| 331 | Ga0207667_10064465 | 3300025949 | Bacteria | 3825 |
| 332 | Ga0207651_10002825 | 3300025960 | Bacteria | 8357 |
| 333 | Ga0207651_10122166 | 3300025960 | Bacteria | 1977 |
| 334 | Ga0207712_10116839 | 3300025961 | Bacteria | 2011 |
| 335 | Ga0207712_10199320 | 3300025961 | Bacteria | 1586 |
| 336 | Ga0207658_10246085 | 3300025986 | Bacteria | 1517 |
| 337 | Ga0207658_10425434 | 3300025986 | Bacteria | 1172 |
| 338 | Ga0207677_10000839 | 3300026023 | Bacteria | 17561 |
| 339 | Ga0207677_10087689 | 3300026023 | Bacteria | 2254 |
| 340 | Ga0207677_10213360 | 3300026023 | Bacteria | 1543 |
| 341 | Ga0207703_10018380 | 3300026035 | Bacteria | 5458 |
| 342 | Ga0207703_10243871 | 3300026035 | Bacteria | 1616 |
| 343 | Ga0207678_10175595 | 3300026067 | Bacteria | 1829 |
| 344 | Ga0207708_10005891 | 3300026075 | Bacteria | 9065 |
| 345 | Ga0207708_10007712 | 3300026075 | Bacteria | 7967 |
| 346 | Ga0207708_10053999 | 3300026075 | Bacteria | 3062 |
| 347 | Ga0207708_10055683 | 3300026075 | Bacteria | 3016 |
| 348 | Ga0207702_10060270 | 3300026078 | Bacteria | 3235 |
| 349 | Ga0207641_10054803 | 3300026088 | Bacteria | 3385 |
| 350 | Ga0207641_10077107 | 3300026088 | Bacteria | 2883 |
| 351 | Ga0207648_10001650 | 3300026089 | Bacteria | 24468 |
| 352 | Ga0207648_10005604 | 3300026089 | Bacteria | 12626 |
| 353 | Ga0207648_10010589 | 3300026089 | Bacteria | 8722 |
| 354 | Ga0207648_10021954 | 3300026089 | Bacteria | 5734 |
| 355 | Ga0207648_10211067 | 3300026089 | Bacteria | 1724 |
| 356 | Ga0207648_10262162 | 3300026089 | Bacteria | 1542 |
| 357 | Ga0207676_10002671 | 3300026095 | Bacteria | 12671 |
| 358 | Ga0207675_100007805 | 3300026118 | Bacteria | 10096 |
| 359 | Ga0207675_100009401 | 3300026118 | Bacteria | 9160 |
| 360 | Ga0207675_100039483 | 3300026118 | Bacteria | 4405 |
| 361 | Ga0207675_100216812 | 3300026118 | Bacteria | 1843 |
| 362 | Ga0207683_10000091 | 3300026121 | Bacteria | 72654 |
| 363 | Ga0207683_10061271 | 3300026121 | Bacteria | 3311 |
| 364 | Ga0207683_10185039 | 3300026121 | Bacteria | 1890 |
| 365 | Ga0207683_10441601 | 3300026121 | Bacteria | 1199 |
| 366 | Ga0207698_10000303 | 3300026142 | Bacteria | 29530 |
| 367 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 368 | Ga0209966_1003408 | 3300027695 | Bacteria | 2673 |
| 369 | Ga0207428_10179339 | 3300027907 | Bacteria | 1601 |
| 370 | Ga0268266_10018807 | 3300028379 | Bacteria | 5887 |
| 371 | Ga0268266_10106420 | 3300028379 | Bacteria | 2479 |
| 372 | Ga0268266_10115900 | 3300028379 | Bacteria | 2379 |
| 373 | Ga0268266_10172793 | 3300028379 | Bacteria | 1962 |
| 374 | Ga0268265_10060865 | 3300028380 | Bacteria | 2895 |
| 375 | Ga0268265_10067478 | 3300028380 | Bacteria | 2769 |
| 376 | Ga0268265_10101630 | 3300028380 | Bacteria | 2323 |
| 377 | Ga0265318_10024589 | 3300028577 | Bacteria | 2387 |
| 378 | Ga0316180_1109577 | 3300030736 | Bacteria | 4462 |
| 379 | Ga0265330_10004213 | 3300031235 | Bacteria | 7335 |
| 380 | Ga0265332_10002783 | 3300031238 | Bacteria | 8695 |
| 381 | Ga0265328_10001439 | 3300031239 | Bacteria | 10959 |
| 382 | Ga0265328_10009570 | 3300031239 | Bacteria | 3941 |
| 383 | Ga0265325_10145424 | 3300031241 | Bacteria | 1125 |
| 384 | Ga0265329_10003330 | 3300031242 | Bacteria | 7028 |
| 385 | Ga0265331_10011063 | 3300031250 | Bacteria | 4950 |
| 386 | Ga0265327_10041394 | 3300031251 | Bacteria | 2484 |
| 387 | Ga0265316_10025384 | 3300031344 | Bacteria | 4946 |
| 388 | Ga0265316_10067899 | 3300031344 | Bacteria | 2756 |
| 389 | Ga0307513_10049717 | 3300031456 | Bacteria | 4539 |
| 390 | Ga0307513_10095992 | 3300031456 | Bacteria | 3004 |
| 391 | Ga0307513_10227853 | 3300031456 | Bacteria | 1678 |
| 392 | Ga0307509_10020099 | 3300031507 | Bacteria | 7590 |
| 393 | Ga0307408_100000103 | 3300031548 | Bacteria | 93203 |
| 394 | Ga0307408_100009488 | 3300031548 | Bacteria | 6419 |
| 395 | Ga0307408_100019827 | 3300031548 | Bacteria | 4529 |
| 396 | Ga0307408_100021031 | 3300031548 | Bacteria | 4410 |
| 397 | Ga0265313_10078270 | 3300031595 | Bacteria | 1508 |
| 398 | Ga0316575_10001963 | 3300031665 | Bacteria | 6816 |
| 399 | Ga0265314_10002821 | 3300031711 | Bacteria | 17326 |
| 400 | Ga0265314_10010351 | 3300031711 | Bacteria | 7787 |
| 401 | Ga0265342_10009537 | 3300031712 | Bacteria | 6823 |
| 402 | Ga0316576_10117649 | 3300031727 | Bacteria | 1994 |
| 403 | Ga0307405_10341956 | 3300031731 | Bacteria | 1151 |
| 404 | Ga0316577_10112474 | 3300031733 | Bacteria | 1528 |
| 405 | Ga0307413_10025670 | 3300031824 | Bacteria | 3234 |
| 406 | Ga0307413_10049951 | 3300031824 | Bacteria | 2510 |
| 407 | Ga0307410_10003260 | 3300031852 | Bacteria | 8104 |
| 408 | Ga0307410_10026068 | 3300031852 | Bacteria | 3674 |
| 409 | Ga0307409_100045785 | 3300031995 | Bacteria | 3306 |
| 410 | Ga0307416_100144212 | 3300032002 | Bacteria | 2171 |
| 411 | Ga0307416_100309129 | 3300032002 | Bacteria | 1576 |
| 412 | Ga0307411_10002266 | 3300032005 | Bacteria | 8409 |
| 413 | Ga0307411_10174919 | 3300032005 | Bacteria | 1623 |
| 414 | Ga0373934_0000134 | 3300035086 | Bacteria | 27424 |
| 415 | Ga0373944_0072262 | 3300035089 | Bacteria | 1126 |
| 416 | Ga0373954_0005310 | 3300035118 | Bacteria | 5566 |
| 417 | Ga0373954_0048164 | 3300035118 | Bacteria | 1996 |
| 418 | Ga0373956_0000006 | 3300035119 | Bacteria | 65782 |
| 419 | Ga0373956_0008199 | 3300035119 | Bacteria | 4228 |
| 420 | Ga0373955_0007451 | 3300035172 | Bacteria | 5032 |
| 421 | Ga0373955_0012679 | 3300035172 | Bacteria | 4056 |
| 422 | Ga0316574_0023043 | 3300035398 | Bacteria | 3714 |
| 423 | Ga0373931_0174656 | 3300035691 | Bacteria | 1268 |
| 424 | Ga0373935_0036070 | 3300035692 | Bacteria | 3089 |
| 425 | Ga0373927_0004491 | 3300035695 | Bacteria | 9764 |
| 426 | Ga0373933_0000564 | 3300035724 | Bacteria | 23136 |
| 427 | Ga0373937_0003219 | 3300036401 | Bacteria | 13673 |
| 428 | Ga0316584_0022111 | 3300036712 | Bacteria | 4634 |
| 429 | Ga0373925_0007446 | 3300037068 | Bacteria | 7987 |
| 430 | Ga0395899_0000344 | 3300037312 | Bacteria | 57423 |
| 431 | Ga0395900_0064859 | 3300037418 | Bacteria | 3752 |
| 432 | Ga0395900_0077918 | 3300037418 | Bacteria | 3405 |
| 433 | Ga0395900_0180285 | 3300037418 | Bacteria | 2147 |
| 434 | Ga0395905_0006025 | 3300037471 | Bacteria | 12275 |
| 435 | Ga0395905_0009860 | 3300037471 | Bacteria | 9310 |
| 436 | Ga0395905_0011146 | 3300037471 | Bacteria | 8693 |
| 437 | Ga0395901_0000533 | 3300038443 | Bacteria | 43906 |
| 438 | Ga0436361_0314082 | 3300039447 | Bacteria | 3272 |
| 439 | Ga0451807_2141541 | 3300041486 | Bacteria | 2311 |
| 440 | Ga0451835_1197999 | 3300041492 | Bacteria | 1420 |
| 441 | Ga0451841_0390070 | 3300041498 | Bacteria | 2605 |
| 442 | Ga0451851_0647212 | 3300041507 | Bacteria | 2358 |
| 443 | Ga0451853_3612137 | 3300041512 | Bacteria | 1615 |
| 444 | Ga0451577_0005356 | 3300042876 | Bacteria | 13163 |
| 445 | Ga0451577_0020957 | 3300042876 | Bacteria | 5991 |
| 446 | Ga0451577_0049802 | 3300042876 | Bacteria | 3740 |
| 447 | Ga0451577_0077190 | 3300042876 | Bacteria | 2970 |
| 448 | Ga0466972_0000070 | 3300044658 | Bacteria | 100242 |
| 449 | Ga0466972_0034493 | 3300044658 | Bacteria | 2479 |
| 450 | Ga0466965_0001667 | 3300044683 | Bacteria | 9113 |
| 451 | Ga0466965_0011675 | 3300044683 | Bacteria | 4120 |
| 452 | Ga0466966_0068935 | 3300044684 | Bacteria | 2219 |
| 453 | Ga0466964_0070986 | 3300044706 | Bacteria | 1472 |
| 454 | Ga0453684_0121483 | 3300044712 | Bacteria | 3152 |
| 455 | Ga0453684_0131363 | 3300044712 | Bacteria | 3004 |
| 456 | Ga0466970_0007209 | 3300044765 | Bacteria | 5569 |
| 457 | Ga0466970_0029818 | 3300044765 | Bacteria | 2875 |
| 458 | Ga0466959_0006523 | 3300045049 | Bacteria | 8093 |
| 459 | Ga0451576_0033607 | 3300045051 | Bacteria | 5452 |
| 460 | Ga0495627_000005 | 3300046453 | Bacteria | 630805 |
| 461 | Ga0495592_0063301 | 3300046454 | Bacteria | 2713 |
| 462 | Ga0495590_0001849 | 3300046457 | Bacteria | 8955 |
| 463 | Ga0495590_0004337 | 3300046457 | Bacteria | 5736 |
| 464 | Ga0495590_0073995 | 3300046457 | Bacteria | 1198 |
| 465 | Ga0495638_0005242 | 3300046460 | Bacteria | 9684 |
| 466 | Ga0495638_0024357 | 3300046460 | Bacteria | 3947 |
| 467 | Ga0495638_0043295 | 3300046460 | Bacteria | 2841 |
| 468 | Ga0495638_0099950 | 3300046460 | Bacteria | 1736 |
| 469 | Ga0495638_0117859 | 3300046460 | Bacteria | 1571 |
| 470 | Ga0495641_0002246 | 3300046461 | Bacteria | 15388 |
| 471 | Ga0495651_0000233 | 3300046462 | Bacteria | 42757 |
| 472 | Ga0495651_0000919 | 3300046462 | Bacteria | 22867 |
| 473 | Ga0495651_0095122 | 3300046462 | Bacteria | 2228 |
| 474 | Ga0495651_0169961 | 3300046462 | Bacteria | 1553 |
| 475 | Ga0495653_0048971 | 3300046463 | Bacteria | 3258 |
| 476 | Ga0495653_0049498 | 3300046463 | Bacteria | 3236 |
| 477 | Ga0495650_0000928 | 3300046471 | Bacteria | 34124 |
| 478 | Ga0495650_0003015 | 3300046471 | Bacteria | 12708 |
| 479 | Ga0495650_0010815 | 3300046471 | Bacteria | 5061 |
| 480 | Ga0495580_0043976 | 3300046472 | Bacteria | 3177 |
| 481 | Ga0495605_0015313 | 3300046474 | Bacteria | 4174 |
| 482 | Ga0495639_0001153 | 3300046475 | Bacteria | 11928 |
| 483 | Ga0495664_0029766 | 3300046477 | Bacteria | 3195 |
| 484 | Ga0495584_0001921 | 3300046491 | Bacteria | 11946 |
| 485 | Ga0495596_0002046 | 3300046500 | Bacteria | 11073 |
| 486 | Ga0495607_0046699 | 3300046501 | Bacteria | 2540 |
| 487 | Ga0495607_0049245 | 3300046501 | Bacteria | 2458 |
| 488 | Ga0495583_0009024 | 3300046506 | Bacteria | 6008 |
| 489 | Ga0495606_0000068 | 3300046507 | Bacteria | 179653 |
| 490 | Ga0495606_0016860 | 3300046507 | Bacteria | 5548 |
| 491 | Ga0495608_0005915 | 3300046511 | Bacteria | 8701 |
| 492 | Ga0495608_0109247 | 3300046511 | Bacteria | 1778 |
| 493 | Ga0495610_0006855 | 3300046512 | Bacteria | 7723 |
| 494 | Ga0495616_0000120 | 3300046513 | Bacteria | 68995 |
| 495 | Ga0495616_0002633 | 3300046513 | Bacteria | 11806 |
| 496 | Ga0495616_0021729 | 3300046513 | Bacteria | 3470 |
| 497 | Ga0495616_0027697 | 3300046513 | Bacteria | 3005 |
| 498 | Ga0495616_0028538 | 3300046513 | Bacteria | 2954 |
| 499 | Ga0495618_0040435 | 3300046514 | Bacteria | 2934 |
| 500 | Ga0495628_0001623 | 3300046516 | Bacteria | 20598 |
| 501 | Ga0495628_0002192 | 3300046516 | Bacteria | 17666 |
| 502 | Ga0495628_0035967 | 3300046516 | Bacteria | 3977 |
| 503 | Ga0495630_0020406 | 3300046517 | Bacteria | 4885 |
| 504 | Ga0495631_0000103 | 3300046518 | Bacteria | 55680 |
| 505 | Ga0495632_0003558 | 3300046519 | Bacteria | 11008 |
| 506 | Ga0495637_0000364 | 3300046520 | Bacteria | 34551 |
| 507 | Ga0495637_0022686 | 3300046520 | Bacteria | 2860 |
| 508 | Ga0495643_0000449 | 3300046522 | Bacteria | 52833 |
| 509 | Ga0495643_0001738 | 3300046522 | Bacteria | 18789 |
| 510 | Ga0495643_0004000 | 3300046522 | Bacteria | 10530 |
| 511 | Ga0495648_0019050 | 3300046524 | Bacteria | 4840 |
| 512 | Ga0495648_0046801 | 3300046524 | Bacteria | 2678 |
| 513 | Ga0495666_0004375 | 3300046526 | Bacteria | 7136 |
| 514 | Ga0495642_0026858 | 3300046528 | Bacteria | 2289 |
| 515 | Ga0495642_0059312 | 3300046528 | Bacteria | 1586 |
| 516 | Ga0495652_0021749 | 3300046529 | Bacteria | 5702 |
| 517 | Ga0495652_0100027 | 3300046529 | Bacteria | 2353 |
| 518 | Ga0495654_0000074 | 3300046530 | Bacteria | 114325 |
| 519 | Ga0495654_0033672 | 3300046530 | Bacteria | 2591 |
| 520 | Ga0495665_0013316 | 3300046531 | Bacteria | 4450 |
| 521 | Ga0495640_0091867 | 3300046533 | Bacteria | 2002 |
| 522 | Ga0495586_0004382 | 3300046535 | Bacteria | 7545 |
| 523 | Ga0495586_0147107 | 3300046535 | Bacteria | 1324 |
| 524 | Ga0495587_0142644 | 3300046536 | Bacteria | 1366 |
| 525 | Ga0495587_0201821 | 3300046536 | Bacteria | 1124 |
| 526 | Ga0495609_0000560 | 3300046538 | Bacteria | 29330 |
| 527 | Ga0495609_0002919 | 3300046538 | Bacteria | 10170 |
| 528 | Ga0495609_0023933 | 3300046538 | Bacteria | 2803 |
| 529 | Ga0495597_0001279 | 3300046542 | Bacteria | 18545 |
| 530 | Ga0495645_0128434 | 3300046543 | Bacteria | 1779 |
| 531 | Ga0495645_0153163 | 3300046543 | Bacteria | 1600 |
| 532 | Ga0495667_0002319 | 3300046559 | Bacteria | 12751 |
| 533 | Ga0495667_0013455 | 3300046559 | Bacteria | 5539 |
| 534 | Ga0495656_0012735 | 3300046615 | Bacteria | 3112 |
| 535 | Ga0495668_0000063 | 3300046616 | Bacteria | 184563 |
| 536 | Ga0495668_0000980 | 3300046616 | Bacteria | 31179 |
| 537 | Ga0495634_0014557 | 3300046642 | Bacteria | 5669 |
| 538 | Ga0495625_0022293 | 3300046660 | Bacteria | 4859 |
| 539 | Ga0495625_0034951 | 3300046660 | Bacteria | 3707 |
| 540 | Ga0495625_0042547 | 3300046660 | Bacteria | 3300 |
| 541 | Ga0495625_0079339 | 3300046660 | Bacteria | 2289 |
| 542 | Ga0495625_0082434 | 3300046660 | Bacteria | 2237 |
| 543 | Ga0495625_0086400 | 3300046660 | Bacteria | 2176 |
| 544 | Ga0495625_0190022 | 3300046660 | Bacteria | 1361 |
| 545 | Ga0495635_0013574 | 3300046663 | Bacteria | 5700 |
| 546 | Ga0495659_0000722 | 3300046664 | Bacteria | 11879 |
| 547 | Ga0495661_0004218 | 3300046665 | Bacteria | 10442 |
| 548 | Ga0495657_0009456 | 3300046675 | Bacteria | 7382 |
| 549 | Ga0495657_0176750 | 3300046675 | Bacteria | 1312 |
| 550 | Ga0495599_0144058 | 3300046678 | Bacteria | 1477 |
| 551 | Ga0495646_0002836 | 3300046680 | Bacteria | 10723 |
| 552 | Ga0495658_0072539 | 3300046683 | Bacteria | 2002 |
| 553 | Ga0495669_0004496 | 3300046684 | Bacteria | 5763 |
| 554 | Ga0495613_0019470 | 3300046689 | Bacteria | 5058 |
| 555 | Ga0495624_0020569 | 3300046690 | Bacteria | 4388 |
| 556 | Ga0495649_0002697 | 3300046694 | Bacteria | 12365 |
| 557 | Ga0495649_0007818 | 3300046694 | Bacteria | 6480 |
| 558 | Ga0495589_0005491 | 3300046794 | Bacteria | 6687 |
| 559 | Ga0495600_0001936 | 3300046809 | Bacteria | 11633 |
| 560 | Ga0495600_0196981 | 3300046809 | Bacteria | 1294 |
| 561 | Ga0495660_0001203 | 3300046810 | Bacteria | 18117 |
| 562 | Ga0495660_0069945 | 3300046810 | Bacteria | 1864 |
| 563 | Ga0495604_0048140 | 3300047317 | Bacteria | 3316 |
| 564 | Ga0495636_0005147 | 3300047318 | Bacteria | 5132 |
| 565 | Ga0495636_0076114 | 3300047318 | Bacteria | 1439 |
| 566 | Ga0495674_0003032 | 3300047319 | Bacteria | 16351 |
| 567 | Ga0495672_0000956 | 3300047320 | Bacteria | 30049 |
| 568 | Ga0495683_0040575 | 3300047323 | Bacteria | 2351 |
| 569 | Ga0495687_002155 | 3300047443 | Bacteria | 16431 |
| 570 | Ga0495687_004211 | 3300047443 | Bacteria | 9868 |
| 571 | Ga0495675_0001126 | 3300047444 | Bacteria | 16251 |
| 572 | Ga0495677_0002777 | 3300047445 | Bacteria | 6830 |
| 573 | Ga0495679_011995 | 3300047446 | Bacteria | 3323 |
| 574 | Ga0495685_006228 | 3300047447 | Bacteria | 3902 |
| 575 | Ga0495685_019891 | 3300047447 | Bacteria | 2307 |
| 576 | Ga0495681_0022851 | 3300047470 | Bacteria | 3336 |
| 577 | Ga0495684_0145196 | 3300047471 | Bacteria | 1777 |
| 578 | Ga0495686_0001174 | 3300047472 | Bacteria | 30574 |
| 579 | Ga0495686_0002601 | 3300047472 | Bacteria | 16742 |
| 580 | Ga0495686_0038907 | 3300047472 | Bacteria | 3040 |
| 581 | Ga0495626_0015026 | 3300048091 | Bacteria | 3968 |
| 582 | Ga0495626_0071450 | 3300048091 | Bacteria | 1559 |
| 583 | Ga0496101_0121877 | 3300048904 | Bacteria | 1972 |
| 584 | Ga0496101_0137002 | 3300048904 | Bacteria | 1863 |
| 585 | Ga0496102_0295027 | 3300048905 | Bacteria | 1528 |
| 586 | Ga0496104_0045265 | 3300048907 | Bacteria | 4138 |
| 587 | Ga0496104_0200458 | 3300048907 | Bacteria | 1908 |
| 588 | Ga0496105_0042336 | 3300048908 | Bacteria | 3754 |
| 589 | Ga0496105_0121664 | 3300048908 | Bacteria | 2152 |
| 590 | Ga0496107_0179040 | 3300048910 | Bacteria | 1574 |
| 591 | Ga0496108_0040465 | 3300048911 | Bacteria | 3886 |
| 592 | Ga0496108_0041766 | 3300048911 | Bacteria | 3830 |
| 593 | Ga0496109_0007070 | 3300048912 | Bacteria | 9473 |
| 594 | Ga0496109_0113152 | 3300048912 | Bacteria | 2524 |
| 595 | Ga0496109_0122303 | 3300048912 | Bacteria | 2425 |
| 596 | Ga0496110_0000225 | 3300048913 | Bacteria | 36623 |
| 597 | Ga0496110_0335371 | 3300048913 | Bacteria | 1378 |
| 598 | Ga0496111_0290071 | 3300048914 | Bacteria | 1213 |
| 599 | Ga0496112_0008077 | 3300048915 | Bacteria | 9397 |
| 600 | Ga0496113_0060816 | 3300048916 | Bacteria | 2849 |
| 601 | Ga0496114_0020108 | 3300048917 | Bacteria | 5416 |
| 602 | Ga0496114_0028930 | 3300048917 | Bacteria | 4552 |
| 603 | Ga0496114_0101027 | 3300048917 | Bacteria | 2462 |
| 604 | Ga0496114_0131732 | 3300048917 | Bacteria | 2160 |
| 605 | Ga0496114_0254535 | 3300048917 | Bacteria | 1545 |
| 606 | Ga0496121_0117941 | 3300048924 | Bacteria | 2010 |
| 607 | Ga0496124_0026196 | 3300048927 | Bacteria | 5263 |
| 608 | Ga0496124_0029862 | 3300048927 | Bacteria | 4849 |
| 609 | Ga0496125_0007840 | 3300048928 | Bacteria | 11284 |
| 610 | Ga0496126_0118001 | 3300048929 | Bacteria | 2304 |
| 611 | Ga0495678_001239 | 3300049459 | Bacteria | 20765 |
| 612 | Ga0495678_048808 | 3300049459 | Bacteria | 1649 |
| 613 | Ga0501032_0280685 | 3300049569 | Bacteria | 1078 |
| 614 | Ga0501034_0002533 | 3300049571 | Bacteria | 21868 |
| 615 | Ga0501036_0040050 | 3300049572 | Bacteria | 3963 |
| 616 | Ga0501038_0026175 | 3300049574 | Bacteria | 5197 |
| 617 | Ga0501038_0056844 | 3300049574 | Bacteria | 3360 |
| 618 | Ga0501038_0171667 | 3300049574 | Bacteria | 1755 |
| 619 | Ga0501039_0057697 | 3300049575 | Bacteria | 3006 |
| 620 | Ga0501039_0168339 | 3300049575 | Bacteria | 1723 |
| 621 | Ga0501040_0018261 | 3300049576 | Bacteria | 4656 |
| 622 | Ga0501040_0123248 | 3300049576 | Bacteria | 1819 |
| 623 | Ga0501041_0026896 | 3300049577 | Bacteria | 3464 |
| 624 | Ga0501042_0007566 | 3300049578 | Bacteria | 7127 |
| 625 | Ga0501042_0102593 | 3300049578 | Bacteria | 2058 |
| 626 | Ga0501042_0225916 | 3300049578 | Bacteria | 1350 |
| 627 | Ga0501043_0127402 | 3300049579 | Bacteria | 1996 |
| 628 | Ga0501043_0273588 | 3300049579 | Bacteria | 1296 |
| 629 | Ga0501048_0164771 | 3300049582 | Bacteria | 1569 |
| 630 | Ga0501067_0100704 | 3300049583 | Bacteria | 1605 |
| 631 | Ga0501068_0000871 | 3300049584 | Bacteria | 15718 |
| 632 | Ga0501068_0001556 | 3300049584 | Bacteria | 12190 |
| 633 | Ga0501068_0140766 | 3300049584 | Bacteria | 1512 |
| 634 | Ga0501069_0224266 | 3300049585 | Bacteria | 1093 |
| 635 | Ga0501070_0010805 | 3300049586 | Bacteria | 7713 |
| 636 | Ga0501071_0028011 | 3300049587 | Bacteria | 3967 |
| 637 | Ga0501071_0042307 | 3300049587 | Bacteria | 3264 |
| 638 | Ga0501072_0003671 | 3300049588 | Bacteria | 11569 |
| 639 | Ga0501072_0007982 | 3300049588 | Bacteria | 8033 |
| 640 | Ga0501073_0000354 | 3300049589 | Bacteria | 30944 |
| 641 | Ga0501073_0003155 | 3300049589 | Bacteria | 12358 |
| 642 | Ga0501074_0000312 | 3300049590 | Bacteria | 28193 |
| 643 | Ga0501074_0052117 | 3300049590 | Bacteria | 2954 |
| 644 | Ga0501074_0134830 | 3300049590 | Bacteria | 1766 |
| 645 | Ga0501075_0001010 | 3300049591 | Bacteria | 17996 |
| 646 | Ga0501075_0016348 | 3300049591 | Bacteria | 5342 |
| 647 | Ga0501075_0023259 | 3300049591 | Bacteria | 4536 |
| 648 | Ga0501075_0050895 | 3300049591 | Bacteria | 3114 |
| 649 | Ga0501076_0007929 | 3300049592 | Bacteria | 7745 |
| 650 | Ga0501076_0013750 | 3300049592 | Bacteria | 6073 |
| 651 | Ga0501076_0078677 | 3300049592 | Bacteria | 2646 |
| 652 | Ga0501077_0007924 | 3300049593 | Bacteria | 6563 |
| 653 | Ga0501227_028380 | 3300049665 | Bacteria | 1329 |
| 654 | Ga0501079_0000416 | 3300049741 | Bacteria | 27691 |
| 655 | Ga0501079_0004121 | 3300049741 | Bacteria | 10754 |
| 656 | Ga0501079_0005114 | 3300049741 | Bacteria | 9743 |
| 657 | Ga0501079_0019011 | 3300049741 | Bacteria | 5249 |
| 658 | Ga0501079_0284439 | 3300049741 | Bacteria | 1293 |
| 659 | Ga0501080_0012130 | 3300049742 | Bacteria | 7895 |
| 660 | Ga0501080_0015303 | 3300049742 | Bacteria | 7071 |
| 661 | Ga0501080_0070202 | 3300049742 | Bacteria | 3258 |
| 662 | Ga0501080_0151655 | 3300049742 | Bacteria | 2142 |
| 663 | Ga0501080_0152715 | 3300049742 | Bacteria | 2134 |
| 664 | Ga0501080_0290183 | 3300049742 | Bacteria | 1485 |
| 665 | Ga0501081_0003335 | 3300049743 | Bacteria | 10211 |
| 666 | Ga0501081_0043473 | 3300049743 | Bacteria | 3082 |
| 667 | Ga0501083_0298257 | 3300049744 | Bacteria | 1048 |
| 668 | Ga0501279_000908 | 3300049775 | Bacteria | 3905 |
| 669 | Ga0501035_0110077 | 3300049822 | Bacteria | 2414 |
| 670 | Ga0501044_0217377 | 3300049823 | Bacteria | 1863 |
| 671 | Ga0501044_0334001 | 3300049823 | Bacteria | 1438 |
| 672 | Ga0501045_0001888 | 3300049824 | Bacteria | 14189 |
| 673 | Ga0501045_0027039 | 3300049824 | Bacteria | 4131 |
| 674 | nmdc:mga0qj67_114492_c1 | 3300050509 | Bacteria | 2178 |
| 675 | nmdc:mga0qj67_136015_c1 | 3300050509 | Bacteria | 1991 |
| 676 | nmdc:mga08y16_145811_c1 | 3300050511 | Bacteria | 2461 |
| 677 | nmdc:mga08y16_171501_c1 | 3300050511 | Bacteria | 2253 |
| 678 | nmdc:mga08y16_177040_c1 | 3300050511 | Bacteria | 2215 |
| 679 | nmdc:mga08y16_55212_c1 | 3300050511 | Bacteria | 4151 |
| 680 | nmdc:mga0rr50_202657_c1 | 3300050513 | Bacteria | 1631 |
| 681 | nmdc:mga08x19_218752_c1 | 3300050514 | Bacteria | 1308 |
| 682 | nmdc:mga0a205_61625_c1 | 3300050515 | Bacteria | 3623 |
| 683 | Ga0495601_0015834 | 3300053077 | Bacteria | 4564 |
| 684 | Ga0495595_0000317 | 3300053084 | Bacteria | 18797 |
| 685 | Ga0495619_0001741 | 3300053085 | Bacteria | 14446 |
| 686 | Ga0500595_005770 | 3300053119 | Bacteria | 5351 |
| 687 | Ga0500628_022306 | 3300053129 | Bacteria | 1294 |
| 688 | Ga0500616_0000032 | 3300053153 | Bacteria | 403673 |
| 689 | Ga0500619_001217 | 3300053154 | Bacteria | 4487 |
| 690 | Ga0501084_0003146 | 3300054114 | Bacteria | 13347 |
| 691 | Ga0501084_0005381 | 3300054114 | Bacteria | 10493 |
| 692 | Ga0501084_0025179 | 3300054114 | Bacteria | 4964 |
| 693 | Ga0501084_0211276 | 3300054114 | Bacteria | 1637 |
| 694 | Ga0501084_0215534 | 3300054114 | Bacteria | 1620 |
| 695 | Ga0501082_0011156 | 3300060353 | Bacteria | 7725 |
| 696 | Ga0501082_0014345 | 3300060353 | Bacteria | 6818 |
| 697 | Ga0530510_0001261 | 3300061734 | Bacteria | 16889 |
| 698 | Ga0530510_0001840 | 3300061734 | Bacteria | 14493 |
| 699 | Ga0530510_0149701 | 3300061734 | Bacteria | 1723 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050513 | nmdc:mga0rr50_202657_c1 | nmdc:mga0rr50_202657_c1_15_821 | 268 |
| 2 | 3300046536 | Ga0495587_0201821 | Ga0495587_0201821_248_1108 | 285 |
| 3 | 3300048091 | Ga0495626_0015026 | Ga0495626_0015026_16_876 | 285 |
| 4 | 3300049743 | Ga0501081_0003335 | Ga0501081_0003335_9342_10199 | 285 |
| 5 | 3300046660 | Ga0495625_0034951 | Ga0495625_0034951_370_1383 | 288 |
| 6 | 3300005842 | Ga0068858_100011447 | Ga0068858_1000114477 | 306 |
| 7 | 3300014325 | Ga0163163_10070857 | Ga0163163_100708572 | 306 |
| 8 | 3300014968 | Ga0157379_10037078 | Ga0157379_100370785 | 306 |
| 9 | 3300026035 | Ga0207703_10018380 | Ga0207703_100183804 | 306 |
| 10 | 3300046453 | Ga0495627_000005 | Ga0495627_000005_343270_344283 | 306 |
| 11 | 3300046460 | Ga0495638_0005242 | Ga0495638_0005242_2595_3596 | 306 |
| 12 | 3300046538 | Ga0495609_0000560 | Ga0495609_0000560_27242_28255 | 306 |
| 13 | 3300046810 | Ga0495660_0001203 | Ga0495660_0001203_2177_3190 | 306 |
| 14 | 3300005331 | Ga0070670_100108857 | Ga0070670_1001088573 | 309 |
| 15 | 3300025925 | Ga0207650_10161299 | Ga0207650_101612992 | 309 |
| 16 | 3300047318 | Ga0495636_0076114 | Ga0495636_0076114_11_1009 | 309 |
| 17 | 3300025728 | Ga0207655_1003226 | Ga0207655_100322610 | 310 |
| 18 | 3300005337 | Ga0070682_100002647 | Ga0070682_1000026476 | 311 |
| 19 | 3300046660 | Ga0495625_0086400 | Ga0495625_0086400_338_1339 | 311 |
| 20 | 3300046660 | Ga0495625_0190022 | Ga0495625_0190022_118_1119 | 311 |
| 21 | 3300049569 | Ga0501032_0280685 | Ga0501032_0280685_133_1068 | 311 |
| 22 | 3300049584 | Ga0501068_0140766 | Ga0501068_0140766_567_1502 | 311 |
| 23 | 3300049585 | Ga0501069_0224266 | Ga0501069_0224266_11_946 | 311 |
| 24 | 3300049591 | Ga0501075_0050895 | Ga0501075_0050895_2168_3103 | 311 |
| 25 | 3300049741 | Ga0501079_0284439 | Ga0501079_0284439_18_956 | 311 |
| 26 | 3300050511 | nmdc:mga08y16_55212_c1 | nmdc:mga08y16_55212_c1_11_949 | 311 |
| 27 | 3300054114 | Ga0501084_0215534 | Ga0501084_0215534_674_1609 | 311 |
| 28 | 3300046694 | Ga0495649_0007818 | Ga0495649_0007818_1739_2740 | 315 |
| 29 | 3300026089 | Ga0207648_10211067 | Ga0207648_102110671 | 317 |
| 30 | 3300041486 | Ga0451807_2141541 | Ga0451807_2141541_916_1917 | 317 |
| 31 | 3300005330 | Ga0070690_100059421 | Ga0070690_1000594212 | 318 |
| 32 | 3300005334 | Ga0068869_100088247 | Ga0068869_1000882474 | 318 |
| 33 | 3300005347 | Ga0070668_100071999 | Ga0070668_1000719994 | 318 |
| 34 | 3300005353 | Ga0070669_100302158 | Ga0070669_1003021582 | 318 |
| 35 | 3300005438 | Ga0070701_10193367 | Ga0070701_101933671 | 318 |
| 36 | 3300005466 | Ga0070685_10060074 | Ga0070685_100600741 | 318 |
| 37 | 3300005543 | Ga0070672_100051544 | Ga0070672_1000515444 | 318 |
| 38 | 3300005544 | Ga0070686_100336735 | Ga0070686_1003367351 | 318 |
| 39 | 3300005719 | Ga0068861_100150614 | Ga0068861_1001506143 | 318 |
| 40 | 3300005840 | Ga0068870_10050469 | Ga0068870_100504692 | 318 |
| 41 | 3300006237 | Ga0097621_100189541 | Ga0097621_1001895412 | 318 |
| 42 | 3300006881 | Ga0068865_100116468 | Ga0068865_1001164682 | 318 |
| 43 | 3300009148 | Ga0105243_10039431 | Ga0105243_100394313 | 318 |
| 44 | 3300009176 | Ga0105242_10100504 | Ga0105242_101005043 | 318 |
| 45 | 3300013296 | Ga0157374_10026122 | Ga0157374_100261222 | 318 |
| 46 | 3300013306 | Ga0163162_10364065 | Ga0163162_103640652 | 318 |
| 47 | 3300014326 | Ga0157380_10419890 | Ga0157380_104198901 | 318 |
| 48 | 3300014968 | Ga0157379_10037907 | Ga0157379_100379074 | 318 |
| 49 | 3300014969 | Ga0157376_10050231 | Ga0157376_100502312 | 318 |
| 50 | 3300025893 | Ga0207682_10059372 | Ga0207682_100593722 | 318 |
| 51 | 3300025907 | Ga0207645_10077657 | Ga0207645_100776572 | 318 |
| 52 | 3300025907 | Ga0207645_10251852 | Ga0207645_102518521 | 318 |
| 53 | 3300025925 | Ga0207650_10136255 | Ga0207650_101362553 | 318 |
| 54 | 3300025935 | Ga0207709_10053600 | Ga0207709_100536003 | 318 |
| 55 | 3300025940 | Ga0207691_10143671 | Ga0207691_101436712 | 318 |
| 56 | 3300025942 | Ga0207689_10012333 | Ga0207689_100123334 | 318 |
| 57 | 3300025986 | Ga0207658_10246085 | Ga0207658_102460852 | 318 |
| 58 | 3300026089 | Ga0207648_10021954 | Ga0207648_100219544 | 318 |
| 59 | 3300026118 | Ga0207675_100216812 | Ga0207675_1002168123 | 318 |
| 60 | 3300026121 | Ga0207683_10185039 | Ga0207683_101850393 | 318 |
| 61 | 3300028379 | Ga0268266_10172793 | Ga0268266_101727933 | 318 |
| 62 | 3300046615 | Ga0495656_0012735 | Ga0495656_0012735_2092_3093 | 318 |
| 63 | 3300009094 | Ga0111539_10045433 | Ga0111539_100454332 | 319 |
| 64 | 3300031456 | Ga0307513_10227853 | Ga0307513_102278532 | 319 |
| 65 | 3300035691 | Ga0373931_0174656 | Ga0373931_0174656_130_1125 | 319 |
| 66 | 3300046512 | Ga0495610_0006855 | Ga0495610_0006855_6269_7267 | 319 |
| 67 | 3300005459 | Ga0068867_100312042 | Ga0068867_1003120422 | 320 |
| 68 | 3300025918 | Ga0207662_10161066 | Ga0207662_101610662 | 320 |
| 69 | 3300026089 | Ga0207648_10262162 | Ga0207648_102621622 | 320 |
| 70 | 3300042876 | Ga0451577_0049802 | Ga0451577_0049802_330_1328 | 320 |
| 71 | 3300005336 | Ga0070680_100394606 | Ga0070680_1003946061 | 321 |
| 72 | 3300005458 | Ga0070681_10030525 | Ga0070681_100305254 | 321 |
| 73 | 3300025912 | Ga0207707_10056798 | Ga0207707_100567983 | 321 |
| 74 | 3300025917 | Ga0207660_10401874 | Ga0207660_104018741 | 321 |
| 75 | 3300031241 | Ga0265325_10145424 | Ga0265325_101454241 | 321 |
| 76 | 3300005327 | Ga0070658_10022476 | Ga0070658_100224762 | 322 |
| 77 | 3300005327 | Ga0070658_10322430 | Ga0070658_103224302 | 322 |
| 78 | 3300014326 | Ga0157380_10100428 | Ga0157380_101004282 | 322 |
| 79 | 3300025909 | Ga0207705_10007611 | Ga0207705_100076114 | 322 |
| 80 | 3300049574 | Ga0501038_0171667 | Ga0501038_0171667_271_1272 | 322 |
| 81 | 3300049575 | Ga0501039_0057697 | Ga0501039_0057697_296_1297 | 322 |
| 82 | 3300049575 | Ga0501039_0168339 | Ga0501039_0168339_668_1669 | 322 |
| 83 | 3300049576 | Ga0501040_0018261 | Ga0501040_0018261_250_1251 | 322 |
| 84 | 3300049578 | Ga0501042_0225916 | Ga0501042_0225916_267_1268 | 322 |
| 85 | 3300049583 | Ga0501067_0100704 | Ga0501067_0100704_83_1084 | 322 |
| 86 | 3300049584 | Ga0501068_0000871 | Ga0501068_0000871_3792_4781 | 322 |
| 87 | 3300049584 | Ga0501068_0001556 | Ga0501068_0001556_10772_11773 | 322 |
| 88 | 3300049586 | Ga0501070_0010805 | Ga0501070_0010805_3457_4458 | 322 |
| 89 | 3300049588 | Ga0501072_0007982 | Ga0501072_0007982_2766_3767 | 322 |
| 90 | 3300049589 | Ga0501073_0000354 | Ga0501073_0000354_15009_16010 | 322 |
| 91 | 3300049589 | Ga0501073_0003155 | Ga0501073_0003155_9796_10785 | 322 |
| 92 | 3300049590 | Ga0501074_0000312 | Ga0501074_0000312_25700_26701 | 322 |
| 93 | 3300049590 | Ga0501074_0052117 | Ga0501074_0052117_1805_2794 | 322 |
| 94 | 3300049591 | Ga0501075_0016348 | Ga0501075_0016348_1289_2290 | 322 |
| 95 | 3300049592 | Ga0501076_0013750 | Ga0501076_0013750_369_1370 | 322 |
| 96 | 3300049592 | Ga0501076_0078677 | Ga0501076_0078677_1286_2287 | 322 |
| 97 | 3300049741 | Ga0501079_0000416 | Ga0501079_0000416_25684_26685 | 322 |
| 98 | 3300049741 | Ga0501079_0005114 | Ga0501079_0005114_5802_6803 | 322 |
| 99 | 3300049742 | Ga0501080_0012130 | Ga0501080_0012130_5493_6494 | 322 |
| 100 | 3300049742 | Ga0501080_0015303 | Ga0501080_0015303_3898_4887 | 322 |
| 101 | 3300049744 | Ga0501083_0298257 | Ga0501083_0298257_30_1031 | 322 |
| 102 | 3300049824 | Ga0501045_0027039 | Ga0501045_0027039_2616_3617 | 322 |
| 103 | 3300053129 | Ga0500628_022306 | Ga0500628_022306_265_1266 | 322 |
| 104 | 3300054114 | Ga0501084_0003146 | Ga0501084_0003146_10226_11227 | 322 |
| 105 | 3300054114 | Ga0501084_0005381 | Ga0501084_0005381_6286_7287 | 322 |
| 106 | 3300060353 | Ga0501082_0011156 | Ga0501082_0011156_6598_7599 | 322 |
| 107 | 3300031456 | Ga0307513_10095992 | Ga0307513_100959923 | 323 |
| 108 | 3300031995 | Ga0307409_100045785 | Ga0307409_1000457852 | 323 |
| 109 | 3300035089 | Ga0373944_0072262 | Ga0373944_0072262_11_982 | 323 |
| 110 | 3300046538 | Ga0495609_0023933 | Ga0495609_0023933_1807_2781 | 323 |
| 111 | 3300053153 | Ga0500616_0000032 | Ga0500616_0000032_291507_292514 | 323 |
| 112 | 3300005543 | Ga0070672_100031713 | Ga0070672_1000317132 | 324 |
| 113 | 3300005841 | Ga0068863_100017176 | Ga0068863_1000171766 | 324 |
| 114 | 3300005937 | Ga0081455_10007076 | Ga0081455_100070768 | 324 |
| 115 | 3300013308 | Ga0157375_10060726 | Ga0157375_100607264 | 324 |
| 116 | 3300025940 | Ga0207691_10003270 | Ga0207691_1000327011 | 324 |
| 117 | 3300026088 | Ga0207641_10054803 | Ga0207641_100548033 | 324 |
| 118 | 3300005530 | Ga0070679_100061976 | Ga0070679_1000619764 | 325 |
| 119 | 3300005563 | Ga0068855_100058882 | Ga0068855_1000588823 | 325 |
| 120 | 3300013307 | Ga0157372_10212810 | Ga0157372_102128101 | 325 |
| 121 | 3300025912 | Ga0207707_10004822 | Ga0207707_100048228 | 325 |
| 122 | 3300025949 | Ga0207667_10064465 | Ga0207667_100644653 | 325 |
| 123 | 3300026078 | Ga0207702_10060270 | Ga0207702_100602702 | 325 |
| 124 | 3300031711 | Ga0265314_10010351 | Ga0265314_100103513 | 325 |
| 125 | 3300037471 | Ga0395905_0011146 | Ga0395905_0011146_3817_4827 | 325 |
| 126 | 3300005353 | Ga0070669_100080225 | Ga0070669_1000802253 | 326 |
| 127 | 3300009093 | Ga0105240_10060144 | Ga0105240_100601442 | 326 |
| 128 | 3300013105 | Ga0157369_10087190 | Ga0157369_100871903 | 326 |
| 129 | 3300014326 | Ga0157380_10027648 | Ga0157380_100276485 | 326 |
| 130 | 3300025937 | Ga0207669_10064597 | Ga0207669_100645973 | 326 |
| 131 | 3300027907 | Ga0207428_10179339 | Ga0207428_101793392 | 326 |
| 132 | 3300050511 | nmdc:mga08y16_171501_c1 | nmdc:mga08y16_171501_c1_1183_2184 | 326 |
| 133 | 3300025918 | Ga0207662_10194293 | Ga0207662_101942931 | 328 |
| 134 | 3300005328 | Ga0070676_10196668 | Ga0070676_101966682 | 329 |
| 135 | 3300005329 | Ga0070683_100003534 | Ga0070683_1000035348 | 329 |
| 136 | 3300005331 | Ga0070670_100000139 | Ga0070670_10000013915 | 329 |
| 137 | 3300005333 | Ga0070677_10020732 | Ga0070677_100207323 | 329 |
| 138 | 3300005335 | Ga0070666_10025974 | Ga0070666_100259743 | 329 |
| 139 | 3300005336 | Ga0070680_100093012 | Ga0070680_1000930122 | 329 |
| 140 | 3300005336 | Ga0070680_100135048 | Ga0070680_1001350482 | 329 |
| 141 | 3300005338 | Ga0068868_100000052 | Ga0068868_10000005214 | 329 |
| 142 | 3300005340 | Ga0070689_100128831 | Ga0070689_1001288311 | 329 |
| 143 | 3300005344 | Ga0070661_100000828 | Ga0070661_10000082818 | 329 |
| 144 | 3300005354 | Ga0070675_100003157 | Ga0070675_1000031576 | 329 |
| 145 | 3300005355 | Ga0070671_100000380 | Ga0070671_1000003809 | 329 |
| 146 | 3300005355 | Ga0070671_100105151 | Ga0070671_1001051513 | 329 |
| 147 | 3300005356 | Ga0070674_100073256 | Ga0070674_1000732563 | 329 |
| 148 | 3300005364 | Ga0070673_100002472 | Ga0070673_1000024724 | 329 |
| 149 | 3300005367 | Ga0070667_100350038 | Ga0070667_1003500381 | 329 |
| 150 | 3300005438 | Ga0070701_10122015 | Ga0070701_101220151 | 329 |
| 151 | 3300005441 | Ga0070700_100004593 | Ga0070700_1000045932 | 329 |
| 152 | 3300005444 | Ga0070694_100162890 | Ga0070694_1001628902 | 329 |
| 153 | 3300005445 | Ga0070708_100021116 | Ga0070708_1000211164 | 329 |
| 154 | 3300005455 | Ga0070663_100148234 | Ga0070663_1001482342 | 329 |
| 155 | 3300005456 | Ga0070678_100000133 | Ga0070678_10000013310 | 329 |
| 156 | 3300005457 | Ga0070662_100033372 | Ga0070662_1000333722 | 329 |
| 157 | 3300005459 | Ga0068867_100122275 | Ga0068867_1001222751 | 329 |
| 158 | 3300005466 | Ga0070685_10088092 | Ga0070685_100880922 | 329 |
| 159 | 3300005535 | Ga0070684_100063093 | Ga0070684_1000630932 | 329 |
| 160 | 3300005539 | Ga0068853_100008911 | Ga0068853_1000089117 | 329 |
| 161 | 3300005543 | Ga0070672_100000161 | Ga0070672_10000016113 | 329 |
| 162 | 3300005564 | Ga0070664_100003400 | Ga0070664_1000034008 | 329 |
| 163 | 3300005578 | Ga0068854_100008869 | Ga0068854_1000088692 | 329 |
| 164 | 3300005615 | Ga0070702_100016569 | Ga0070702_1000165694 | 329 |
| 165 | 3300005615 | Ga0070702_100116174 | Ga0070702_1001161742 | 329 |
| 166 | 3300005616 | Ga0068852_100000154 | Ga0068852_10000015415 | 329 |
| 167 | 3300005617 | Ga0068859_100148137 | Ga0068859_1001481373 | 329 |
| 168 | 3300005618 | Ga0068864_100001323 | Ga0068864_10000132314 | 329 |
| 169 | 3300005834 | Ga0068851_10000654 | Ga0068851_1000065410 | 329 |
| 170 | 3300005841 | Ga0068863_100016337 | Ga0068863_1000163373 | 329 |
| 171 | 3300005842 | Ga0068858_100041294 | Ga0068858_1000412944 | 329 |
| 172 | 3300005843 | Ga0068860_100278273 | Ga0068860_1002782731 | 329 |
| 173 | 3300006237 | Ga0097621_100003402 | Ga0097621_1000034028 | 329 |
| 174 | 3300006358 | Ga0068871_100000092 | Ga0068871_10000009238 | 329 |
| 175 | 3300006358 | Ga0068871_100165764 | Ga0068871_1001657642 | 329 |
| 176 | 3300006881 | Ga0068865_100023112 | Ga0068865_1000231124 | 329 |
| 177 | 3300006881 | Ga0068865_100071985 | Ga0068865_1000719851 | 329 |
| 178 | 3300006881 | Ga0068865_100082743 | Ga0068865_1000827433 | 329 |
| 179 | 3300006931 | Ga0097620_100148128 | Ga0097620_1001481283 | 329 |
| 180 | 3300009093 | Ga0105240_10030806 | Ga0105240_100308066 | 329 |
| 181 | 3300009148 | Ga0105243_10018590 | Ga0105243_100185904 | 329 |
| 182 | 3300009177 | Ga0105248_10012985 | Ga0105248_100129854 | 329 |
| 183 | 3300009177 | Ga0105248_10152064 | Ga0105248_101520643 | 329 |
| 184 | 3300009553 | Ga0105249_10017231 | Ga0105249_100172317 | 329 |
| 185 | 3300009553 | Ga0105249_10084809 | Ga0105249_100848093 | 329 |
| 186 | 3300013296 | Ga0157374_10000136 | Ga0157374_1000013613 | 329 |
| 187 | 3300013297 | Ga0157378_10003595 | Ga0157378_100035956 | 329 |
| 188 | 3300013297 | Ga0157378_10091651 | Ga0157378_100916514 | 329 |
| 189 | 3300013297 | Ga0157378_10161023 | Ga0157378_101610232 | 329 |
| 190 | 3300013306 | Ga0163162_10014976 | Ga0163162_100149766 | 329 |
| 191 | 3300013308 | Ga0157375_10001678 | Ga0157375_1000167813 | 329 |
| 192 | 3300013308 | Ga0157375_10260077 | Ga0157375_102600772 | 329 |
| 193 | 3300013308 | Ga0157375_10380112 | Ga0157375_103801122 | 329 |
| 194 | 3300014745 | Ga0157377_10034022 | Ga0157377_100340223 | 329 |
| 195 | 3300014968 | Ga0157379_10018785 | Ga0157379_100187852 | 329 |
| 196 | 3300014969 | Ga0157376_10000389 | Ga0157376_100003896 | 329 |
| 197 | 3300025321 | Ga0207656_10004985 | Ga0207656_100049853 | 329 |
| 198 | 3300025893 | Ga0207682_10003680 | Ga0207682_100036806 | 329 |
| 199 | 3300025907 | Ga0207645_10079070 | Ga0207645_100790703 | 329 |
| 200 | 3300025912 | Ga0207707_10040451 | Ga0207707_100404512 | 329 |
| 201 | 3300025913 | Ga0207695_10030443 | Ga0207695_100304434 | 329 |
| 202 | 3300025920 | Ga0207649_10001756 | Ga0207649_100017567 | 329 |
| 203 | 3300025922 | Ga0207646_10081660 | Ga0207646_100816602 | 329 |
| 204 | 3300025923 | Ga0207681_10099904 | Ga0207681_100999042 | 329 |
| 205 | 3300025925 | Ga0207650_10001124 | Ga0207650_100011246 | 329 |
| 206 | 3300025925 | Ga0207650_10054076 | Ga0207650_100540763 | 329 |
| 207 | 3300025926 | Ga0207659_10001282 | Ga0207659_1000128213 | 329 |
| 208 | 3300025931 | Ga0207644_10001590 | Ga0207644_1000159012 | 329 |
| 209 | 3300025933 | Ga0207706_10017591 | Ga0207706_100175917 | 329 |
| 210 | 3300025934 | Ga0207686_10036749 | Ga0207686_100367492 | 329 |
| 211 | 3300025935 | Ga0207709_10023687 | Ga0207709_100236872 | 329 |
| 212 | 3300025937 | Ga0207669_10043114 | Ga0207669_100431142 | 329 |
| 213 | 3300025940 | Ga0207691_10000043 | Ga0207691_1000004313 | 329 |
| 214 | 3300025941 | Ga0207711_10018943 | Ga0207711_100189435 | 329 |
| 215 | 3300025941 | Ga0207711_10070604 | Ga0207711_100706042 | 329 |
| 216 | 3300025942 | Ga0207689_10002924 | Ga0207689_1000292410 | 329 |
| 217 | 3300025942 | Ga0207689_10026317 | Ga0207689_100263172 | 329 |
| 218 | 3300025944 | Ga0207661_10000832 | Ga0207661_1000083217 | 329 |
| 219 | 3300025945 | Ga0207679_10000574 | Ga0207679_100005746 | 329 |
| 220 | 3300025960 | Ga0207651_10002825 | Ga0207651_100028254 | 329 |
| 221 | 3300025961 | Ga0207712_10116839 | Ga0207712_101168391 | 329 |
| 222 | 3300026023 | Ga0207677_10000839 | Ga0207677_1000083912 | 329 |
| 223 | 3300026023 | Ga0207677_10213360 | Ga0207677_102133602 | 329 |
| 224 | 3300026067 | Ga0207678_10175595 | Ga0207678_101755952 | 329 |
| 225 | 3300026075 | Ga0207708_10005891 | Ga0207708_100058911 | 329 |
| 226 | 3300026075 | Ga0207708_10055683 | Ga0207708_100556833 | 329 |
| 227 | 3300026088 | Ga0207641_10077107 | Ga0207641_100771072 | 329 |
| 228 | 3300026089 | Ga0207648_10001650 | Ga0207648_100016503 | 329 |
| 229 | 3300026089 | Ga0207648_10005604 | Ga0207648_1000560412 | 329 |
| 230 | 3300026089 | Ga0207648_10010589 | Ga0207648_100105897 | 329 |
| 231 | 3300026095 | Ga0207676_10002671 | Ga0207676_100026717 | 329 |
| 232 | 3300026121 | Ga0207683_10000091 | Ga0207683_1000009154 | 329 |
| 233 | 3300026121 | Ga0207683_10061271 | Ga0207683_100612713 | 329 |
| 234 | 3300026121 | Ga0207683_10441601 | Ga0207683_104416012 | 329 |
| 235 | 3300026142 | Ga0207698_10000303 | Ga0207698_1000030312 | 329 |
| 236 | 3300028577 | Ga0265318_10024589 | Ga0265318_100245892 | 329 |
| 237 | 3300031235 | Ga0265330_10004213 | Ga0265330_100042135 | 329 |
| 238 | 3300031238 | Ga0265332_10002783 | Ga0265332_100027835 | 329 |
| 239 | 3300031239 | Ga0265328_10001439 | Ga0265328_100014396 | 329 |
| 240 | 3300031242 | Ga0265329_10003330 | Ga0265329_100033304 | 329 |
| 241 | 3300031250 | Ga0265331_10011063 | Ga0265331_100110634 | 329 |
| 242 | 3300031344 | Ga0265316_10025384 | Ga0265316_100253844 | 329 |
| 243 | 3300031595 | Ga0265313_10078270 | Ga0265313_100782702 | 329 |
| 244 | 3300031711 | Ga0265314_10002821 | Ga0265314_100028214 | 329 |
| 245 | 3300031712 | Ga0265342_10009537 | Ga0265342_100095372 | 329 |
| 246 | 3300048904 | Ga0496101_0137002 | Ga0496101_0137002_659_1651 | 329 |
| 247 | 3300048907 | Ga0496104_0200458 | Ga0496104_0200458_696_1688 | 329 |
| 248 | 3300048911 | Ga0496108_0040465 | Ga0496108_0040465_958_1950 | 329 |
| 249 | 3300048912 | Ga0496109_0007070 | Ga0496109_0007070_1755_2747 | 329 |
| 250 | 3300048913 | Ga0496110_0000225 | Ga0496110_0000225_30939_31931 | 329 |
| 251 | 3300048917 | Ga0496114_0028930 | Ga0496114_0028930_573_1565 | 329 |
| 252 | 3300048917 | Ga0496114_0101027 | Ga0496114_0101027_20_1012 | 329 |
| 253 | 3300048928 | Ga0496125_0007840 | Ga0496125_0007840_9755_10747 | 329 |
| 254 | 3300048929 | Ga0496126_0118001 | Ga0496126_0118001_966_1958 | 329 |
| 255 | 3300049571 | Ga0501034_0002533 | Ga0501034_0002533_10628_11617 | 329 |
| 256 | 3300049574 | Ga0501038_0026175 | Ga0501038_0026175_1908_2900 | 329 |
| 257 | 3300049577 | Ga0501041_0026896 | Ga0501041_0026896_830_1822 | 329 |
| 258 | 3300049578 | Ga0501042_0007566 | Ga0501042_0007566_4967_5959 | 329 |
| 259 | 3300049579 | Ga0501043_0127402 | Ga0501043_0127402_252_1244 | 329 |
| 260 | 3300049587 | Ga0501071_0028011 | Ga0501071_0028011_1656_2648 | 329 |
| 261 | 3300049587 | Ga0501071_0042307 | Ga0501071_0042307_380_1372 | 329 |
| 262 | 3300049588 | Ga0501072_0003671 | Ga0501072_0003671_9448_10437 | 329 |
| 263 | 3300049591 | Ga0501075_0001010 | Ga0501075_0001010_20_1012 | 329 |
| 264 | 3300049592 | Ga0501076_0007929 | Ga0501076_0007929_6734_7726 | 329 |
| 265 | 3300049593 | Ga0501077_0007924 | Ga0501077_0007924_4855_5847 | 329 |
| 266 | 3300049741 | Ga0501079_0019011 | Ga0501079_0019011_1059_2051 | 329 |
| 267 | 3300049743 | Ga0501081_0043473 | Ga0501081_0043473_83_1075 | 329 |
| 268 | 3300049823 | Ga0501044_0334001 | Ga0501044_0334001_379_1371 | 329 |
| 269 | 3300049824 | Ga0501045_0001888 | Ga0501045_0001888_12476_13468 | 329 |
| 270 | 3300054114 | Ga0501084_0025179 | Ga0501084_0025179_603_1595 | 329 |
| 271 | 3300060353 | Ga0501082_0014345 | Ga0501082_0014345_4283_5275 | 329 |
| 272 | 3300061734 | Ga0530510_0001261 | Ga0530510_0001261_7410_8402 | 329 |
| 273 | 3300031251 | Ga0265327_10041394 | Ga0265327_100413941 | 330 |
| 274 | 3300046471 | Ga0495650_0010815 | Ga0495650_0010815_2603_3616 | 330 |
| 275 | 3300005334 | Ga0068869_100256851 | Ga0068869_1002568512 | 331 |
| 276 | 3300005548 | Ga0070665_100036349 | Ga0070665_1000363495 | 331 |
| 277 | 3300005719 | Ga0068861_100010878 | Ga0068861_1000108785 | 331 |
| 278 | 3300005844 | Ga0068862_100134794 | Ga0068862_1001347943 | 331 |
| 279 | 3300006846 | Ga0075430_100183365 | Ga0075430_1001833652 | 331 |
| 280 | 3300025942 | Ga0207689_10302794 | Ga0207689_103027942 | 331 |
| 281 | 3300028379 | Ga0268266_10106420 | Ga0268266_101064203 | 331 |
| 282 | 3300031824 | Ga0307413_10049951 | Ga0307413_100499513 | 331 |
| 283 | 3300031852 | Ga0307410_10003260 | Ga0307410_100032604 | 331 |
| 284 | 3300035086 | Ga0373934_0000134 | Ga0373934_0000134_18542_19540 | 331 |
| 285 | 3300035118 | Ga0373954_0005310 | Ga0373954_0005310_538_1536 | 331 |
| 286 | 3300035118 | Ga0373954_0048164 | Ga0373954_0048164_486_1484 | 331 |
| 287 | 3300035119 | Ga0373956_0000006 | Ga0373956_0000006_7281_8279 | 331 |
| 288 | 3300035119 | Ga0373956_0008199 | Ga0373956_0008199_1438_2436 | 331 |
| 289 | 3300035172 | Ga0373955_0007451 | Ga0373955_0007451_3372_4370 | 331 |
| 290 | 3300035172 | Ga0373955_0012679 | Ga0373955_0012679_1327_2325 | 331 |
| 291 | 3300035692 | Ga0373935_0036070 | Ga0373935_0036070_1629_2627 | 331 |
| 292 | 3300035695 | Ga0373927_0004491 | Ga0373927_0004491_6209_7207 | 331 |
| 293 | 3300035724 | Ga0373933_0000564 | Ga0373933_0000564_10610_11608 | 331 |
| 294 | 3300036401 | Ga0373937_0003219 | Ga0373937_0003219_3087_4085 | 331 |
| 295 | 3300037068 | Ga0373925_0007446 | Ga0373925_0007446_6353_7351 | 331 |
| 296 | 3300046454 | Ga0495592_0063301 | Ga0495592_0063301_463_1461 | 331 |
| 297 | 3300046461 | Ga0495641_0002246 | Ga0495641_0002246_7922_8920 | 331 |
| 298 | 3300046462 | Ga0495651_0000233 | Ga0495651_0000233_33128_34126 | 331 |
| 299 | 3300046462 | Ga0495651_0000919 | Ga0495651_0000919_9987_10985 | 331 |
| 300 | 3300046463 | Ga0495653_0049498 | Ga0495653_0049498_2061_3059 | 331 |
| 301 | 3300046472 | Ga0495580_0043976 | Ga0495580_0043976_942_1940 | 331 |
| 302 | 3300046475 | Ga0495639_0001153 | Ga0495639_0001153_9001_9999 | 331 |
| 303 | 3300046477 | Ga0495664_0029766 | Ga0495664_0029766_271_1269 | 331 |
| 304 | 3300046511 | Ga0495608_0109247 | Ga0495608_0109247_404_1402 | 331 |
| 305 | 3300046514 | Ga0495618_0040435 | Ga0495618_0040435_1254_2252 | 331 |
| 306 | 3300046516 | Ga0495628_0035967 | Ga0495628_0035967_1289_2287 | 331 |
| 307 | 3300046517 | Ga0495630_0020406 | Ga0495630_0020406_3710_4708 | 331 |
| 308 | 3300046520 | Ga0495637_0022686 | Ga0495637_0022686_240_1238 | 331 |
| 309 | 3300046526 | Ga0495666_0004375 | Ga0495666_0004375_4863_5861 | 331 |
| 310 | 3300046531 | Ga0495665_0013316 | Ga0495665_0013316_2135_3133 | 331 |
| 311 | 3300046533 | Ga0495640_0091867 | Ga0495640_0091867_620_1618 | 331 |
| 312 | 3300046535 | Ga0495586_0004382 | Ga0495586_0004382_6173_7171 | 331 |
| 313 | 3300046535 | Ga0495586_0147107 | Ga0495586_0147107_192_1190 | 331 |
| 314 | 3300046536 | Ga0495587_0142644 | Ga0495587_0142644_128_1126 | 331 |
| 315 | 3300046559 | Ga0495667_0002319 | Ga0495667_0002319_9987_10985 | 331 |
| 316 | 3300046559 | Ga0495667_0013455 | Ga0495667_0013455_1769_2767 | 331 |
| 317 | 3300046642 | Ga0495634_0014557 | Ga0495634_0014557_2773_3771 | 331 |
| 318 | 3300046663 | Ga0495635_0013574 | Ga0495635_0013574_3266_4264 | 331 |
| 319 | 3300046675 | Ga0495657_0009456 | Ga0495657_0009456_1140_2138 | 331 |
| 320 | 3300046675 | Ga0495657_0176750 | Ga0495657_0176750_29_1027 | 331 |
| 321 | 3300046678 | Ga0495599_0144058 | Ga0495599_0144058_469_1467 | 331 |
| 322 | 3300046683 | Ga0495658_0072539 | Ga0495658_0072539_620_1618 | 331 |
| 323 | 3300046689 | Ga0495613_0019470 | Ga0495613_0019470_794_1792 | 331 |
| 324 | 3300046809 | Ga0495600_0196981 | Ga0495600_0196981_50_1048 | 331 |
| 325 | 3300047317 | Ga0495604_0048140 | Ga0495604_0048140_1121_2119 | 331 |
| 326 | 3300047319 | Ga0495674_0003032 | Ga0495674_0003032_14432_15430 | 331 |
| 327 | 3300047444 | Ga0495675_0001126 | Ga0495675_0001126_8231_9229 | 331 |
| 328 | 3300047471 | Ga0495684_0145196 | Ga0495684_0145196_267_1265 | 331 |
| 329 | 3300050509 | nmdc:mga0qj67_136015_c1 | nmdc:mga0qj67_136015_c1_816_1811 | 331 |
| 330 | 3300050514 | nmdc:mga08x19_218752_c1 | nmdc:mga08x19_218752_c1_181_1179 | 331 |
| 331 | 3300053084 | Ga0495595_0000317 | Ga0495595_0000317_10447_11445 | 331 |
| 332 | 3300053085 | Ga0495619_0001741 | Ga0495619_0001741_4965_5963 | 331 |
| 333 | iso_pu_bacteria | 2643221554 | 2643787456 | 331 |
| 334 | iso_pu_bacteria | 2643221638 | 2644214023 | 331 |
| 335 | iso_pu_bacteria | 2818991436 | 2819541197 | 331 |
| 336 | 3300005614 | Ga0068856_100377364 | Ga0068856_1003773641 | 332 |
| 337 | 3300005844 | Ga0068862_100171490 | Ga0068862_1001714902 | 332 |
| 338 | 3300046460 | Ga0495638_0117859 | Ga0495638_0117859_403_1401 | 332 |
| 339 | 3300046513 | Ga0495616_0021729 | Ga0495616_0021729_364_1362 | 332 |
| 340 | 3300046660 | Ga0495625_0082434 | Ga0495625_0082434_1162_2160 | 332 |
| 341 | 3300005295 | Ga0065707_10083624 | Ga0065707_100836245 | 333 |
| 342 | 3300005330 | Ga0070690_100003271 | Ga0070690_1000032713 | 333 |
| 343 | 3300005330 | Ga0070690_100043334 | Ga0070690_1000433342 | 333 |
| 344 | 3300005331 | Ga0070670_100003576 | Ga0070670_1000035766 | 333 |
| 345 | 3300005335 | Ga0070666_10003050 | Ga0070666_100030506 | 333 |
| 346 | 3300005337 | Ga0070682_100033530 | Ga0070682_1000335303 | 333 |
| 347 | 3300005338 | Ga0068868_100002988 | Ga0068868_1000029886 | 333 |
| 348 | 3300005341 | Ga0070691_10155354 | Ga0070691_101553541 | 333 |
| 349 | 3300005343 | Ga0070687_100050223 | Ga0070687_1000502231 | 333 |
| 350 | 3300005345 | Ga0070692_10082506 | Ga0070692_100825062 | 333 |
| 351 | 3300005355 | Ga0070671_100050568 | Ga0070671_1000505682 | 333 |
| 352 | 3300005356 | Ga0070674_100056233 | Ga0070674_1000562332 | 333 |
| 353 | 3300005364 | Ga0070673_100178659 | Ga0070673_1001786592 | 333 |
| 354 | 3300005365 | Ga0070688_100168924 | Ga0070688_1001689242 | 333 |
| 355 | 3300005437 | Ga0070710_10120125 | Ga0070710_101201252 | 333 |
| 356 | 3300005438 | Ga0070701_10001290 | Ga0070701_100012903 | 333 |
| 357 | 3300005440 | Ga0070705_100008425 | Ga0070705_1000084255 | 333 |
| 358 | 3300005441 | Ga0070700_100019740 | Ga0070700_1000197403 | 333 |
| 359 | 3300005444 | Ga0070694_100205254 | Ga0070694_1002052541 | 333 |
| 360 | 3300005543 | Ga0070672_100032446 | Ga0070672_1000324463 | 333 |
| 361 | 3300005545 | Ga0070695_100038851 | Ga0070695_1000388513 | 333 |
| 362 | 3300005546 | Ga0070696_100036088 | Ga0070696_1000360882 | 333 |
| 363 | 3300005548 | Ga0070665_100016957 | Ga0070665_1000169573 | 333 |
| 364 | 3300005549 | Ga0070704_100004455 | Ga0070704_1000044553 | 333 |
| 365 | 3300005564 | Ga0070664_100000778 | Ga0070664_10000077824 | 333 |
| 366 | 3300005615 | Ga0070702_100064864 | Ga0070702_1000648643 | 333 |
| 367 | 3300005617 | Ga0068859_100011998 | Ga0068859_1000119984 | 333 |
| 368 | 3300005617 | Ga0068859_100030344 | Ga0068859_1000303442 | 333 |
| 369 | 3300005617 | Ga0068859_100091196 | Ga0068859_1000911962 | 333 |
| 370 | 3300005618 | Ga0068864_100002108 | Ga0068864_1000021083 | 333 |
| 371 | 3300005719 | Ga0068861_100023338 | Ga0068861_1000233383 | 333 |
| 372 | 3300005841 | Ga0068863_100002243 | Ga0068863_1000022432 | 333 |
| 373 | 3300005843 | Ga0068860_100013959 | Ga0068860_1000139594 | 333 |
| 374 | 3300005844 | Ga0068862_100014237 | Ga0068862_1000142373 | 333 |
| 375 | 3300006237 | Ga0097621_100016958 | Ga0097621_1000169585 | 333 |
| 376 | 3300006358 | Ga0068871_100004973 | Ga0068871_1000049739 | 333 |
| 377 | 3300006358 | Ga0068871_100033056 | Ga0068871_1000330564 | 333 |
| 378 | 3300006844 | Ga0075428_100014644 | Ga0075428_1000146446 | 333 |
| 379 | 3300006846 | Ga0075430_100171165 | Ga0075430_1001711652 | 333 |
| 380 | 3300006852 | Ga0075433_10131112 | Ga0075433_101311122 | 333 |
| 381 | 3300006931 | Ga0097620_100011997 | Ga0097620_1000119976 | 333 |
| 382 | 3300006931 | Ga0097620_100030344 | Ga0097620_1000303442 | 333 |
| 383 | 3300006931 | Ga0097620_100091197 | Ga0097620_1000911972 | 333 |
| 384 | 3300009094 | Ga0111539_10079217 | Ga0111539_100792173 | 333 |
| 385 | 3300009094 | Ga0111539_10177614 | Ga0111539_101776143 | 333 |
| 386 | 3300009098 | Ga0105245_10022419 | Ga0105245_100224192 | 333 |
| 387 | 3300009176 | Ga0105242_10238775 | Ga0105242_102387752 | 333 |
| 388 | 3300011119 | Ga0105246_10004725 | Ga0105246_100047254 | 333 |
| 389 | 3300013296 | Ga0157374_10001696 | Ga0157374_1000169614 | 333 |
| 390 | 3300013306 | Ga0163162_10021750 | Ga0163162_100217506 | 333 |
| 391 | 3300013308 | Ga0157375_10078315 | Ga0157375_100783153 | 333 |
| 392 | 3300014326 | Ga0157380_10203224 | Ga0157380_102032242 | 333 |
| 393 | 3300014968 | Ga0157379_10034303 | Ga0157379_100343032 | 333 |
| 394 | 3300025898 | Ga0207692_10104170 | Ga0207692_101041701 | 333 |
| 395 | 3300025903 | Ga0207680_10038250 | Ga0207680_100382501 | 333 |
| 396 | 3300025917 | Ga0207660_10126896 | Ga0207660_101268962 | 333 |
| 397 | 3300025918 | Ga0207662_10070866 | Ga0207662_100708661 | 333 |
| 398 | 3300025920 | Ga0207649_10141915 | Ga0207649_101419152 | 333 |
| 399 | 3300025925 | Ga0207650_10022663 | Ga0207650_100226632 | 333 |
| 400 | 3300025931 | Ga0207644_10016901 | Ga0207644_100169012 | 333 |
| 401 | 3300025934 | Ga0207686_10186863 | Ga0207686_101868632 | 333 |
| 402 | 3300025936 | Ga0207670_10006847 | Ga0207670_100068474 | 333 |
| 403 | 3300025936 | Ga0207670_10062351 | Ga0207670_100623513 | 333 |
| 404 | 3300025938 | Ga0207704_10072158 | Ga0207704_100721581 | 333 |
| 405 | 3300025940 | Ga0207691_10106928 | Ga0207691_101069282 | 333 |
| 406 | 3300025941 | Ga0207711_10001630 | Ga0207711_100016303 | 333 |
| 407 | 3300025942 | Ga0207689_10354906 | Ga0207689_103549061 | 333 |
| 408 | 3300025960 | Ga0207651_10122166 | Ga0207651_101221662 | 333 |
| 409 | 3300025961 | Ga0207712_10199320 | Ga0207712_101993202 | 333 |
| 410 | 3300025986 | Ga0207658_10425434 | Ga0207658_104254341 | 333 |
| 411 | 3300026075 | Ga0207708_10007712 | Ga0207708_100077122 | 333 |
| 412 | 3300026075 | Ga0207708_10053999 | Ga0207708_100539993 | 333 |
| 413 | 3300026118 | Ga0207675_100007805 | Ga0207675_1000078054 | 333 |
| 414 | 3300026118 | Ga0207675_100009401 | Ga0207675_1000094017 | 333 |
| 415 | 3300027695 | Ga0209966_1003408 | Ga0209966_10034082 | 333 |
| 416 | 3300028379 | Ga0268266_10115900 | Ga0268266_101159002 | 333 |
| 417 | 3300028380 | Ga0268265_10067478 | Ga0268265_100674783 | 333 |
| 418 | 3300028380 | Ga0268265_10101630 | Ga0268265_101016303 | 333 |
| 419 | 3300031456 | Ga0307513_10049717 | Ga0307513_100497175 | 333 |
| 420 | 3300031507 | Ga0307509_10020099 | Ga0307509_100200992 | 333 |
| 421 | 3300031665 | Ga0316575_10001963 | Ga0316575_100019635 | 333 |
| 422 | 3300031727 | Ga0316576_10117649 | Ga0316576_101176492 | 333 |
| 423 | 3300031731 | Ga0307405_10341956 | Ga0307405_103419561 | 333 |
| 424 | 3300031733 | Ga0316577_10112474 | Ga0316577_101124742 | 333 |
| 425 | 3300031824 | Ga0307413_10025670 | Ga0307413_100256703 | 333 |
| 426 | 3300031852 | Ga0307410_10026068 | Ga0307410_100260684 | 333 |
| 427 | 3300032002 | Ga0307416_100144212 | Ga0307416_1001442122 | 333 |
| 428 | 3300032002 | Ga0307416_100309129 | Ga0307416_1003091292 | 333 |
| 429 | 3300032005 | Ga0307411_10002266 | Ga0307411_100022666 | 333 |
| 430 | 3300032005 | Ga0307411_10174919 | Ga0307411_101749192 | 333 |
| 431 | 3300035398 | Ga0316574_0023043 | Ga0316574_0023043_1248_2249 | 333 |
| 432 | 3300036712 | Ga0316584_0022111 | Ga0316584_0022111_876_1877 | 333 |
| 433 | 3300041492 | Ga0451835_1197999 | Ga0451835_1197999_163_1164 | 333 |
| 434 | 3300041498 | Ga0451841_0390070 | Ga0451841_0390070_1309_2310 | 333 |
| 435 | 3300041507 | Ga0451851_0647212 | Ga0451851_0647212_398_1399 | 333 |
| 436 | 3300041512 | Ga0451853_3612137 | Ga0451853_3612137_366_1367 | 333 |
| 437 | 3300046457 | Ga0495590_0001849 | Ga0495590_0001849_4608_5609 | 333 |
| 438 | 3300046460 | Ga0495638_0024357 | Ga0495638_0024357_1153_2154 | 333 |
| 439 | 3300046660 | Ga0495625_0079339 | Ga0495625_0079339_663_1664 | 333 |
| 440 | 3300048904 | Ga0496101_0121877 | Ga0496101_0121877_634_1635 | 333 |
| 441 | 3300048905 | Ga0496102_0295027 | Ga0496102_0295027_292_1293 | 333 |
| 442 | 3300048907 | Ga0496104_0045265 | Ga0496104_0045265_1356_2357 | 333 |
| 443 | 3300048908 | Ga0496105_0121664 | Ga0496105_0121664_171_1172 | 333 |
| 444 | 3300048912 | Ga0496109_0122303 | Ga0496109_0122303_145_1146 | 333 |
| 445 | 3300048915 | Ga0496112_0008077 | Ga0496112_0008077_7597_8598 | 333 |
| 446 | 3300048916 | Ga0496113_0060816 | Ga0496113_0060816_145_1146 | 333 |
| 447 | 3300048917 | Ga0496114_0020108 | Ga0496114_0020108_1895_2896 | 333 |
| 448 | 3300049572 | Ga0501036_0040050 | Ga0501036_0040050_75_1076 | 333 |
| 449 | 3300049574 | Ga0501038_0056844 | Ga0501038_0056844_249_1250 | 333 |
| 450 | 3300049576 | Ga0501040_0123248 | Ga0501040_0123248_214_1215 | 333 |
| 451 | 3300049578 | Ga0501042_0102593 | Ga0501042_0102593_13_1014 | 333 |
| 452 | 3300049579 | Ga0501043_0273588 | Ga0501043_0273588_123_1124 | 333 |
| 453 | 3300049582 | Ga0501048_0164771 | Ga0501048_0164771_321_1322 | 333 |
| 454 | 3300049590 | Ga0501074_0134830 | Ga0501074_0134830_617_1618 | 333 |
| 455 | 3300049591 | Ga0501075_0023259 | Ga0501075_0023259_2443_3444 | 333 |
| 456 | 3300049741 | Ga0501079_0004121 | Ga0501079_0004121_419_1420 | 333 |
| 457 | 3300049742 | Ga0501080_0151655 | Ga0501080_0151655_690_1691 | 333 |
| 458 | 3300049742 | Ga0501080_0152715 | Ga0501080_0152715_437_1438 | 333 |
| 459 | 3300049742 | Ga0501080_0290183 | Ga0501080_0290183_258_1259 | 333 |
| 460 | 3300049822 | Ga0501035_0110077 | Ga0501035_0110077_1100_2101 | 333 |
| 461 | 3300050509 | nmdc:mga0qj67_114492_c1 | nmdc:mga0qj67_114492_c1_657_1658 | 333 |
| 462 | 3300050511 | nmdc:mga08y16_145811_c1 | nmdc:mga08y16_145811_c1_738_1739 | 333 |
| 463 | 3300050511 | nmdc:mga08y16_177040_c1 | nmdc:mga08y16_177040_c1_777_1778 | 333 |
| 464 | 3300050515 | nmdc:mga0a205_61625_c1 | nmdc:mga0a205_61625_c1_1631_2632 | 333 |
| 465 | 3300054114 | Ga0501084_0211276 | Ga0501084_0211276_193_1194 | 333 |
| 466 | 3300061734 | Ga0530510_0001840 | Ga0530510_0001840_2298_3299 | 333 |
| 467 | 3300061734 | Ga0530510_0149701 | Ga0530510_0149701_677_1678 | 333 |
| 468 | 3300005344 | Ga0070661_100002567 | Ga0070661_1000025677 | 334 |
| 469 | 3300005366 | Ga0070659_100030020 | Ga0070659_1000300202 | 334 |
| 470 | 3300005457 | Ga0070662_100090976 | Ga0070662_1000909763 | 334 |
| 471 | 3300005458 | Ga0070681_10175455 | Ga0070681_101754551 | 334 |
| 472 | 3300005548 | Ga0070665_100005913 | Ga0070665_10000591312 | 334 |
| 473 | 3300005563 | Ga0068855_100521708 | Ga0068855_1005217082 | 334 |
| 474 | 3300005564 | Ga0070664_100003658 | Ga0070664_1000036583 | 334 |
| 475 | 3300005577 | Ga0068857_100059943 | Ga0068857_1000599434 | 334 |
| 476 | 3300005719 | Ga0068861_100049514 | Ga0068861_1000495143 | 334 |
| 477 | 3300005719 | Ga0068861_100494959 | Ga0068861_1004949591 | 334 |
| 478 | 3300009098 | Ga0105245_10015255 | Ga0105245_100152556 | 334 |
| 479 | 3300009174 | Ga0105241_10089072 | Ga0105241_100890722 | 334 |
| 480 | 3300013306 | Ga0163162_10150181 | Ga0163162_101501812 | 334 |
| 481 | 3300014969 | Ga0157376_10051163 | Ga0157376_100511632 | 334 |
| 482 | 3300025911 | Ga0207654_10052489 | Ga0207654_100524892 | 334 |
| 483 | 3300025919 | Ga0207657_10035388 | Ga0207657_100353883 | 334 |
| 484 | 3300025932 | Ga0207690_10005703 | Ga0207690_100057032 | 334 |
| 485 | 3300025932 | Ga0207690_10322267 | Ga0207690_103222671 | 334 |
| 486 | 3300025942 | Ga0207689_10050097 | Ga0207689_100500972 | 334 |
| 487 | 3300025945 | Ga0207679_10002762 | Ga0207679_100027628 | 334 |
| 488 | 3300026023 | Ga0207677_10087689 | Ga0207677_100876891 | 334 |
| 489 | 3300026035 | Ga0207703_10243871 | Ga0207703_102438712 | 334 |
| 490 | 3300026118 | Ga0207675_100039483 | Ga0207675_1000394833 | 334 |
| 491 | 3300028379 | Ga0268266_10018807 | Ga0268266_100188072 | 334 |
| 492 | 3300028380 | Ga0268265_10060865 | Ga0268265_100608654 | 334 |
| 493 | 3300037312 | Ga0395899_0000344 | Ga0395899_0000344_24433_25440 | 334 |
| 494 | 3300037418 | Ga0395900_0064859 | Ga0395900_0064859_1689_2696 | 334 |
| 495 | 3300037418 | Ga0395900_0077918 | Ga0395900_0077918_878_1885 | 334 |
| 496 | 3300037418 | Ga0395900_0180285 | Ga0395900_0180285_504_1511 | 334 |
| 497 | 3300037471 | Ga0395905_0006025 | Ga0395905_0006025_3824_4831 | 334 |
| 498 | 3300037471 | Ga0395905_0009860 | Ga0395905_0009860_1292_2299 | 334 |
| 499 | 3300038443 | Ga0395901_0000533 | Ga0395901_0000533_12136_13143 | 334 |
| 500 | 3300039447 | Ga0436361_0314082 | Ga0436361_0314082_229_1236 | 334 |
| 501 | 3300044658 | Ga0466972_0000070 | Ga0466972_0000070_75813_76820 | 334 |
| 502 | 3300044658 | Ga0466972_0034493 | Ga0466972_0034493_560_1567 | 334 |
| 503 | 3300044683 | Ga0466965_0001667 | Ga0466965_0001667_8032_9039 | 334 |
| 504 | 3300044684 | Ga0466966_0068935 | Ga0466966_0068935_334_1341 | 334 |
| 505 | 3300044706 | Ga0466964_0070986 | Ga0466964_0070986_57_1064 | 334 |
| 506 | 3300044712 | Ga0453684_0131363 | Ga0453684_0131363_390_1397 | 334 |
| 507 | 3300044765 | Ga0466970_0007209 | Ga0466970_0007209_3710_4717 | 334 |
| 508 | 3300045049 | Ga0466959_0006523 | Ga0466959_0006523_506_1513 | 334 |
| 509 | 3300046457 | Ga0495590_0073995 | Ga0495590_0073995_12_1019 | 334 |
| 510 | 3300046507 | Ga0495606_0016860 | Ga0495606_0016860_253_1260 | 334 |
| 511 | 3300046522 | Ga0495643_0004000 | Ga0495643_0004000_427_1434 | 334 |
| 512 | 3300046528 | Ga0495642_0026858 | Ga0495642_0026858_1182_2189 | 334 |
| 513 | 3300046665 | Ga0495661_0004218 | Ga0495661_0004218_6172_7179 | 334 |
| 514 | 3300047443 | Ga0495687_004211 | Ga0495687_004211_1501_2508 | 334 |
| 515 | 3300048908 | Ga0496105_0042336 | Ga0496105_0042336_2704_3711 | 334 |
| 516 | 3300048910 | Ga0496107_0179040 | Ga0496107_0179040_258_1265 | 334 |
| 517 | 3300048911 | Ga0496108_0041766 | Ga0496108_0041766_498_1505 | 334 |
| 518 | 3300048912 | Ga0496109_0113152 | Ga0496109_0113152_682_1689 | 334 |
| 519 | 3300048913 | Ga0496110_0335371 | Ga0496110_0335371_50_1057 | 334 |
| 520 | 3300048914 | Ga0496111_0290071 | Ga0496111_0290071_179_1186 | 334 |
| 521 | 3300048917 | Ga0496114_0131732 | Ga0496114_0131732_467_1474 | 334 |
| 522 | 3300048917 | Ga0496114_0254535 | Ga0496114_0254535_527_1534 | 334 |
| 523 | 3300048924 | Ga0496121_0117941 | Ga0496121_0117941_459_1466 | 334 |
| 524 | 3300049742 | Ga0501080_0070202 | Ga0501080_0070202_1164_2171 | 334 |
| 525 | 3300049823 | Ga0501044_0217377 | Ga0501044_0217377_501_1508 | 334 |
| 526 | 3300002771 | JGI25163J39215_1002284 | JGI25163J39215_10022842 | 335 |
| 527 | 3300002773 | JGI25152J39213_1000839 | JGI25152J39213_100083915 | 335 |
| 528 | 3300002774 | JGI25150J39212_1000639 | JGI25150J39212_10006391 | 335 |
| 529 | 3300002774 | JGI25150J39212_1001574 | JGI25150J39212_10015747 | 335 |
| 530 | 3300002774 | JGI25150J39212_1002946 | JGI25150J39212_10029461 | 335 |
| 531 | 3300002987 | JGI25159J45721_1000701 | JGI25159J45721_10007016 | 335 |
| 532 | 3300002987 | JGI25159J45721_1005270 | JGI25159J45721_10052705 | 335 |
| 533 | 3300002987 | JGI25159J45721_1005657 | JGI25159J45721_10056572 | 335 |
| 534 | 3300003214 | JGI25165J46597_1000064 | JGI25165J46597_1000064172 | 335 |
| 535 | 3300003215 | JGI25153J46596_10002118 | JGI25153J46596_1000211812 | 335 |
| 536 | 3300003354 | JGI25160J50197_1003074 | JGI25160J50197_10030743 | 335 |
| 537 | 3300003374 | JGI25161J50226_1000500 | JGI25161J50226_10005002 | 335 |
| 538 | 3300003374 | JGI25161J50226_1001505 | JGI25161J50226_10015057 | 335 |
| 539 | 3300003751 | Ga0055538_1000031 | Ga0055538_100003115 | 335 |
| 540 | 3300003752 | Ga0055539_1000041 | Ga0055539_100004115 | 335 |
| 541 | 3300003756 | Ga0055533_1000051 | Ga0055533_1000051172 | 335 |
| 542 | 3300003759 | Ga0055525_1000061 | Ga0055525_100006115 | 335 |
| 543 | 3300003771 | Ga0055526_1001572 | Ga0055526_10015721 | 335 |
| 544 | 3300003771 | Ga0055526_1004107 | Ga0055526_10041079 | 335 |
| 545 | 3300003771 | Ga0055526_1017481 | Ga0055526_10174814 | 335 |
| 546 | 3300003773 | Ga0055537_1000041 | Ga0055537_100004185 | 335 |
| 547 | 3300003773 | Ga0055537_1001581 | Ga0055537_10015815 | 335 |
| 548 | 3300003775 | Ga0055524_1000007 | Ga0055524_100000713 | 335 |
| 549 | 3300003775 | Ga0055524_1000153 | Ga0055524_100015322 | 335 |
| 550 | 3300003775 | Ga0055524_1001204 | Ga0055524_10012044 | 335 |
| 551 | 3300003775 | Ga0055524_1001786 | Ga0055524_100178612 | 335 |
| 552 | 3300003775 | Ga0055524_1005089 | Ga0055524_10050897 | 335 |
| 553 | 3300003775 | Ga0055524_1005404 | Ga0055524_10054042 | 335 |
| 554 | 3300003784 | Ga0055534_1000505 | Ga0055534_10005057 | 335 |
| 555 | 3300003784 | Ga0055534_1000540 | Ga0055534_10005402 | 335 |
| 556 | 3300003790 | Ga0055528_1000984 | Ga0055528_10009846 | 335 |
| 557 | 3300003790 | Ga0055528_1005770 | Ga0055528_10057703 | 335 |
| 558 | 3300003794 | Ga0055531_10002277 | Ga0055531_1000227716 | 335 |
| 559 | 3300003841 | Ga0055541_1000028 | Ga0055541_100002815 | 335 |
| 560 | 3300004625 | Ga0055543_1001582 | Ga0055543_10015827 | 335 |
| 561 | 3300004625 | Ga0055543_1002113 | Ga0055543_10021136 | 335 |
| 562 | 3300005262 | Ga0065165_1000404 | Ga0065165_100040448 | 335 |
| 563 | 3300006948 | Ga0099826_10000052 | Ga0099826_1000005242 | 335 |
| 564 | 3300013102 | Ga0157371_10000001 | Ga0157371_10000001277 | 335 |
| 565 | 3300015261 | Ga0182006_1003516 | Ga0182006_10035163 | 335 |
| 566 | 3300015262 | Ga0182007_10002481 | Ga0182007_100024814 | 335 |
| 567 | 3300015262 | Ga0182007_10019825 | Ga0182007_100198252 | 335 |
| 568 | 3300015265 | Ga0182005_1002989 | Ga0182005_10029892 | 335 |
| 569 | 3300025208 | Ga0209436_100445 | Ga0209436_1004453 | 335 |
| 570 | 3300025208 | Ga0209436_101852 | Ga0209436_1018524 | 335 |
| 571 | 3300025208 | Ga0209436_113897 | Ga0209436_1138972 | 335 |
| 572 | 3300025224 | Ga0209784_100039 | Ga0209784_10003954 | 335 |
| 573 | 3300025225 | Ga0209566_100023 | Ga0209566_10002354 | 335 |
| 574 | 3300025226 | Ga0209674_100040 | Ga0209674_10004054 | 335 |
| 575 | 3300025230 | Ga0209563_100072 | Ga0209563_10007254 | 335 |
| 576 | 3300025231 | Ga0207427_101009 | Ga0207427_10100913 | 335 |
| 577 | 3300025233 | Ga0209437_100097 | Ga0209437_10009754 | 335 |
| 578 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011840 | 335 |
| 579 | 3300025245 | Ga0207425_1003063 | Ga0207425_10030635 | 335 |
| 580 | 3300025253 | Ga0209677_100041 | Ga0209677_10004154 | 335 |
| 581 | 3300025258 | Ga0209129_1000001 | Ga0209129_10000011017 | 335 |
| 582 | 3300025258 | Ga0209129_1019142 | Ga0209129_10191422 | 335 |
| 583 | 3300025261 | Ga0209233_1000122 | Ga0209233_100012254 | 335 |
| 584 | 3300025263 | Ga0209565_1000009 | Ga0209565_1000009267 | 335 |
| 585 | 3300025263 | Ga0209565_1001365 | Ga0209565_100136510 | 335 |
| 586 | 3300025263 | Ga0209565_1001610 | Ga0209565_10016107 | 335 |
| 587 | 3300025263 | Ga0209565_1002049 | Ga0209565_10020497 | 335 |
| 588 | 3300025263 | Ga0209565_1004635 | Ga0209565_10046355 | 335 |
| 589 | 3300025263 | Ga0209565_1010335 | Ga0209565_10103352 | 335 |
| 590 | 3300025273 | Ga0209673_1000019 | Ga0209673_1000019115 | 335 |
| 591 | 3300025273 | Ga0209673_1005407 | Ga0209673_10054073 | 335 |
| 592 | 3300025284 | Ga0209130_1000179 | Ga0209130_100017946 | 335 |
| 593 | 3300025284 | Ga0209130_1001179 | Ga0209130_10011793 | 335 |
| 594 | 3300025284 | Ga0209130_1002928 | Ga0209130_10029285 | 335 |
| 595 | 3300025291 | Ga0209675_1000028 | Ga0209675_1000028241 | 335 |
| 596 | 3300025291 | Ga0209675_1002184 | Ga0209675_10021847 | 335 |
| 597 | 3300025291 | Ga0209675_1007135 | Ga0209675_10071352 | 335 |
| 598 | 3300025295 | Ga0209564_1000058 | Ga0209564_100005853 | 335 |
| 599 | 3300025295 | Ga0209564_1000376 | Ga0209564_100037681 | 335 |
| 600 | 3300025295 | Ga0209564_1004759 | Ga0209564_10047593 | 335 |
| 601 | 3300025295 | Ga0209564_1010338 | Ga0209564_10103385 | 335 |
| 602 | 3300025297 | Ga0209758_1000166 | Ga0209758_100016670 | 335 |
| 603 | 3300025298 | Ga0209050_1000446 | Ga0209050_10004467 | 335 |
| 604 | 3300025298 | Ga0209050_1002114 | Ga0209050_10021142 | 335 |
| 605 | 3300025299 | Ga0209256_1000005 | Ga0209256_1000005479 | 335 |
| 606 | 3300025299 | Ga0209256_1000052 | Ga0209256_1000052101 | 335 |
| 607 | 3300025299 | Ga0209256_1001352 | Ga0209256_10013523 | 335 |
| 608 | 3300025299 | Ga0209256_1002086 | Ga0209256_100208615 | 335 |
| 609 | 3300025299 | Ga0209256_1003952 | Ga0209256_10039525 | 335 |
| 610 | 3300025299 | Ga0209256_1005512 | Ga0209256_10055125 | 335 |
| 611 | 3300025302 | Ga0207426_1003167 | Ga0207426_10031675 | 335 |
| 612 | 3300025304 | Ga0209257_1000107 | Ga0209257_100010779 | 335 |
| 613 | 3300025304 | Ga0209257_1006960 | Ga0209257_10069601 | 335 |
| 614 | 3300027666 | Ga0209282_1000001 | Ga0209282_10000012263 | 335 |
| 615 | 3300030736 | Ga0316180_1109577 | Ga0316180_11095772 | 335 |
| 616 | 3300031548 | Ga0307408_100000103 | Ga0307408_1000001033 | 335 |
| 617 | 3300031548 | Ga0307408_100009488 | Ga0307408_1000094882 | 335 |
| 618 | 3300031548 | Ga0307408_100019827 | Ga0307408_1000198272 | 335 |
| 619 | 3300031548 | Ga0307408_100021031 | Ga0307408_1000210313 | 335 |
| 620 | 3300044683 | Ga0466965_0011675 | Ga0466965_0011675_2842_3852 | 335 |
| 621 | 3300044765 | Ga0466970_0029818 | Ga0466970_0029818_1765_2775 | 335 |
| 622 | 3300046457 | Ga0495590_0004337 | Ga0495590_0004337_1085_2095 | 335 |
| 623 | 3300046460 | Ga0495638_0043295 | Ga0495638_0043295_45_1055 | 335 |
| 624 | 3300046460 | Ga0495638_0099950 | Ga0495638_0099950_301_1311 | 335 |
| 625 | 3300046462 | Ga0495651_0095122 | Ga0495651_0095122_493_1503 | 335 |
| 626 | 3300046462 | Ga0495651_0169961 | Ga0495651_0169961_499_1509 | 335 |
| 627 | 3300046463 | Ga0495653_0048971 | Ga0495653_0048971_1481_2491 | 335 |
| 628 | 3300046471 | Ga0495650_0000928 | Ga0495650_0000928_14328_15338 | 335 |
| 629 | 3300046471 | Ga0495650_0003015 | Ga0495650_0003015_2477_3490 | 335 |
| 630 | 3300046474 | Ga0495605_0015313 | Ga0495605_0015313_2568_3578 | 335 |
| 631 | 3300046491 | Ga0495584_0001921 | Ga0495584_0001921_3389_4399 | 335 |
| 632 | 3300046500 | Ga0495596_0002046 | Ga0495596_0002046_9387_10397 | 335 |
| 633 | 3300046501 | Ga0495607_0046699 | Ga0495607_0046699_950_1960 | 335 |
| 634 | 3300046501 | Ga0495607_0049245 | Ga0495607_0049245_570_1580 | 335 |
| 635 | 3300046506 | Ga0495583_0009024 | Ga0495583_0009024_164_1174 | 335 |
| 636 | 3300046507 | Ga0495606_0000068 | Ga0495606_0000068_114424_115434 | 335 |
| 637 | 3300046511 | Ga0495608_0005915 | Ga0495608_0005915_7569_8579 | 335 |
| 638 | 3300046513 | Ga0495616_0000120 | Ga0495616_0000120_64610_65620 | 335 |
| 639 | 3300046513 | Ga0495616_0002633 | Ga0495616_0002633_1833_2843 | 335 |
| 640 | 3300046513 | Ga0495616_0027697 | Ga0495616_0027697_1088_2098 | 335 |
| 641 | 3300046513 | Ga0495616_0028538 | Ga0495616_0028538_1184_2194 | 335 |
| 642 | 3300046516 | Ga0495628_0001623 | Ga0495628_0001623_1201_2211 | 335 |
| 643 | 3300046516 | Ga0495628_0002192 | Ga0495628_0002192_11462_12472 | 335 |
| 644 | 3300046518 | Ga0495631_0000103 | Ga0495631_0000103_54452_55462 | 335 |
| 645 | 3300046519 | Ga0495632_0003558 | Ga0495632_0003558_7944_8954 | 335 |
| 646 | 3300046520 | Ga0495637_0000364 | Ga0495637_0000364_13300_14313 | 335 |
| 647 | 3300046522 | Ga0495643_0000449 | Ga0495643_0000449_11702_12712 | 335 |
| 648 | 3300046522 | Ga0495643_0001738 | Ga0495643_0001738_2966_3976 | 335 |
| 649 | 3300046524 | Ga0495648_0019050 | Ga0495648_0019050_3722_4732 | 335 |
| 650 | 3300046524 | Ga0495648_0046801 | Ga0495648_0046801_211_1221 | 335 |
| 651 | 3300046528 | Ga0495642_0059312 | Ga0495642_0059312_392_1402 | 335 |
| 652 | 3300046529 | Ga0495652_0021749 | Ga0495652_0021749_4191_5201 | 335 |
| 653 | 3300046529 | Ga0495652_0100027 | Ga0495652_0100027_768_1778 | 335 |
| 654 | 3300046530 | Ga0495654_0000074 | Ga0495654_0000074_99376_100389 | 335 |
| 655 | 3300046530 | Ga0495654_0033672 | Ga0495654_0033672_436_1446 | 335 |
| 656 | 3300046538 | Ga0495609_0002919 | Ga0495609_0002919_6360_7370 | 335 |
| 657 | 3300046542 | Ga0495597_0001279 | Ga0495597_0001279_15998_17008 | 335 |
| 658 | 3300046543 | Ga0495645_0128434 | Ga0495645_0128434_26_1036 | 335 |
| 659 | 3300046543 | Ga0495645_0153163 | Ga0495645_0153163_498_1508 | 335 |
| 660 | 3300046616 | Ga0495668_0000063 | Ga0495668_0000063_87707_88717 | 335 |
| 661 | 3300046616 | Ga0495668_0000980 | Ga0495668_0000980_220_1230 | 335 |
| 662 | 3300046660 | Ga0495625_0022293 | Ga0495625_0022293_3457_4467 | 335 |
| 663 | 3300046660 | Ga0495625_0042547 | Ga0495625_0042547_1153_2163 | 335 |
| 664 | 3300046664 | Ga0495659_0000722 | Ga0495659_0000722_5945_6955 | 335 |
| 665 | 3300046680 | Ga0495646_0002836 | Ga0495646_0002836_6028_7038 | 335 |
| 666 | 3300046684 | Ga0495669_0004496 | Ga0495669_0004496_4633_5643 | 335 |
| 667 | 3300046690 | Ga0495624_0020569 | Ga0495624_0020569_1896_2906 | 335 |
| 668 | 3300046694 | Ga0495649_0002697 | Ga0495649_0002697_8374_9384 | 335 |
| 669 | 3300046794 | Ga0495589_0005491 | Ga0495589_0005491_4654_5664 | 335 |
| 670 | 3300046809 | Ga0495600_0001936 | Ga0495600_0001936_2562_3572 | 335 |
| 671 | 3300046810 | Ga0495660_0069945 | Ga0495660_0069945_64_1074 | 335 |
| 672 | 3300047318 | Ga0495636_0005147 | Ga0495636_0005147_1885_2895 | 335 |
| 673 | 3300047320 | Ga0495672_0000956 | Ga0495672_0000956_21694_22704 | 335 |
| 674 | 3300047323 | Ga0495683_0040575 | Ga0495683_0040575_255_1265 | 335 |
| 675 | 3300047443 | Ga0495687_002155 | Ga0495687_002155_7368_8378 | 335 |
| 676 | 3300047445 | Ga0495677_0002777 | Ga0495677_0002777_3908_4918 | 335 |
| 677 | 3300047446 | Ga0495679_011995 | Ga0495679_011995_2099_3109 | 335 |
| 678 | 3300047447 | Ga0495685_006228 | Ga0495685_006228_864_1874 | 335 |
| 679 | 3300047447 | Ga0495685_019891 | Ga0495685_019891_530_1540 | 335 |
| 680 | 3300047470 | Ga0495681_0022851 | Ga0495681_0022851_1194_2204 | 335 |
| 681 | 3300047472 | Ga0495686_0001174 | Ga0495686_0001174_12110_13120 | 335 |
| 682 | 3300047472 | Ga0495686_0002601 | Ga0495686_0002601_3204_4214 | 335 |
| 683 | 3300047472 | Ga0495686_0038907 | Ga0495686_0038907_782_1792 | 335 |
| 684 | 3300048091 | Ga0495626_0071450 | Ga0495626_0071450_404_1414 | 335 |
| 685 | 3300048927 | Ga0496124_0026196 | Ga0496124_0026196_1042_2052 | 335 |
| 686 | 3300048927 | Ga0496124_0029862 | Ga0496124_0029862_199_1209 | 335 |
| 687 | 3300049459 | Ga0495678_001239 | Ga0495678_001239_1395_2405 | 335 |
| 688 | 3300049459 | Ga0495678_048808 | Ga0495678_048808_370_1380 | 335 |
| 689 | 3300049665 | Ga0501227_028380 | Ga0501227_028380_146_1156 | 335 |
| 690 | 3300049775 | Ga0501279_000908 | Ga0501279_000908_507_1517 | 335 |
| 691 | 3300053077 | Ga0495601_0015834 | Ga0495601_0015834_768_1778 | 335 |
| 692 | 3300053119 | Ga0500595_005770 | Ga0500595_005770_4042_5052 | 335 |
| 693 | 3300053154 | Ga0500619_001217 | Ga0500619_001217_3188_4198 | 335 |
| 694 | iso_pu_bacteria | 2643221603 | 2644028245 | 335 |
| 695 | 3300042876 | Ga0451577_0005356 | Ga0451577_0005356_11475_12485 | 336 |
| 696 | 3300042876 | Ga0451577_0077190 | Ga0451577_0077190_851_1861 | 336 |
| 697 | 2162886007 | SwRhRL2b_contig_602634 | SwRhRL2b_0771.00000120 | 337 |
| 698 | 3300005289 | Ga0065704_10075032 | Ga0065704_100750323 | 337 |
| 699 | 3300031239 | Ga0265328_10009570 | Ga0265328_100095704 | 337 |
| 700 | 3300031344 | Ga0265316_10067899 | Ga0265316_100678992 | 337 |
| 701 | 3300042876 | Ga0451577_0020957 | Ga0451577_0020957_1127_2140 | 337 |
| 702 | 3300044712 | Ga0453684_0121483 | Ga0453684_0121483_1090_2103 | 337 |
| 703 | 3300045051 | Ga0451576_0033607 | Ga0451576_0033607_3473_4486 | 337 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6l85-assembly1.cif.gz_A | the sodium-dependent phosphate transporter | 0.9004 | 9 | 337 |
| 6l85-assembly1.cif.gz_A | the sodium-dependent phosphate transporter | 0.8773 | 9 | 337 |
| 6vq7-assembly1.cif.gz_g | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.2921 | 52 | 251 |
| 6vq7-assembly1.cif.gz_g | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.2848 | 52 | 251 |
| 7d06-assembly1.cif.gz_D | cryo em structure of the nucleotide free acinetobacter mlafedb complex | 0.2844 | 54 | 328 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P38361_8_554_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8692 | 15 | 325 | 3.40.50.2020 |
| af_P38361_8_554_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8033 | 15 | 325 | 3.40.50.2020 |
| af_A0A1D6H4R6_249_412_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3435 | 85 | 322 | 1.20.1250.20 |
| af_A0A1D6H4R6_249_412_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3363 | 85 | 322 | 1.20.1250.20 |
| af_I1N7G8_11_135_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.3346 | 133 | 238 | 1.20.140.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0UP37-F1-model_v4 | Inorganic phosphate transporter | 0.9847 | 146 | 324 |
GO:0005315
GO:0016020 GO:0035435 |
| AF-A0A7V2LXL0-F1-model_v4 | Inorganic phosphate transporter | 0.984 | 12 | 336 |
GO:0005315
GO:0016020 GO:0035435 |
| AF-A0A538GE76-F1-model_v4 | Inorganic phosphate transporter | 0.9838 | 9 | 337 |
GO:0005315
GO:0016020 GO:0035435 |
| AF-A0A346N0I1-F1-model_v4 | Inorganic phosphate transporter | 0.9832 | 7 | 336 |
GO:0005315
GO:0016020 GO:0035435 |
| AF-A0A3N8PF03-F1-model_v4 | Anion permease | 0.9829 | 115 | 306 |
GO:0005315
GO:0016020 GO:0035435 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar