F476322

General Info

Members Datasets Scaffolds Average Seq Length
703 386 699 330

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221603|2644028245
Length 344
Sequence HGIKQNKNLMQTLQISIYTLAFLILLALLFDFMNGFHDAANAIATVVSTGVLKPQHAVAMAAFFNVVAIFFFQLKVATTVGKGTIEPSVVDHYVVFGALVGAIFWNILTWYYGIPSSSSHALIGGLVGAAVAKAGTGALISSGLIKTIAFIVLSPLLGFVFGSIMMVVVSWLFVRSTPRRVDKWFRRAQLVSASMYSLGHGGNDAQKTMGIIWMLLIAAGYSSTTDPLPMWVVLSCYAAIGMGTLFGGWRIVKTMGQKITKLKPVGGFCAETGGAITLFLATALGVPVSTTHTITGAIVGVGSSRKMSAVRWGVAGNIVWAWIFTIPASAFVAAIAWWIGTKIL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2818991436 Collimonas arenae 515 Isolate Unclassified
6 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
89 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
90 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
91 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
123 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
124 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
141 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
192 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
197 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
198 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
199 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
200 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
201 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
202 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
203 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
213 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
241 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
242 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
258 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
259 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
260 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
265 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
266 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
267 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
268 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
269 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
272 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
273 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
274 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
275 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
276 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
277 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
278 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
281 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
299 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
316 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
324 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
325 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
326 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
339 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
340 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
341 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
361 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
363 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
364 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
365 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
366 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
367 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
368 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
369 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
372 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
379 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
380 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
381 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
382 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
383 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
384 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
385 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
386 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.23
Nodule 0.28
Rhizoplane 3.41
Rhizosphere 81.65
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_602634 2162886007 Bacteria 4965
2 JGI25163J39215_1002284 3300002771 Bacteria 2083
3 JGI25152J39213_1000839 3300002773 Bacteria 15259
4 JGI25150J39212_1000639 3300002774 Bacteria 13223
5 JGI25150J39212_1001574 3300002774 Bacteria 6236
6 JGI25150J39212_1002946 3300002774 Bacteria 4106
7 JGI25159J45721_1000701 3300002987 Bacteria 14633
8 JGI25159J45721_1005270 3300002987 Bacteria 4085
9 JGI25159J45721_1005657 3300002987 Bacteria 3886
10 JGI25165J46597_1000064 3300003214 Bacteria 199878
11 JGI25153J46596_10002118 3300003215 Bacteria 11612
12 JGI25160J50197_1003074 3300003354 Bacteria 7610
13 JGI25161J50226_1000500 3300003374 Bacteria 17353
14 JGI25161J50226_1001505 3300003374 Bacteria 6908
15 Ga0055538_1000031 3300003751 Bacteria 199878
16 Ga0055539_1000041 3300003752 Bacteria 199878
17 Ga0055533_1000051 3300003756 Bacteria 199878
18 Ga0055525_1000061 3300003759 Bacteria 199878
19 Ga0055526_1001572 3300003771 Bacteria 16064
20 Ga0055526_1004107 3300003771 Bacteria 8885
21 Ga0055526_1017481 3300003771 Bacteria 2734
22 Ga0055537_1000041 3300003773 Bacteria 91422
23 Ga0055537_1001581 3300003773 Bacteria 8639
24 Ga0055524_1000007 3300003775 Bacteria 298766
25 Ga0055524_1000153 3300003775 Bacteria 82019
26 Ga0055524_1001204 3300003775 Bacteria 15355
27 Ga0055524_1001786 3300003775 Bacteria 11814
28 Ga0055524_1005089 3300003775 Bacteria 5947
29 Ga0055524_1005404 3300003775 Bacteria 5713
30 Ga0055534_1000505 3300003784 Bacteria 21272
31 Ga0055534_1000540 3300003784 Bacteria 20263
32 Ga0055528_1000984 3300003790 Bacteria 18916
33 Ga0055528_1005770 3300003790 Bacteria 5704
34 Ga0055531_10002277 3300003794 Bacteria 12991
35 Ga0055541_1000028 3300003841 Bacteria 199878
36 Ga0055543_1001582 3300004625 Bacteria 8779
37 Ga0055543_1002113 3300004625 Bacteria 6896
38 Ga0065165_1000404 3300005262 Bacteria 69447
39 Ga0065704_10075032 3300005289 Bacteria 5833
40 Ga0065707_10083624 3300005295 Bacteria 8615
41 Ga0070658_10022476 3300005327 Bacteria 5061
42 Ga0070658_10322430 3300005327 Bacteria 1319
43 Ga0070676_10196668 3300005328 Bacteria 1319
44 Ga0070683_100003534 3300005329 Bacteria 12724
45 Ga0070690_100003271 3300005330 Bacteria 8849
46 Ga0070690_100043334 3300005330 Bacteria 2854
47 Ga0070690_100059421 3300005330 Bacteria 2458
48 Ga0070670_100000139 3300005331 Bacteria 67826
49 Ga0070670_100003576 3300005331 Bacteria 12933
50 Ga0070670_100108857 3300005331 Bacteria 2388
51 Ga0070677_10020732 3300005333 Bacteria 2399
52 Ga0068869_100088247 3300005334 Bacteria 2327
53 Ga0068869_100256851 3300005334 Bacteria 1398
54 Ga0070666_10003050 3300005335 Bacteria 10170
55 Ga0070666_10025974 3300005335 Bacteria 3822
56 Ga0070680_100093012 3300005336 Bacteria 2497
57 Ga0070680_100135048 3300005336 Bacteria 2066
58 Ga0070680_100394606 3300005336 Bacteria 1179
59 Ga0070682_100002647 3300005337 Bacteria 9897
60 Ga0070682_100033530 3300005337 Bacteria 3121
61 Ga0068868_100000052 3300005338 Bacteria 66081
62 Ga0068868_100002988 3300005338 Bacteria 11748
63 Ga0070689_100128831 3300005340 Bacteria 2028
64 Ga0070691_10155354 3300005341 Bacteria 1176
65 Ga0070687_100050223 3300005343 Bacteria 2153
66 Ga0070661_100000828 3300005344 Bacteria 22256
67 Ga0070661_100002567 3300005344 Bacteria 12450
68 Ga0070692_10082506 3300005345 Bacteria 1734
69 Ga0070668_100071999 3300005347 Bacteria 2693
70 Ga0070669_100080225 3300005353 Bacteria 2428
71 Ga0070669_100302158 3300005353 Bacteria 1287
72 Ga0070675_100003157 3300005354 Bacteria 12471
73 Ga0070671_100000380 3300005355 Bacteria 30594
74 Ga0070671_100050568 3300005355 Bacteria 3457
75 Ga0070671_100105151 3300005355 Bacteria 2369
76 Ga0070674_100056233 3300005356 Bacteria 2728
77 Ga0070674_100073256 3300005356 Bacteria 2427
78 Ga0070673_100002472 3300005364 Bacteria 11280
79 Ga0070673_100178659 3300005364 Bacteria 1816
80 Ga0070688_100168924 3300005365 Bacteria 1508
81 Ga0070659_100030020 3300005366 Bacteria 4205
82 Ga0070667_100350038 3300005367 Bacteria 1337
83 Ga0070710_10120125 3300005437 Bacteria 1590
84 Ga0070701_10001290 3300005438 Bacteria 9205
85 Ga0070701_10122015 3300005438 Bacteria 1470
86 Ga0070701_10193367 3300005438 Bacteria 1198
87 Ga0070705_100008425 3300005440 Bacteria 5107
88 Ga0070700_100004593 3300005441 Bacteria 7227
89 Ga0070700_100019740 3300005441 Bacteria 3893
90 Ga0070694_100162890 3300005444 Bacteria 1638
91 Ga0070694_100205254 3300005444 Bacteria 1471
92 Ga0070708_100021116 3300005445 Bacteria 5500
93 Ga0070663_100148234 3300005455 Bacteria 1797
94 Ga0070678_100000133 3300005456 Bacteria 30071
95 Ga0070662_100033372 3300005457 Bacteria 3623
96 Ga0070662_100090976 3300005457 Bacteria 2291
97 Ga0070681_10030525 3300005458 Bacteria 5408
98 Ga0070681_10175455 3300005458 Bacteria 2065
99 Ga0068867_100122275 3300005459 Bacteria 2013
100 Ga0068867_100312042 3300005459 Bacteria 1300
101 Ga0070685_10060074 3300005466 Bacteria 2221
102 Ga0070685_10088092 3300005466 Bacteria 1874
103 Ga0070679_100061976 3300005530 Bacteria 3728
104 Ga0070684_100063093 3300005535 Bacteria 3247
105 Ga0068853_100008911 3300005539 Bacteria 8076
106 Ga0070672_100000161 3300005543 Bacteria 37259
107 Ga0070672_100031713 3300005543 Bacteria 3981
108 Ga0070672_100032446 3300005543 Bacteria 3941
109 Ga0070672_100051544 3300005543 Bacteria 3210
110 Ga0070686_100336735 3300005544 Bacteria 1130
111 Ga0070695_100038851 3300005545 Bacteria 3006
112 Ga0070696_100036088 3300005546 Bacteria 3407
113 Ga0070665_100005913 3300005548 Bacteria 12535
114 Ga0070665_100016957 3300005548 Bacteria 7303
115 Ga0070665_100036349 3300005548 Bacteria 4954
116 Ga0070704_100004455 3300005549 Bacteria 8087
117 Ga0068855_100058882 3300005563 Bacteria 4496
118 Ga0068855_100521708 3300005563 Bacteria 1289
119 Ga0070664_100000778 3300005564 Bacteria 24605
120 Ga0070664_100003400 3300005564 Bacteria 12849
121 Ga0070664_100003658 3300005564 Bacteria 12383
122 Ga0068857_100059943 3300005577 Bacteria 3382
123 Ga0068854_100008869 3300005578 Bacteria 6473
124 Ga0068856_100377364 3300005614 Bacteria 1437
125 Ga0070702_100016569 3300005615 Bacteria 3784
126 Ga0070702_100064864 3300005615 Bacteria 2137
127 Ga0070702_100116174 3300005615 Bacteria 1668
128 Ga0068852_100000154 3300005616 Bacteria 45758
129 Ga0068859_100011998 3300005617 Bacteria 8703
130 Ga0068859_100030344 3300005617 Bacteria 5425
131 Ga0068859_100091196 3300005617 Bacteria 3098
132 Ga0068859_100148137 3300005617 Bacteria 2422
133 Ga0068864_100001323 3300005618 Bacteria 20596
134 Ga0068864_100002108 3300005618 Bacteria 16440
135 Ga0068861_100010878 3300005719 Bacteria 6322
136 Ga0068861_100023338 3300005719 Bacteria 4461
137 Ga0068861_100049514 3300005719 Bacteria 3181
138 Ga0068861_100150614 3300005719 Bacteria 1908
139 Ga0068861_100494959 3300005719 Bacteria 1104
140 Ga0068851_10000654 3300005834 Bacteria 14796
141 Ga0068870_10050469 3300005840 Bacteria 2198
142 Ga0068863_100002243 3300005841 Bacteria 19184
143 Ga0068863_100016337 3300005841 Bacteria 7121
144 Ga0068863_100017176 3300005841 Bacteria 6940
145 Ga0068858_100011447 3300005842 Bacteria 8375
146 Ga0068858_100041294 3300005842 Bacteria 4277
147 Ga0068860_100013959 3300005843 Bacteria 7875
148 Ga0068860_100278273 3300005843 Bacteria 1635
149 Ga0068862_100014237 3300005844 Bacteria 6597
150 Ga0068862_100134794 3300005844 Bacteria 2188
151 Ga0068862_100171490 3300005844 Bacteria 1942
152 Ga0081455_10007076 3300005937 Bacteria 11903
153 Ga0097621_100003402 3300006237 Bacteria 10956
154 Ga0097621_100016958 3300006237 Bacteria 5521
155 Ga0097621_100189541 3300006237 Bacteria 1780
156 Ga0068871_100000092 3300006358 Bacteria 52522
157 Ga0068871_100004973 3300006358 Bacteria 9284
158 Ga0068871_100033056 3300006358 Bacteria 4092
159 Ga0068871_100165764 3300006358 Bacteria 1891
160 Ga0075428_100014644 3300006844 Bacteria 8709
161 Ga0075430_100171165 3300006846 Bacteria 1807
162 Ga0075430_100183365 3300006846 Bacteria 1741
163 Ga0075433_10131112 3300006852 Bacteria 2227
164 Ga0068865_100023112 3300006881 Bacteria 4067
165 Ga0068865_100071985 3300006881 Bacteria 2454
166 Ga0068865_100082743 3300006881 Bacteria 2308
167 Ga0068865_100116468 3300006881 Bacteria 1979
168 Ga0097620_100011997 3300006931 Bacteria 8703
169 Ga0097620_100030344 3300006931 Bacteria 5425
170 Ga0097620_100091197 3300006931 Bacteria 3098
171 Ga0097620_100148128 3300006931 Bacteria 2422
172 Ga0099826_10000052 3300006948 Bacteria 73156
173 Ga0105240_10030806 3300009093 Bacteria 6969
174 Ga0105240_10060144 3300009093 Bacteria 4737
175 Ga0111539_10045433 3300009094 Bacteria 5258
176 Ga0111539_10079217 3300009094 Bacteria 3864
177 Ga0111539_10177614 3300009094 Bacteria 2487
178 Ga0105245_10015255 3300009098 Bacteria 6694
179 Ga0105245_10022419 3300009098 Bacteria 5544
180 Ga0105243_10018590 3300009148 Bacteria 5267
181 Ga0105243_10039431 3300009148 Bacteria 3682
182 Ga0105241_10089072 3300009174 Bacteria 2431
183 Ga0105242_10100504 3300009176 Bacteria 2450
184 Ga0105242_10238775 3300009176 Bacteria 1633
185 Ga0105248_10012985 3300009177 Bacteria 9181
186 Ga0105248_10152064 3300009177 Bacteria 2611
187 Ga0105249_10017231 3300009553 Bacteria 6411
188 Ga0105249_10084809 3300009553 Bacteria 2951
189 Ga0105246_10004725 3300011119 Bacteria 8295
190 Ga0157371_10000001 3300013102 Bacteria 1162285
191 Ga0157369_10087190 3300013105 Bacteria 3333
192 Ga0157374_10000136 3300013296 Bacteria 66574
193 Ga0157374_10001696 3300013296 Bacteria 18451
194 Ga0157374_10026122 3300013296 Bacteria 5251
195 Ga0157378_10003595 3300013297 Bacteria 13723
196 Ga0157378_10091651 3300013297 Bacteria 2764
197 Ga0157378_10161023 3300013297 Bacteria 2099
198 Ga0163162_10014976 3300013306 Bacteria 7575
199 Ga0163162_10021750 3300013306 Bacteria 6317
200 Ga0163162_10150181 3300013306 Bacteria 2447
201 Ga0163162_10364065 3300013306 Bacteria 1579
202 Ga0157372_10212810 3300013307 Bacteria 2240
203 Ga0157375_10001678 3300013308 Bacteria 19062
204 Ga0157375_10060726 3300013308 Bacteria 3751
205 Ga0157375_10078315 3300013308 Bacteria 3338
206 Ga0157375_10260077 3300013308 Bacteria 1897
207 Ga0157375_10380112 3300013308 Bacteria 1579
208 Ga0163163_10070857 3300014325 Bacteria 3472
209 Ga0157380_10027648 3300014326 Bacteria 4315
210 Ga0157380_10100428 3300014326 Bacteria 2409
211 Ga0157380_10203224 3300014326 Bacteria 1759
212 Ga0157380_10419890 3300014326 Bacteria 1275
213 Ga0157377_10034022 3300014745 Bacteria 2786
214 Ga0157379_10018785 3300014968 Bacteria 6095
215 Ga0157379_10034303 3300014968 Bacteria 4524
216 Ga0157379_10037078 3300014968 Bacteria 4347
217 Ga0157379_10037907 3300014968 Bacteria 4300
218 Ga0157376_10000389 3300014969 Bacteria 28637
219 Ga0157376_10050231 3300014969 Bacteria 3459
220 Ga0157376_10051163 3300014969 Bacteria 3431
221 Ga0182006_1003516 3300015261 Bacteria 7995
222 Ga0182007_10002481 3300015262 Bacteria 9145
223 Ga0182007_10019825 3300015262 Bacteria 2411
224 Ga0182005_1002989 3300015265 Bacteria 5851
225 Ga0209436_100445 3300025208 Bacteria 18569
226 Ga0209436_101852 3300025208 Bacteria 6855
227 Ga0209436_113897 3300025208 Bacteria 1300
228 Ga0209784_100039 3300025224 Bacteria 232021
229 Ga0209566_100023 3300025225 Bacteria 396571
230 Ga0209674_100040 3300025226 Bacteria 396571
231 Ga0209563_100072 3300025230 Bacteria 232021
232 Ga0207427_101009 3300025231 Bacteria 11777
233 Ga0209437_100097 3300025233 Bacteria 232021
234 Ga0207425_1000001 3300025245 Bacteria 2525432
235 Ga0207425_1003063 3300025245 Bacteria 5539
236 Ga0209677_100041 3300025253 Bacteria 232021
237 Ga0209129_1000001 3300025258 Bacteria 1452436
238 Ga0209129_1019142 3300025258 Bacteria 1300
239 Ga0209233_1000122 3300025261 Bacteria 232021
240 Ga0209565_1000009 3300025263 Bacteria 751701
241 Ga0209565_1001365 3300025263 Bacteria 11005
242 Ga0209565_1001610 3300025263 Bacteria 9548
243 Ga0209565_1002049 3300025263 Bacteria 7742
244 Ga0209565_1004635 3300025263 Bacteria 4144
245 Ga0209565_1010335 3300025263 Bacteria 2316
246 Ga0209673_1000019 3300025273 Bacteria 449094
247 Ga0209673_1005407 3300025273 Bacteria 6434
248 Ga0209130_1000179 3300025284 Bacteria 90126
249 Ga0209130_1001179 3300025284 Bacteria 18686
250 Ga0209130_1002928 3300025284 Bacteria 7800
251 Ga0209675_1000028 3300025291 Bacteria 281253
252 Ga0209675_1002184 3300025291 Bacteria 10263
253 Ga0209675_1007135 3300025291 Bacteria 4337
254 Ga0209564_1000058 3300025295 Bacteria 332955
255 Ga0209564_1000376 3300025295 Bacteria 82120
256 Ga0209564_1004759 3300025295 Bacteria 8116
257 Ga0209564_1010338 3300025295 Bacteria 4311
258 Ga0209758_1000166 3300025297 Bacteria 151104
259 Ga0209050_1000446 3300025298 Bacteria 74770
260 Ga0209050_1002114 3300025298 Bacteria 18120
261 Ga0209256_1000005 3300025299 Bacteria 1315082
262 Ga0209256_1000052 3300025299 Bacteria 299374
263 Ga0209256_1001352 3300025299 Bacteria 25972
264 Ga0209256_1002086 3300025299 Bacteria 17544
265 Ga0209256_1003952 3300025299 Bacteria 9749
266 Ga0209256_1005512 3300025299 Bacteria 7242
267 Ga0207426_1003167 3300025302 Bacteria 9303
268 Ga0209257_1000107 3300025304 Bacteria 240937
269 Ga0209257_1006960 3300025304 Bacteria 7046
270 Ga0207656_10004985 3300025321 Bacteria 4663
271 Ga0207655_1003226 3300025728 Bacteria 12257
272 Ga0207682_10003680 3300025893 Bacteria 6607
273 Ga0207682_10059372 3300025893 Bacteria 1598
274 Ga0207692_10104170 3300025898 Bacteria 1563
275 Ga0207680_10038250 3300025903 Bacteria 2777
276 Ga0207645_10077657 3300025907 Bacteria 2127
277 Ga0207645_10079070 3300025907 Bacteria 2108
278 Ga0207645_10251852 3300025907 Bacteria 1168
279 Ga0207705_10007611 3300025909 Bacteria 7964
280 Ga0207654_10052489 3300025911 Bacteria 2350
281 Ga0207707_10004822 3300025912 Bacteria 11829
282 Ga0207707_10040451 3300025912 Bacteria 4071
283 Ga0207707_10056798 3300025912 Bacteria 3406
284 Ga0207695_10030443 3300025913 Bacteria 5940
285 Ga0207660_10126896 3300025917 Bacteria 1938
286 Ga0207660_10401874 3300025917 Bacteria 1103
287 Ga0207662_10070866 3300025918 Bacteria 2109
288 Ga0207662_10161066 3300025918 Bacteria 1433
289 Ga0207662_10194293 3300025918 Bacteria 1311
290 Ga0207657_10035388 3300025919 Bacteria 4478
291 Ga0207649_10001756 3300025920 Bacteria 12435
292 Ga0207649_10141915 3300025920 Bacteria 1645
293 Ga0207646_10081660 3300025922 Bacteria 2890
294 Ga0207681_10099904 3300025923 Bacteria 2090
295 Ga0207650_10001124 3300025925 Bacteria 19682
296 Ga0207650_10022663 3300025925 Bacteria 4447
297 Ga0207650_10054076 3300025925 Bacteria 2977
298 Ga0207650_10136255 3300025925 Bacteria 1926
299 Ga0207650_10161299 3300025925 Bacteria 1777
300 Ga0207659_10001282 3300025926 Bacteria 15015
301 Ga0207644_10001590 3300025931 Bacteria 14666
302 Ga0207644_10016901 3300025931 Bacteria 4915
303 Ga0207690_10005703 3300025932 Bacteria 7354
304 Ga0207690_10322267 3300025932 Bacteria 1215
305 Ga0207706_10017591 3300025933 Bacteria 6441
306 Ga0207686_10036749 3300025934 Bacteria 2951
307 Ga0207686_10186863 3300025934 Bacteria 1474
308 Ga0207709_10023687 3300025935 Bacteria 3497
309 Ga0207709_10053600 3300025935 Bacteria 2482
310 Ga0207670_10006847 3300025936 Bacteria 6343
311 Ga0207670_10062351 3300025936 Bacteria 2548
312 Ga0207669_10043114 3300025937 Bacteria 2640
313 Ga0207669_10064597 3300025937 Bacteria 2266
314 Ga0207704_10072158 3300025938 Bacteria 2193
315 Ga0207691_10000043 3300025940 Bacteria 102398
316 Ga0207691_10003270 3300025940 Bacteria 15785
317 Ga0207691_10106928 3300025940 Bacteria 2491
318 Ga0207691_10143671 3300025940 Bacteria 2101
319 Ga0207711_10001630 3300025941 Bacteria 20705
320 Ga0207711_10018943 3300025941 Bacteria 5725
321 Ga0207711_10070604 3300025941 Bacteria 3029
322 Ga0207689_10002924 3300025942 Bacteria 15766
323 Ga0207689_10012333 3300025942 Bacteria 7312
324 Ga0207689_10026317 3300025942 Bacteria 4871
325 Ga0207689_10050097 3300025942 Bacteria 3444
326 Ga0207689_10302794 3300025942 Bacteria 1325
327 Ga0207689_10354906 3300025942 Bacteria 1219
328 Ga0207661_10000832 3300025944 Bacteria 20212
329 Ga0207679_10000574 3300025945 Bacteria 24632
330 Ga0207679_10002762 3300025945 Bacteria 10865
331 Ga0207667_10064465 3300025949 Bacteria 3825
332 Ga0207651_10002825 3300025960 Bacteria 8357
333 Ga0207651_10122166 3300025960 Bacteria 1977
334 Ga0207712_10116839 3300025961 Bacteria 2011
335 Ga0207712_10199320 3300025961 Bacteria 1586
336 Ga0207658_10246085 3300025986 Bacteria 1517
337 Ga0207658_10425434 3300025986 Bacteria 1172
338 Ga0207677_10000839 3300026023 Bacteria 17561
339 Ga0207677_10087689 3300026023 Bacteria 2254
340 Ga0207677_10213360 3300026023 Bacteria 1543
341 Ga0207703_10018380 3300026035 Bacteria 5458
342 Ga0207703_10243871 3300026035 Bacteria 1616
343 Ga0207678_10175595 3300026067 Bacteria 1829
344 Ga0207708_10005891 3300026075 Bacteria 9065
345 Ga0207708_10007712 3300026075 Bacteria 7967
346 Ga0207708_10053999 3300026075 Bacteria 3062
347 Ga0207708_10055683 3300026075 Bacteria 3016
348 Ga0207702_10060270 3300026078 Bacteria 3235
349 Ga0207641_10054803 3300026088 Bacteria 3385
350 Ga0207641_10077107 3300026088 Bacteria 2883
351 Ga0207648_10001650 3300026089 Bacteria 24468
352 Ga0207648_10005604 3300026089 Bacteria 12626
353 Ga0207648_10010589 3300026089 Bacteria 8722
354 Ga0207648_10021954 3300026089 Bacteria 5734
355 Ga0207648_10211067 3300026089 Bacteria 1724
356 Ga0207648_10262162 3300026089 Bacteria 1542
357 Ga0207676_10002671 3300026095 Bacteria 12671
358 Ga0207675_100007805 3300026118 Bacteria 10096
359 Ga0207675_100009401 3300026118 Bacteria 9160
360 Ga0207675_100039483 3300026118 Bacteria 4405
361 Ga0207675_100216812 3300026118 Bacteria 1843
362 Ga0207683_10000091 3300026121 Bacteria 72654
363 Ga0207683_10061271 3300026121 Bacteria 3311
364 Ga0207683_10185039 3300026121 Bacteria 1890
365 Ga0207683_10441601 3300026121 Bacteria 1199
366 Ga0207698_10000303 3300026142 Bacteria 29530
367 Ga0209282_1000001 3300027666 Bacteria 2450367
368 Ga0209966_1003408 3300027695 Bacteria 2673
369 Ga0207428_10179339 3300027907 Bacteria 1601
370 Ga0268266_10018807 3300028379 Bacteria 5887
371 Ga0268266_10106420 3300028379 Bacteria 2479
372 Ga0268266_10115900 3300028379 Bacteria 2379
373 Ga0268266_10172793 3300028379 Bacteria 1962
374 Ga0268265_10060865 3300028380 Bacteria 2895
375 Ga0268265_10067478 3300028380 Bacteria 2769
376 Ga0268265_10101630 3300028380 Bacteria 2323
377 Ga0265318_10024589 3300028577 Bacteria 2387
378 Ga0316180_1109577 3300030736 Bacteria 4462
379 Ga0265330_10004213 3300031235 Bacteria 7335
380 Ga0265332_10002783 3300031238 Bacteria 8695
381 Ga0265328_10001439 3300031239 Bacteria 10959
382 Ga0265328_10009570 3300031239 Bacteria 3941
383 Ga0265325_10145424 3300031241 Bacteria 1125
384 Ga0265329_10003330 3300031242 Bacteria 7028
385 Ga0265331_10011063 3300031250 Bacteria 4950
386 Ga0265327_10041394 3300031251 Bacteria 2484
387 Ga0265316_10025384 3300031344 Bacteria 4946
388 Ga0265316_10067899 3300031344 Bacteria 2756
389 Ga0307513_10049717 3300031456 Bacteria 4539
390 Ga0307513_10095992 3300031456 Bacteria 3004
391 Ga0307513_10227853 3300031456 Bacteria 1678
392 Ga0307509_10020099 3300031507 Bacteria 7590
393 Ga0307408_100000103 3300031548 Bacteria 93203
394 Ga0307408_100009488 3300031548 Bacteria 6419
395 Ga0307408_100019827 3300031548 Bacteria 4529
396 Ga0307408_100021031 3300031548 Bacteria 4410
397 Ga0265313_10078270 3300031595 Bacteria 1508
398 Ga0316575_10001963 3300031665 Bacteria 6816
399 Ga0265314_10002821 3300031711 Bacteria 17326
400 Ga0265314_10010351 3300031711 Bacteria 7787
401 Ga0265342_10009537 3300031712 Bacteria 6823
402 Ga0316576_10117649 3300031727 Bacteria 1994
403 Ga0307405_10341956 3300031731 Bacteria 1151
404 Ga0316577_10112474 3300031733 Bacteria 1528
405 Ga0307413_10025670 3300031824 Bacteria 3234
406 Ga0307413_10049951 3300031824 Bacteria 2510
407 Ga0307410_10003260 3300031852 Bacteria 8104
408 Ga0307410_10026068 3300031852 Bacteria 3674
409 Ga0307409_100045785 3300031995 Bacteria 3306
410 Ga0307416_100144212 3300032002 Bacteria 2171
411 Ga0307416_100309129 3300032002 Bacteria 1576
412 Ga0307411_10002266 3300032005 Bacteria 8409
413 Ga0307411_10174919 3300032005 Bacteria 1623
414 Ga0373934_0000134 3300035086 Bacteria 27424
415 Ga0373944_0072262 3300035089 Bacteria 1126
416 Ga0373954_0005310 3300035118 Bacteria 5566
417 Ga0373954_0048164 3300035118 Bacteria 1996
418 Ga0373956_0000006 3300035119 Bacteria 65782
419 Ga0373956_0008199 3300035119 Bacteria 4228
420 Ga0373955_0007451 3300035172 Bacteria 5032
421 Ga0373955_0012679 3300035172 Bacteria 4056
422 Ga0316574_0023043 3300035398 Bacteria 3714
423 Ga0373931_0174656 3300035691 Bacteria 1268
424 Ga0373935_0036070 3300035692 Bacteria 3089
425 Ga0373927_0004491 3300035695 Bacteria 9764
426 Ga0373933_0000564 3300035724 Bacteria 23136
427 Ga0373937_0003219 3300036401 Bacteria 13673
428 Ga0316584_0022111 3300036712 Bacteria 4634
429 Ga0373925_0007446 3300037068 Bacteria 7987
430 Ga0395899_0000344 3300037312 Bacteria 57423
431 Ga0395900_0064859 3300037418 Bacteria 3752
432 Ga0395900_0077918 3300037418 Bacteria 3405
433 Ga0395900_0180285 3300037418 Bacteria 2147
434 Ga0395905_0006025 3300037471 Bacteria 12275
435 Ga0395905_0009860 3300037471 Bacteria 9310
436 Ga0395905_0011146 3300037471 Bacteria 8693
437 Ga0395901_0000533 3300038443 Bacteria 43906
438 Ga0436361_0314082 3300039447 Bacteria 3272
439 Ga0451807_2141541 3300041486 Bacteria 2311
440 Ga0451835_1197999 3300041492 Bacteria 1420
441 Ga0451841_0390070 3300041498 Bacteria 2605
442 Ga0451851_0647212 3300041507 Bacteria 2358
443 Ga0451853_3612137 3300041512 Bacteria 1615
444 Ga0451577_0005356 3300042876 Bacteria 13163
445 Ga0451577_0020957 3300042876 Bacteria 5991
446 Ga0451577_0049802 3300042876 Bacteria 3740
447 Ga0451577_0077190 3300042876 Bacteria 2970
448 Ga0466972_0000070 3300044658 Bacteria 100242
449 Ga0466972_0034493 3300044658 Bacteria 2479
450 Ga0466965_0001667 3300044683 Bacteria 9113
451 Ga0466965_0011675 3300044683 Bacteria 4120
452 Ga0466966_0068935 3300044684 Bacteria 2219
453 Ga0466964_0070986 3300044706 Bacteria 1472
454 Ga0453684_0121483 3300044712 Bacteria 3152
455 Ga0453684_0131363 3300044712 Bacteria 3004
456 Ga0466970_0007209 3300044765 Bacteria 5569
457 Ga0466970_0029818 3300044765 Bacteria 2875
458 Ga0466959_0006523 3300045049 Bacteria 8093
459 Ga0451576_0033607 3300045051 Bacteria 5452
460 Ga0495627_000005 3300046453 Bacteria 630805
461 Ga0495592_0063301 3300046454 Bacteria 2713
462 Ga0495590_0001849 3300046457 Bacteria 8955
463 Ga0495590_0004337 3300046457 Bacteria 5736
464 Ga0495590_0073995 3300046457 Bacteria 1198
465 Ga0495638_0005242 3300046460 Bacteria 9684
466 Ga0495638_0024357 3300046460 Bacteria 3947
467 Ga0495638_0043295 3300046460 Bacteria 2841
468 Ga0495638_0099950 3300046460 Bacteria 1736
469 Ga0495638_0117859 3300046460 Bacteria 1571
470 Ga0495641_0002246 3300046461 Bacteria 15388
471 Ga0495651_0000233 3300046462 Bacteria 42757
472 Ga0495651_0000919 3300046462 Bacteria 22867
473 Ga0495651_0095122 3300046462 Bacteria 2228
474 Ga0495651_0169961 3300046462 Bacteria 1553
475 Ga0495653_0048971 3300046463 Bacteria 3258
476 Ga0495653_0049498 3300046463 Bacteria 3236
477 Ga0495650_0000928 3300046471 Bacteria 34124
478 Ga0495650_0003015 3300046471 Bacteria 12708
479 Ga0495650_0010815 3300046471 Bacteria 5061
480 Ga0495580_0043976 3300046472 Bacteria 3177
481 Ga0495605_0015313 3300046474 Bacteria 4174
482 Ga0495639_0001153 3300046475 Bacteria 11928
483 Ga0495664_0029766 3300046477 Bacteria 3195
484 Ga0495584_0001921 3300046491 Bacteria 11946
485 Ga0495596_0002046 3300046500 Bacteria 11073
486 Ga0495607_0046699 3300046501 Bacteria 2540
487 Ga0495607_0049245 3300046501 Bacteria 2458
488 Ga0495583_0009024 3300046506 Bacteria 6008
489 Ga0495606_0000068 3300046507 Bacteria 179653
490 Ga0495606_0016860 3300046507 Bacteria 5548
491 Ga0495608_0005915 3300046511 Bacteria 8701
492 Ga0495608_0109247 3300046511 Bacteria 1778
493 Ga0495610_0006855 3300046512 Bacteria 7723
494 Ga0495616_0000120 3300046513 Bacteria 68995
495 Ga0495616_0002633 3300046513 Bacteria 11806
496 Ga0495616_0021729 3300046513 Bacteria 3470
497 Ga0495616_0027697 3300046513 Bacteria 3005
498 Ga0495616_0028538 3300046513 Bacteria 2954
499 Ga0495618_0040435 3300046514 Bacteria 2934
500 Ga0495628_0001623 3300046516 Bacteria 20598
501 Ga0495628_0002192 3300046516 Bacteria 17666
502 Ga0495628_0035967 3300046516 Bacteria 3977
503 Ga0495630_0020406 3300046517 Bacteria 4885
504 Ga0495631_0000103 3300046518 Bacteria 55680
505 Ga0495632_0003558 3300046519 Bacteria 11008
506 Ga0495637_0000364 3300046520 Bacteria 34551
507 Ga0495637_0022686 3300046520 Bacteria 2860
508 Ga0495643_0000449 3300046522 Bacteria 52833
509 Ga0495643_0001738 3300046522 Bacteria 18789
510 Ga0495643_0004000 3300046522 Bacteria 10530
511 Ga0495648_0019050 3300046524 Bacteria 4840
512 Ga0495648_0046801 3300046524 Bacteria 2678
513 Ga0495666_0004375 3300046526 Bacteria 7136
514 Ga0495642_0026858 3300046528 Bacteria 2289
515 Ga0495642_0059312 3300046528 Bacteria 1586
516 Ga0495652_0021749 3300046529 Bacteria 5702
517 Ga0495652_0100027 3300046529 Bacteria 2353
518 Ga0495654_0000074 3300046530 Bacteria 114325
519 Ga0495654_0033672 3300046530 Bacteria 2591
520 Ga0495665_0013316 3300046531 Bacteria 4450
521 Ga0495640_0091867 3300046533 Bacteria 2002
522 Ga0495586_0004382 3300046535 Bacteria 7545
523 Ga0495586_0147107 3300046535 Bacteria 1324
524 Ga0495587_0142644 3300046536 Bacteria 1366
525 Ga0495587_0201821 3300046536 Bacteria 1124
526 Ga0495609_0000560 3300046538 Bacteria 29330
527 Ga0495609_0002919 3300046538 Bacteria 10170
528 Ga0495609_0023933 3300046538 Bacteria 2803
529 Ga0495597_0001279 3300046542 Bacteria 18545
530 Ga0495645_0128434 3300046543 Bacteria 1779
531 Ga0495645_0153163 3300046543 Bacteria 1600
532 Ga0495667_0002319 3300046559 Bacteria 12751
533 Ga0495667_0013455 3300046559 Bacteria 5539
534 Ga0495656_0012735 3300046615 Bacteria 3112
535 Ga0495668_0000063 3300046616 Bacteria 184563
536 Ga0495668_0000980 3300046616 Bacteria 31179
537 Ga0495634_0014557 3300046642 Bacteria 5669
538 Ga0495625_0022293 3300046660 Bacteria 4859
539 Ga0495625_0034951 3300046660 Bacteria 3707
540 Ga0495625_0042547 3300046660 Bacteria 3300
541 Ga0495625_0079339 3300046660 Bacteria 2289
542 Ga0495625_0082434 3300046660 Bacteria 2237
543 Ga0495625_0086400 3300046660 Bacteria 2176
544 Ga0495625_0190022 3300046660 Bacteria 1361
545 Ga0495635_0013574 3300046663 Bacteria 5700
546 Ga0495659_0000722 3300046664 Bacteria 11879
547 Ga0495661_0004218 3300046665 Bacteria 10442
548 Ga0495657_0009456 3300046675 Bacteria 7382
549 Ga0495657_0176750 3300046675 Bacteria 1312
550 Ga0495599_0144058 3300046678 Bacteria 1477
551 Ga0495646_0002836 3300046680 Bacteria 10723
552 Ga0495658_0072539 3300046683 Bacteria 2002
553 Ga0495669_0004496 3300046684 Bacteria 5763
554 Ga0495613_0019470 3300046689 Bacteria 5058
555 Ga0495624_0020569 3300046690 Bacteria 4388
556 Ga0495649_0002697 3300046694 Bacteria 12365
557 Ga0495649_0007818 3300046694 Bacteria 6480
558 Ga0495589_0005491 3300046794 Bacteria 6687
559 Ga0495600_0001936 3300046809 Bacteria 11633
560 Ga0495600_0196981 3300046809 Bacteria 1294
561 Ga0495660_0001203 3300046810 Bacteria 18117
562 Ga0495660_0069945 3300046810 Bacteria 1864
563 Ga0495604_0048140 3300047317 Bacteria 3316
564 Ga0495636_0005147 3300047318 Bacteria 5132
565 Ga0495636_0076114 3300047318 Bacteria 1439
566 Ga0495674_0003032 3300047319 Bacteria 16351
567 Ga0495672_0000956 3300047320 Bacteria 30049
568 Ga0495683_0040575 3300047323 Bacteria 2351
569 Ga0495687_002155 3300047443 Bacteria 16431
570 Ga0495687_004211 3300047443 Bacteria 9868
571 Ga0495675_0001126 3300047444 Bacteria 16251
572 Ga0495677_0002777 3300047445 Bacteria 6830
573 Ga0495679_011995 3300047446 Bacteria 3323
574 Ga0495685_006228 3300047447 Bacteria 3902
575 Ga0495685_019891 3300047447 Bacteria 2307
576 Ga0495681_0022851 3300047470 Bacteria 3336
577 Ga0495684_0145196 3300047471 Bacteria 1777
578 Ga0495686_0001174 3300047472 Bacteria 30574
579 Ga0495686_0002601 3300047472 Bacteria 16742
580 Ga0495686_0038907 3300047472 Bacteria 3040
581 Ga0495626_0015026 3300048091 Bacteria 3968
582 Ga0495626_0071450 3300048091 Bacteria 1559
583 Ga0496101_0121877 3300048904 Bacteria 1972
584 Ga0496101_0137002 3300048904 Bacteria 1863
585 Ga0496102_0295027 3300048905 Bacteria 1528
586 Ga0496104_0045265 3300048907 Bacteria 4138
587 Ga0496104_0200458 3300048907 Bacteria 1908
588 Ga0496105_0042336 3300048908 Bacteria 3754
589 Ga0496105_0121664 3300048908 Bacteria 2152
590 Ga0496107_0179040 3300048910 Bacteria 1574
591 Ga0496108_0040465 3300048911 Bacteria 3886
592 Ga0496108_0041766 3300048911 Bacteria 3830
593 Ga0496109_0007070 3300048912 Bacteria 9473
594 Ga0496109_0113152 3300048912 Bacteria 2524
595 Ga0496109_0122303 3300048912 Bacteria 2425
596 Ga0496110_0000225 3300048913 Bacteria 36623
597 Ga0496110_0335371 3300048913 Bacteria 1378
598 Ga0496111_0290071 3300048914 Bacteria 1213
599 Ga0496112_0008077 3300048915 Bacteria 9397
600 Ga0496113_0060816 3300048916 Bacteria 2849
601 Ga0496114_0020108 3300048917 Bacteria 5416
602 Ga0496114_0028930 3300048917 Bacteria 4552
603 Ga0496114_0101027 3300048917 Bacteria 2462
604 Ga0496114_0131732 3300048917 Bacteria 2160
605 Ga0496114_0254535 3300048917 Bacteria 1545
606 Ga0496121_0117941 3300048924 Bacteria 2010
607 Ga0496124_0026196 3300048927 Bacteria 5263
608 Ga0496124_0029862 3300048927 Bacteria 4849
609 Ga0496125_0007840 3300048928 Bacteria 11284
610 Ga0496126_0118001 3300048929 Bacteria 2304
611 Ga0495678_001239 3300049459 Bacteria 20765
612 Ga0495678_048808 3300049459 Bacteria 1649
613 Ga0501032_0280685 3300049569 Bacteria 1078
614 Ga0501034_0002533 3300049571 Bacteria 21868
615 Ga0501036_0040050 3300049572 Bacteria 3963
616 Ga0501038_0026175 3300049574 Bacteria 5197
617 Ga0501038_0056844 3300049574 Bacteria 3360
618 Ga0501038_0171667 3300049574 Bacteria 1755
619 Ga0501039_0057697 3300049575 Bacteria 3006
620 Ga0501039_0168339 3300049575 Bacteria 1723
621 Ga0501040_0018261 3300049576 Bacteria 4656
622 Ga0501040_0123248 3300049576 Bacteria 1819
623 Ga0501041_0026896 3300049577 Bacteria 3464
624 Ga0501042_0007566 3300049578 Bacteria 7127
625 Ga0501042_0102593 3300049578 Bacteria 2058
626 Ga0501042_0225916 3300049578 Bacteria 1350
627 Ga0501043_0127402 3300049579 Bacteria 1996
628 Ga0501043_0273588 3300049579 Bacteria 1296
629 Ga0501048_0164771 3300049582 Bacteria 1569
630 Ga0501067_0100704 3300049583 Bacteria 1605
631 Ga0501068_0000871 3300049584 Bacteria 15718
632 Ga0501068_0001556 3300049584 Bacteria 12190
633 Ga0501068_0140766 3300049584 Bacteria 1512
634 Ga0501069_0224266 3300049585 Bacteria 1093
635 Ga0501070_0010805 3300049586 Bacteria 7713
636 Ga0501071_0028011 3300049587 Bacteria 3967
637 Ga0501071_0042307 3300049587 Bacteria 3264
638 Ga0501072_0003671 3300049588 Bacteria 11569
639 Ga0501072_0007982 3300049588 Bacteria 8033
640 Ga0501073_0000354 3300049589 Bacteria 30944
641 Ga0501073_0003155 3300049589 Bacteria 12358
642 Ga0501074_0000312 3300049590 Bacteria 28193
643 Ga0501074_0052117 3300049590 Bacteria 2954
644 Ga0501074_0134830 3300049590 Bacteria 1766
645 Ga0501075_0001010 3300049591 Bacteria 17996
646 Ga0501075_0016348 3300049591 Bacteria 5342
647 Ga0501075_0023259 3300049591 Bacteria 4536
648 Ga0501075_0050895 3300049591 Bacteria 3114
649 Ga0501076_0007929 3300049592 Bacteria 7745
650 Ga0501076_0013750 3300049592 Bacteria 6073
651 Ga0501076_0078677 3300049592 Bacteria 2646
652 Ga0501077_0007924 3300049593 Bacteria 6563
653 Ga0501227_028380 3300049665 Bacteria 1329
654 Ga0501079_0000416 3300049741 Bacteria 27691
655 Ga0501079_0004121 3300049741 Bacteria 10754
656 Ga0501079_0005114 3300049741 Bacteria 9743
657 Ga0501079_0019011 3300049741 Bacteria 5249
658 Ga0501079_0284439 3300049741 Bacteria 1293
659 Ga0501080_0012130 3300049742 Bacteria 7895
660 Ga0501080_0015303 3300049742 Bacteria 7071
661 Ga0501080_0070202 3300049742 Bacteria 3258
662 Ga0501080_0151655 3300049742 Bacteria 2142
663 Ga0501080_0152715 3300049742 Bacteria 2134
664 Ga0501080_0290183 3300049742 Bacteria 1485
665 Ga0501081_0003335 3300049743 Bacteria 10211
666 Ga0501081_0043473 3300049743 Bacteria 3082
667 Ga0501083_0298257 3300049744 Bacteria 1048
668 Ga0501279_000908 3300049775 Bacteria 3905
669 Ga0501035_0110077 3300049822 Bacteria 2414
670 Ga0501044_0217377 3300049823 Bacteria 1863
671 Ga0501044_0334001 3300049823 Bacteria 1438
672 Ga0501045_0001888 3300049824 Bacteria 14189
673 Ga0501045_0027039 3300049824 Bacteria 4131
674 nmdc:mga0qj67_114492_c1 3300050509 Bacteria 2178
675 nmdc:mga0qj67_136015_c1 3300050509 Bacteria 1991
676 nmdc:mga08y16_145811_c1 3300050511 Bacteria 2461
677 nmdc:mga08y16_171501_c1 3300050511 Bacteria 2253
678 nmdc:mga08y16_177040_c1 3300050511 Bacteria 2215
679 nmdc:mga08y16_55212_c1 3300050511 Bacteria 4151
680 nmdc:mga0rr50_202657_c1 3300050513 Bacteria 1631
681 nmdc:mga08x19_218752_c1 3300050514 Bacteria 1308
682 nmdc:mga0a205_61625_c1 3300050515 Bacteria 3623
683 Ga0495601_0015834 3300053077 Bacteria 4564
684 Ga0495595_0000317 3300053084 Bacteria 18797
685 Ga0495619_0001741 3300053085 Bacteria 14446
686 Ga0500595_005770 3300053119 Bacteria 5351
687 Ga0500628_022306 3300053129 Bacteria 1294
688 Ga0500616_0000032 3300053153 Bacteria 403673
689 Ga0500619_001217 3300053154 Bacteria 4487
690 Ga0501084_0003146 3300054114 Bacteria 13347
691 Ga0501084_0005381 3300054114 Bacteria 10493
692 Ga0501084_0025179 3300054114 Bacteria 4964
693 Ga0501084_0211276 3300054114 Bacteria 1637
694 Ga0501084_0215534 3300054114 Bacteria 1620
695 Ga0501082_0011156 3300060353 Bacteria 7725
696 Ga0501082_0014345 3300060353 Bacteria 6818
697 Ga0530510_0001261 3300061734 Bacteria 16889
698 Ga0530510_0001840 3300061734 Bacteria 14493
699 Ga0530510_0149701 3300061734 Bacteria 1723

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050513 nmdc:mga0rr50_202657_c1 nmdc:mga0rr50_202657_c1_15_821 268
2 3300046536 Ga0495587_0201821 Ga0495587_0201821_248_1108 285
3 3300048091 Ga0495626_0015026 Ga0495626_0015026_16_876 285
4 3300049743 Ga0501081_0003335 Ga0501081_0003335_9342_10199 285
5 3300046660 Ga0495625_0034951 Ga0495625_0034951_370_1383 288
6 3300005842 Ga0068858_100011447 Ga0068858_1000114477 306
7 3300014325 Ga0163163_10070857 Ga0163163_100708572 306
8 3300014968 Ga0157379_10037078 Ga0157379_100370785 306
9 3300026035 Ga0207703_10018380 Ga0207703_100183804 306
10 3300046453 Ga0495627_000005 Ga0495627_000005_343270_344283 306
11 3300046460 Ga0495638_0005242 Ga0495638_0005242_2595_3596 306
12 3300046538 Ga0495609_0000560 Ga0495609_0000560_27242_28255 306
13 3300046810 Ga0495660_0001203 Ga0495660_0001203_2177_3190 306
14 3300005331 Ga0070670_100108857 Ga0070670_1001088573 309
15 3300025925 Ga0207650_10161299 Ga0207650_101612992 309
16 3300047318 Ga0495636_0076114 Ga0495636_0076114_11_1009 309
17 3300025728 Ga0207655_1003226 Ga0207655_100322610 310
18 3300005337 Ga0070682_100002647 Ga0070682_1000026476 311
19 3300046660 Ga0495625_0086400 Ga0495625_0086400_338_1339 311
20 3300046660 Ga0495625_0190022 Ga0495625_0190022_118_1119 311
21 3300049569 Ga0501032_0280685 Ga0501032_0280685_133_1068 311
22 3300049584 Ga0501068_0140766 Ga0501068_0140766_567_1502 311
23 3300049585 Ga0501069_0224266 Ga0501069_0224266_11_946 311
24 3300049591 Ga0501075_0050895 Ga0501075_0050895_2168_3103 311
25 3300049741 Ga0501079_0284439 Ga0501079_0284439_18_956 311
26 3300050511 nmdc:mga08y16_55212_c1 nmdc:mga08y16_55212_c1_11_949 311
27 3300054114 Ga0501084_0215534 Ga0501084_0215534_674_1609 311
28 3300046694 Ga0495649_0007818 Ga0495649_0007818_1739_2740 315
29 3300026089 Ga0207648_10211067 Ga0207648_102110671 317
30 3300041486 Ga0451807_2141541 Ga0451807_2141541_916_1917 317
31 3300005330 Ga0070690_100059421 Ga0070690_1000594212 318
32 3300005334 Ga0068869_100088247 Ga0068869_1000882474 318
33 3300005347 Ga0070668_100071999 Ga0070668_1000719994 318
34 3300005353 Ga0070669_100302158 Ga0070669_1003021582 318
35 3300005438 Ga0070701_10193367 Ga0070701_101933671 318
36 3300005466 Ga0070685_10060074 Ga0070685_100600741 318
37 3300005543 Ga0070672_100051544 Ga0070672_1000515444 318
38 3300005544 Ga0070686_100336735 Ga0070686_1003367351 318
39 3300005719 Ga0068861_100150614 Ga0068861_1001506143 318
40 3300005840 Ga0068870_10050469 Ga0068870_100504692 318
41 3300006237 Ga0097621_100189541 Ga0097621_1001895412 318
42 3300006881 Ga0068865_100116468 Ga0068865_1001164682 318
43 3300009148 Ga0105243_10039431 Ga0105243_100394313 318
44 3300009176 Ga0105242_10100504 Ga0105242_101005043 318
45 3300013296 Ga0157374_10026122 Ga0157374_100261222 318
46 3300013306 Ga0163162_10364065 Ga0163162_103640652 318
47 3300014326 Ga0157380_10419890 Ga0157380_104198901 318
48 3300014968 Ga0157379_10037907 Ga0157379_100379074 318
49 3300014969 Ga0157376_10050231 Ga0157376_100502312 318
50 3300025893 Ga0207682_10059372 Ga0207682_100593722 318
51 3300025907 Ga0207645_10077657 Ga0207645_100776572 318
52 3300025907 Ga0207645_10251852 Ga0207645_102518521 318
53 3300025925 Ga0207650_10136255 Ga0207650_101362553 318
54 3300025935 Ga0207709_10053600 Ga0207709_100536003 318
55 3300025940 Ga0207691_10143671 Ga0207691_101436712 318
56 3300025942 Ga0207689_10012333 Ga0207689_100123334 318
57 3300025986 Ga0207658_10246085 Ga0207658_102460852 318
58 3300026089 Ga0207648_10021954 Ga0207648_100219544 318
59 3300026118 Ga0207675_100216812 Ga0207675_1002168123 318
60 3300026121 Ga0207683_10185039 Ga0207683_101850393 318
61 3300028379 Ga0268266_10172793 Ga0268266_101727933 318
62 3300046615 Ga0495656_0012735 Ga0495656_0012735_2092_3093 318
63 3300009094 Ga0111539_10045433 Ga0111539_100454332 319
64 3300031456 Ga0307513_10227853 Ga0307513_102278532 319
65 3300035691 Ga0373931_0174656 Ga0373931_0174656_130_1125 319
66 3300046512 Ga0495610_0006855 Ga0495610_0006855_6269_7267 319
67 3300005459 Ga0068867_100312042 Ga0068867_1003120422 320
68 3300025918 Ga0207662_10161066 Ga0207662_101610662 320
69 3300026089 Ga0207648_10262162 Ga0207648_102621622 320
70 3300042876 Ga0451577_0049802 Ga0451577_0049802_330_1328 320
71 3300005336 Ga0070680_100394606 Ga0070680_1003946061 321
72 3300005458 Ga0070681_10030525 Ga0070681_100305254 321
73 3300025912 Ga0207707_10056798 Ga0207707_100567983 321
74 3300025917 Ga0207660_10401874 Ga0207660_104018741 321
75 3300031241 Ga0265325_10145424 Ga0265325_101454241 321
76 3300005327 Ga0070658_10022476 Ga0070658_100224762 322
77 3300005327 Ga0070658_10322430 Ga0070658_103224302 322
78 3300014326 Ga0157380_10100428 Ga0157380_101004282 322
79 3300025909 Ga0207705_10007611 Ga0207705_100076114 322
80 3300049574 Ga0501038_0171667 Ga0501038_0171667_271_1272 322
81 3300049575 Ga0501039_0057697 Ga0501039_0057697_296_1297 322
82 3300049575 Ga0501039_0168339 Ga0501039_0168339_668_1669 322
83 3300049576 Ga0501040_0018261 Ga0501040_0018261_250_1251 322
84 3300049578 Ga0501042_0225916 Ga0501042_0225916_267_1268 322
85 3300049583 Ga0501067_0100704 Ga0501067_0100704_83_1084 322
86 3300049584 Ga0501068_0000871 Ga0501068_0000871_3792_4781 322
87 3300049584 Ga0501068_0001556 Ga0501068_0001556_10772_11773 322
88 3300049586 Ga0501070_0010805 Ga0501070_0010805_3457_4458 322
89 3300049588 Ga0501072_0007982 Ga0501072_0007982_2766_3767 322
90 3300049589 Ga0501073_0000354 Ga0501073_0000354_15009_16010 322
91 3300049589 Ga0501073_0003155 Ga0501073_0003155_9796_10785 322
92 3300049590 Ga0501074_0000312 Ga0501074_0000312_25700_26701 322
93 3300049590 Ga0501074_0052117 Ga0501074_0052117_1805_2794 322
94 3300049591 Ga0501075_0016348 Ga0501075_0016348_1289_2290 322
95 3300049592 Ga0501076_0013750 Ga0501076_0013750_369_1370 322
96 3300049592 Ga0501076_0078677 Ga0501076_0078677_1286_2287 322
97 3300049741 Ga0501079_0000416 Ga0501079_0000416_25684_26685 322
98 3300049741 Ga0501079_0005114 Ga0501079_0005114_5802_6803 322
99 3300049742 Ga0501080_0012130 Ga0501080_0012130_5493_6494 322
100 3300049742 Ga0501080_0015303 Ga0501080_0015303_3898_4887 322
101 3300049744 Ga0501083_0298257 Ga0501083_0298257_30_1031 322
102 3300049824 Ga0501045_0027039 Ga0501045_0027039_2616_3617 322
103 3300053129 Ga0500628_022306 Ga0500628_022306_265_1266 322
104 3300054114 Ga0501084_0003146 Ga0501084_0003146_10226_11227 322
105 3300054114 Ga0501084_0005381 Ga0501084_0005381_6286_7287 322
106 3300060353 Ga0501082_0011156 Ga0501082_0011156_6598_7599 322
107 3300031456 Ga0307513_10095992 Ga0307513_100959923 323
108 3300031995 Ga0307409_100045785 Ga0307409_1000457852 323
109 3300035089 Ga0373944_0072262 Ga0373944_0072262_11_982 323
110 3300046538 Ga0495609_0023933 Ga0495609_0023933_1807_2781 323
111 3300053153 Ga0500616_0000032 Ga0500616_0000032_291507_292514 323
112 3300005543 Ga0070672_100031713 Ga0070672_1000317132 324
113 3300005841 Ga0068863_100017176 Ga0068863_1000171766 324
114 3300005937 Ga0081455_10007076 Ga0081455_100070768 324
115 3300013308 Ga0157375_10060726 Ga0157375_100607264 324
116 3300025940 Ga0207691_10003270 Ga0207691_1000327011 324
117 3300026088 Ga0207641_10054803 Ga0207641_100548033 324
118 3300005530 Ga0070679_100061976 Ga0070679_1000619764 325
119 3300005563 Ga0068855_100058882 Ga0068855_1000588823 325
120 3300013307 Ga0157372_10212810 Ga0157372_102128101 325
121 3300025912 Ga0207707_10004822 Ga0207707_100048228 325
122 3300025949 Ga0207667_10064465 Ga0207667_100644653 325
123 3300026078 Ga0207702_10060270 Ga0207702_100602702 325
124 3300031711 Ga0265314_10010351 Ga0265314_100103513 325
125 3300037471 Ga0395905_0011146 Ga0395905_0011146_3817_4827 325
126 3300005353 Ga0070669_100080225 Ga0070669_1000802253 326
127 3300009093 Ga0105240_10060144 Ga0105240_100601442 326
128 3300013105 Ga0157369_10087190 Ga0157369_100871903 326
129 3300014326 Ga0157380_10027648 Ga0157380_100276485 326
130 3300025937 Ga0207669_10064597 Ga0207669_100645973 326
131 3300027907 Ga0207428_10179339 Ga0207428_101793392 326
132 3300050511 nmdc:mga08y16_171501_c1 nmdc:mga08y16_171501_c1_1183_2184 326
133 3300025918 Ga0207662_10194293 Ga0207662_101942931 328
134 3300005328 Ga0070676_10196668 Ga0070676_101966682 329
135 3300005329 Ga0070683_100003534 Ga0070683_1000035348 329
136 3300005331 Ga0070670_100000139 Ga0070670_10000013915 329
137 3300005333 Ga0070677_10020732 Ga0070677_100207323 329
138 3300005335 Ga0070666_10025974 Ga0070666_100259743 329
139 3300005336 Ga0070680_100093012 Ga0070680_1000930122 329
140 3300005336 Ga0070680_100135048 Ga0070680_1001350482 329
141 3300005338 Ga0068868_100000052 Ga0068868_10000005214 329
142 3300005340 Ga0070689_100128831 Ga0070689_1001288311 329
143 3300005344 Ga0070661_100000828 Ga0070661_10000082818 329
144 3300005354 Ga0070675_100003157 Ga0070675_1000031576 329
145 3300005355 Ga0070671_100000380 Ga0070671_1000003809 329
146 3300005355 Ga0070671_100105151 Ga0070671_1001051513 329
147 3300005356 Ga0070674_100073256 Ga0070674_1000732563 329
148 3300005364 Ga0070673_100002472 Ga0070673_1000024724 329
149 3300005367 Ga0070667_100350038 Ga0070667_1003500381 329
150 3300005438 Ga0070701_10122015 Ga0070701_101220151 329
151 3300005441 Ga0070700_100004593 Ga0070700_1000045932 329
152 3300005444 Ga0070694_100162890 Ga0070694_1001628902 329
153 3300005445 Ga0070708_100021116 Ga0070708_1000211164 329
154 3300005455 Ga0070663_100148234 Ga0070663_1001482342 329
155 3300005456 Ga0070678_100000133 Ga0070678_10000013310 329
156 3300005457 Ga0070662_100033372 Ga0070662_1000333722 329
157 3300005459 Ga0068867_100122275 Ga0068867_1001222751 329
158 3300005466 Ga0070685_10088092 Ga0070685_100880922 329
159 3300005535 Ga0070684_100063093 Ga0070684_1000630932 329
160 3300005539 Ga0068853_100008911 Ga0068853_1000089117 329
161 3300005543 Ga0070672_100000161 Ga0070672_10000016113 329
162 3300005564 Ga0070664_100003400 Ga0070664_1000034008 329
163 3300005578 Ga0068854_100008869 Ga0068854_1000088692 329
164 3300005615 Ga0070702_100016569 Ga0070702_1000165694 329
165 3300005615 Ga0070702_100116174 Ga0070702_1001161742 329
166 3300005616 Ga0068852_100000154 Ga0068852_10000015415 329
167 3300005617 Ga0068859_100148137 Ga0068859_1001481373 329
168 3300005618 Ga0068864_100001323 Ga0068864_10000132314 329
169 3300005834 Ga0068851_10000654 Ga0068851_1000065410 329
170 3300005841 Ga0068863_100016337 Ga0068863_1000163373 329
171 3300005842 Ga0068858_100041294 Ga0068858_1000412944 329
172 3300005843 Ga0068860_100278273 Ga0068860_1002782731 329
173 3300006237 Ga0097621_100003402 Ga0097621_1000034028 329
174 3300006358 Ga0068871_100000092 Ga0068871_10000009238 329
175 3300006358 Ga0068871_100165764 Ga0068871_1001657642 329
176 3300006881 Ga0068865_100023112 Ga0068865_1000231124 329
177 3300006881 Ga0068865_100071985 Ga0068865_1000719851 329
178 3300006881 Ga0068865_100082743 Ga0068865_1000827433 329
179 3300006931 Ga0097620_100148128 Ga0097620_1001481283 329
180 3300009093 Ga0105240_10030806 Ga0105240_100308066 329
181 3300009148 Ga0105243_10018590 Ga0105243_100185904 329
182 3300009177 Ga0105248_10012985 Ga0105248_100129854 329
183 3300009177 Ga0105248_10152064 Ga0105248_101520643 329
184 3300009553 Ga0105249_10017231 Ga0105249_100172317 329
185 3300009553 Ga0105249_10084809 Ga0105249_100848093 329
186 3300013296 Ga0157374_10000136 Ga0157374_1000013613 329
187 3300013297 Ga0157378_10003595 Ga0157378_100035956 329
188 3300013297 Ga0157378_10091651 Ga0157378_100916514 329
189 3300013297 Ga0157378_10161023 Ga0157378_101610232 329
190 3300013306 Ga0163162_10014976 Ga0163162_100149766 329
191 3300013308 Ga0157375_10001678 Ga0157375_1000167813 329
192 3300013308 Ga0157375_10260077 Ga0157375_102600772 329
193 3300013308 Ga0157375_10380112 Ga0157375_103801122 329
194 3300014745 Ga0157377_10034022 Ga0157377_100340223 329
195 3300014968 Ga0157379_10018785 Ga0157379_100187852 329
196 3300014969 Ga0157376_10000389 Ga0157376_100003896 329
197 3300025321 Ga0207656_10004985 Ga0207656_100049853 329
198 3300025893 Ga0207682_10003680 Ga0207682_100036806 329
199 3300025907 Ga0207645_10079070 Ga0207645_100790703 329
200 3300025912 Ga0207707_10040451 Ga0207707_100404512 329
201 3300025913 Ga0207695_10030443 Ga0207695_100304434 329
202 3300025920 Ga0207649_10001756 Ga0207649_100017567 329
203 3300025922 Ga0207646_10081660 Ga0207646_100816602 329
204 3300025923 Ga0207681_10099904 Ga0207681_100999042 329
205 3300025925 Ga0207650_10001124 Ga0207650_100011246 329
206 3300025925 Ga0207650_10054076 Ga0207650_100540763 329
207 3300025926 Ga0207659_10001282 Ga0207659_1000128213 329
208 3300025931 Ga0207644_10001590 Ga0207644_1000159012 329
209 3300025933 Ga0207706_10017591 Ga0207706_100175917 329
210 3300025934 Ga0207686_10036749 Ga0207686_100367492 329
211 3300025935 Ga0207709_10023687 Ga0207709_100236872 329
212 3300025937 Ga0207669_10043114 Ga0207669_100431142 329
213 3300025940 Ga0207691_10000043 Ga0207691_1000004313 329
214 3300025941 Ga0207711_10018943 Ga0207711_100189435 329
215 3300025941 Ga0207711_10070604 Ga0207711_100706042 329
216 3300025942 Ga0207689_10002924 Ga0207689_1000292410 329
217 3300025942 Ga0207689_10026317 Ga0207689_100263172 329
218 3300025944 Ga0207661_10000832 Ga0207661_1000083217 329
219 3300025945 Ga0207679_10000574 Ga0207679_100005746 329
220 3300025960 Ga0207651_10002825 Ga0207651_100028254 329
221 3300025961 Ga0207712_10116839 Ga0207712_101168391 329
222 3300026023 Ga0207677_10000839 Ga0207677_1000083912 329
223 3300026023 Ga0207677_10213360 Ga0207677_102133602 329
224 3300026067 Ga0207678_10175595 Ga0207678_101755952 329
225 3300026075 Ga0207708_10005891 Ga0207708_100058911 329
226 3300026075 Ga0207708_10055683 Ga0207708_100556833 329
227 3300026088 Ga0207641_10077107 Ga0207641_100771072 329
228 3300026089 Ga0207648_10001650 Ga0207648_100016503 329
229 3300026089 Ga0207648_10005604 Ga0207648_1000560412 329
230 3300026089 Ga0207648_10010589 Ga0207648_100105897 329
231 3300026095 Ga0207676_10002671 Ga0207676_100026717 329
232 3300026121 Ga0207683_10000091 Ga0207683_1000009154 329
233 3300026121 Ga0207683_10061271 Ga0207683_100612713 329
234 3300026121 Ga0207683_10441601 Ga0207683_104416012 329
235 3300026142 Ga0207698_10000303 Ga0207698_1000030312 329
236 3300028577 Ga0265318_10024589 Ga0265318_100245892 329
237 3300031235 Ga0265330_10004213 Ga0265330_100042135 329
238 3300031238 Ga0265332_10002783 Ga0265332_100027835 329
239 3300031239 Ga0265328_10001439 Ga0265328_100014396 329
240 3300031242 Ga0265329_10003330 Ga0265329_100033304 329
241 3300031250 Ga0265331_10011063 Ga0265331_100110634 329
242 3300031344 Ga0265316_10025384 Ga0265316_100253844 329
243 3300031595 Ga0265313_10078270 Ga0265313_100782702 329
244 3300031711 Ga0265314_10002821 Ga0265314_100028214 329
245 3300031712 Ga0265342_10009537 Ga0265342_100095372 329
246 3300048904 Ga0496101_0137002 Ga0496101_0137002_659_1651 329
247 3300048907 Ga0496104_0200458 Ga0496104_0200458_696_1688 329
248 3300048911 Ga0496108_0040465 Ga0496108_0040465_958_1950 329
249 3300048912 Ga0496109_0007070 Ga0496109_0007070_1755_2747 329
250 3300048913 Ga0496110_0000225 Ga0496110_0000225_30939_31931 329
251 3300048917 Ga0496114_0028930 Ga0496114_0028930_573_1565 329
252 3300048917 Ga0496114_0101027 Ga0496114_0101027_20_1012 329
253 3300048928 Ga0496125_0007840 Ga0496125_0007840_9755_10747 329
254 3300048929 Ga0496126_0118001 Ga0496126_0118001_966_1958 329
255 3300049571 Ga0501034_0002533 Ga0501034_0002533_10628_11617 329
256 3300049574 Ga0501038_0026175 Ga0501038_0026175_1908_2900 329
257 3300049577 Ga0501041_0026896 Ga0501041_0026896_830_1822 329
258 3300049578 Ga0501042_0007566 Ga0501042_0007566_4967_5959 329
259 3300049579 Ga0501043_0127402 Ga0501043_0127402_252_1244 329
260 3300049587 Ga0501071_0028011 Ga0501071_0028011_1656_2648 329
261 3300049587 Ga0501071_0042307 Ga0501071_0042307_380_1372 329
262 3300049588 Ga0501072_0003671 Ga0501072_0003671_9448_10437 329
263 3300049591 Ga0501075_0001010 Ga0501075_0001010_20_1012 329
264 3300049592 Ga0501076_0007929 Ga0501076_0007929_6734_7726 329
265 3300049593 Ga0501077_0007924 Ga0501077_0007924_4855_5847 329
266 3300049741 Ga0501079_0019011 Ga0501079_0019011_1059_2051 329
267 3300049743 Ga0501081_0043473 Ga0501081_0043473_83_1075 329
268 3300049823 Ga0501044_0334001 Ga0501044_0334001_379_1371 329
269 3300049824 Ga0501045_0001888 Ga0501045_0001888_12476_13468 329
270 3300054114 Ga0501084_0025179 Ga0501084_0025179_603_1595 329
271 3300060353 Ga0501082_0014345 Ga0501082_0014345_4283_5275 329
272 3300061734 Ga0530510_0001261 Ga0530510_0001261_7410_8402 329
273 3300031251 Ga0265327_10041394 Ga0265327_100413941 330
274 3300046471 Ga0495650_0010815 Ga0495650_0010815_2603_3616 330
275 3300005334 Ga0068869_100256851 Ga0068869_1002568512 331
276 3300005548 Ga0070665_100036349 Ga0070665_1000363495 331
277 3300005719 Ga0068861_100010878 Ga0068861_1000108785 331
278 3300005844 Ga0068862_100134794 Ga0068862_1001347943 331
279 3300006846 Ga0075430_100183365 Ga0075430_1001833652 331
280 3300025942 Ga0207689_10302794 Ga0207689_103027942 331
281 3300028379 Ga0268266_10106420 Ga0268266_101064203 331
282 3300031824 Ga0307413_10049951 Ga0307413_100499513 331
283 3300031852 Ga0307410_10003260 Ga0307410_100032604 331
284 3300035086 Ga0373934_0000134 Ga0373934_0000134_18542_19540 331
285 3300035118 Ga0373954_0005310 Ga0373954_0005310_538_1536 331
286 3300035118 Ga0373954_0048164 Ga0373954_0048164_486_1484 331
287 3300035119 Ga0373956_0000006 Ga0373956_0000006_7281_8279 331
288 3300035119 Ga0373956_0008199 Ga0373956_0008199_1438_2436 331
289 3300035172 Ga0373955_0007451 Ga0373955_0007451_3372_4370 331
290 3300035172 Ga0373955_0012679 Ga0373955_0012679_1327_2325 331
291 3300035692 Ga0373935_0036070 Ga0373935_0036070_1629_2627 331
292 3300035695 Ga0373927_0004491 Ga0373927_0004491_6209_7207 331
293 3300035724 Ga0373933_0000564 Ga0373933_0000564_10610_11608 331
294 3300036401 Ga0373937_0003219 Ga0373937_0003219_3087_4085 331
295 3300037068 Ga0373925_0007446 Ga0373925_0007446_6353_7351 331
296 3300046454 Ga0495592_0063301 Ga0495592_0063301_463_1461 331
297 3300046461 Ga0495641_0002246 Ga0495641_0002246_7922_8920 331
298 3300046462 Ga0495651_0000233 Ga0495651_0000233_33128_34126 331
299 3300046462 Ga0495651_0000919 Ga0495651_0000919_9987_10985 331
300 3300046463 Ga0495653_0049498 Ga0495653_0049498_2061_3059 331
301 3300046472 Ga0495580_0043976 Ga0495580_0043976_942_1940 331
302 3300046475 Ga0495639_0001153 Ga0495639_0001153_9001_9999 331
303 3300046477 Ga0495664_0029766 Ga0495664_0029766_271_1269 331
304 3300046511 Ga0495608_0109247 Ga0495608_0109247_404_1402 331
305 3300046514 Ga0495618_0040435 Ga0495618_0040435_1254_2252 331
306 3300046516 Ga0495628_0035967 Ga0495628_0035967_1289_2287 331
307 3300046517 Ga0495630_0020406 Ga0495630_0020406_3710_4708 331
308 3300046520 Ga0495637_0022686 Ga0495637_0022686_240_1238 331
309 3300046526 Ga0495666_0004375 Ga0495666_0004375_4863_5861 331
310 3300046531 Ga0495665_0013316 Ga0495665_0013316_2135_3133 331
311 3300046533 Ga0495640_0091867 Ga0495640_0091867_620_1618 331
312 3300046535 Ga0495586_0004382 Ga0495586_0004382_6173_7171 331
313 3300046535 Ga0495586_0147107 Ga0495586_0147107_192_1190 331
314 3300046536 Ga0495587_0142644 Ga0495587_0142644_128_1126 331
315 3300046559 Ga0495667_0002319 Ga0495667_0002319_9987_10985 331
316 3300046559 Ga0495667_0013455 Ga0495667_0013455_1769_2767 331
317 3300046642 Ga0495634_0014557 Ga0495634_0014557_2773_3771 331
318 3300046663 Ga0495635_0013574 Ga0495635_0013574_3266_4264 331
319 3300046675 Ga0495657_0009456 Ga0495657_0009456_1140_2138 331
320 3300046675 Ga0495657_0176750 Ga0495657_0176750_29_1027 331
321 3300046678 Ga0495599_0144058 Ga0495599_0144058_469_1467 331
322 3300046683 Ga0495658_0072539 Ga0495658_0072539_620_1618 331
323 3300046689 Ga0495613_0019470 Ga0495613_0019470_794_1792 331
324 3300046809 Ga0495600_0196981 Ga0495600_0196981_50_1048 331
325 3300047317 Ga0495604_0048140 Ga0495604_0048140_1121_2119 331
326 3300047319 Ga0495674_0003032 Ga0495674_0003032_14432_15430 331
327 3300047444 Ga0495675_0001126 Ga0495675_0001126_8231_9229 331
328 3300047471 Ga0495684_0145196 Ga0495684_0145196_267_1265 331
329 3300050509 nmdc:mga0qj67_136015_c1 nmdc:mga0qj67_136015_c1_816_1811 331
330 3300050514 nmdc:mga08x19_218752_c1 nmdc:mga08x19_218752_c1_181_1179 331
331 3300053084 Ga0495595_0000317 Ga0495595_0000317_10447_11445 331
332 3300053085 Ga0495619_0001741 Ga0495619_0001741_4965_5963 331
333 iso_pu_bacteria 2643221554 2643787456 331
334 iso_pu_bacteria 2643221638 2644214023 331
335 iso_pu_bacteria 2818991436 2819541197 331
336 3300005614 Ga0068856_100377364 Ga0068856_1003773641 332
337 3300005844 Ga0068862_100171490 Ga0068862_1001714902 332
338 3300046460 Ga0495638_0117859 Ga0495638_0117859_403_1401 332
339 3300046513 Ga0495616_0021729 Ga0495616_0021729_364_1362 332
340 3300046660 Ga0495625_0082434 Ga0495625_0082434_1162_2160 332
341 3300005295 Ga0065707_10083624 Ga0065707_100836245 333
342 3300005330 Ga0070690_100003271 Ga0070690_1000032713 333
343 3300005330 Ga0070690_100043334 Ga0070690_1000433342 333
344 3300005331 Ga0070670_100003576 Ga0070670_1000035766 333
345 3300005335 Ga0070666_10003050 Ga0070666_100030506 333
346 3300005337 Ga0070682_100033530 Ga0070682_1000335303 333
347 3300005338 Ga0068868_100002988 Ga0068868_1000029886 333
348 3300005341 Ga0070691_10155354 Ga0070691_101553541 333
349 3300005343 Ga0070687_100050223 Ga0070687_1000502231 333
350 3300005345 Ga0070692_10082506 Ga0070692_100825062 333
351 3300005355 Ga0070671_100050568 Ga0070671_1000505682 333
352 3300005356 Ga0070674_100056233 Ga0070674_1000562332 333
353 3300005364 Ga0070673_100178659 Ga0070673_1001786592 333
354 3300005365 Ga0070688_100168924 Ga0070688_1001689242 333
355 3300005437 Ga0070710_10120125 Ga0070710_101201252 333
356 3300005438 Ga0070701_10001290 Ga0070701_100012903 333
357 3300005440 Ga0070705_100008425 Ga0070705_1000084255 333
358 3300005441 Ga0070700_100019740 Ga0070700_1000197403 333
359 3300005444 Ga0070694_100205254 Ga0070694_1002052541 333
360 3300005543 Ga0070672_100032446 Ga0070672_1000324463 333
361 3300005545 Ga0070695_100038851 Ga0070695_1000388513 333
362 3300005546 Ga0070696_100036088 Ga0070696_1000360882 333
363 3300005548 Ga0070665_100016957 Ga0070665_1000169573 333
364 3300005549 Ga0070704_100004455 Ga0070704_1000044553 333
365 3300005564 Ga0070664_100000778 Ga0070664_10000077824 333
366 3300005615 Ga0070702_100064864 Ga0070702_1000648643 333
367 3300005617 Ga0068859_100011998 Ga0068859_1000119984 333
368 3300005617 Ga0068859_100030344 Ga0068859_1000303442 333
369 3300005617 Ga0068859_100091196 Ga0068859_1000911962 333
370 3300005618 Ga0068864_100002108 Ga0068864_1000021083 333
371 3300005719 Ga0068861_100023338 Ga0068861_1000233383 333
372 3300005841 Ga0068863_100002243 Ga0068863_1000022432 333
373 3300005843 Ga0068860_100013959 Ga0068860_1000139594 333
374 3300005844 Ga0068862_100014237 Ga0068862_1000142373 333
375 3300006237 Ga0097621_100016958 Ga0097621_1000169585 333
376 3300006358 Ga0068871_100004973 Ga0068871_1000049739 333
377 3300006358 Ga0068871_100033056 Ga0068871_1000330564 333
378 3300006844 Ga0075428_100014644 Ga0075428_1000146446 333
379 3300006846 Ga0075430_100171165 Ga0075430_1001711652 333
380 3300006852 Ga0075433_10131112 Ga0075433_101311122 333
381 3300006931 Ga0097620_100011997 Ga0097620_1000119976 333
382 3300006931 Ga0097620_100030344 Ga0097620_1000303442 333
383 3300006931 Ga0097620_100091197 Ga0097620_1000911972 333
384 3300009094 Ga0111539_10079217 Ga0111539_100792173 333
385 3300009094 Ga0111539_10177614 Ga0111539_101776143 333
386 3300009098 Ga0105245_10022419 Ga0105245_100224192 333
387 3300009176 Ga0105242_10238775 Ga0105242_102387752 333
388 3300011119 Ga0105246_10004725 Ga0105246_100047254 333
389 3300013296 Ga0157374_10001696 Ga0157374_1000169614 333
390 3300013306 Ga0163162_10021750 Ga0163162_100217506 333
391 3300013308 Ga0157375_10078315 Ga0157375_100783153 333
392 3300014326 Ga0157380_10203224 Ga0157380_102032242 333
393 3300014968 Ga0157379_10034303 Ga0157379_100343032 333
394 3300025898 Ga0207692_10104170 Ga0207692_101041701 333
395 3300025903 Ga0207680_10038250 Ga0207680_100382501 333
396 3300025917 Ga0207660_10126896 Ga0207660_101268962 333
397 3300025918 Ga0207662_10070866 Ga0207662_100708661 333
398 3300025920 Ga0207649_10141915 Ga0207649_101419152 333
399 3300025925 Ga0207650_10022663 Ga0207650_100226632 333
400 3300025931 Ga0207644_10016901 Ga0207644_100169012 333
401 3300025934 Ga0207686_10186863 Ga0207686_101868632 333
402 3300025936 Ga0207670_10006847 Ga0207670_100068474 333
403 3300025936 Ga0207670_10062351 Ga0207670_100623513 333
404 3300025938 Ga0207704_10072158 Ga0207704_100721581 333
405 3300025940 Ga0207691_10106928 Ga0207691_101069282 333
406 3300025941 Ga0207711_10001630 Ga0207711_100016303 333
407 3300025942 Ga0207689_10354906 Ga0207689_103549061 333
408 3300025960 Ga0207651_10122166 Ga0207651_101221662 333
409 3300025961 Ga0207712_10199320 Ga0207712_101993202 333
410 3300025986 Ga0207658_10425434 Ga0207658_104254341 333
411 3300026075 Ga0207708_10007712 Ga0207708_100077122 333
412 3300026075 Ga0207708_10053999 Ga0207708_100539993 333
413 3300026118 Ga0207675_100007805 Ga0207675_1000078054 333
414 3300026118 Ga0207675_100009401 Ga0207675_1000094017 333
415 3300027695 Ga0209966_1003408 Ga0209966_10034082 333
416 3300028379 Ga0268266_10115900 Ga0268266_101159002 333
417 3300028380 Ga0268265_10067478 Ga0268265_100674783 333
418 3300028380 Ga0268265_10101630 Ga0268265_101016303 333
419 3300031456 Ga0307513_10049717 Ga0307513_100497175 333
420 3300031507 Ga0307509_10020099 Ga0307509_100200992 333
421 3300031665 Ga0316575_10001963 Ga0316575_100019635 333
422 3300031727 Ga0316576_10117649 Ga0316576_101176492 333
423 3300031731 Ga0307405_10341956 Ga0307405_103419561 333
424 3300031733 Ga0316577_10112474 Ga0316577_101124742 333
425 3300031824 Ga0307413_10025670 Ga0307413_100256703 333
426 3300031852 Ga0307410_10026068 Ga0307410_100260684 333
427 3300032002 Ga0307416_100144212 Ga0307416_1001442122 333
428 3300032002 Ga0307416_100309129 Ga0307416_1003091292 333
429 3300032005 Ga0307411_10002266 Ga0307411_100022666 333
430 3300032005 Ga0307411_10174919 Ga0307411_101749192 333
431 3300035398 Ga0316574_0023043 Ga0316574_0023043_1248_2249 333
432 3300036712 Ga0316584_0022111 Ga0316584_0022111_876_1877 333
433 3300041492 Ga0451835_1197999 Ga0451835_1197999_163_1164 333
434 3300041498 Ga0451841_0390070 Ga0451841_0390070_1309_2310 333
435 3300041507 Ga0451851_0647212 Ga0451851_0647212_398_1399 333
436 3300041512 Ga0451853_3612137 Ga0451853_3612137_366_1367 333
437 3300046457 Ga0495590_0001849 Ga0495590_0001849_4608_5609 333
438 3300046460 Ga0495638_0024357 Ga0495638_0024357_1153_2154 333
439 3300046660 Ga0495625_0079339 Ga0495625_0079339_663_1664 333
440 3300048904 Ga0496101_0121877 Ga0496101_0121877_634_1635 333
441 3300048905 Ga0496102_0295027 Ga0496102_0295027_292_1293 333
442 3300048907 Ga0496104_0045265 Ga0496104_0045265_1356_2357 333
443 3300048908 Ga0496105_0121664 Ga0496105_0121664_171_1172 333
444 3300048912 Ga0496109_0122303 Ga0496109_0122303_145_1146 333
445 3300048915 Ga0496112_0008077 Ga0496112_0008077_7597_8598 333
446 3300048916 Ga0496113_0060816 Ga0496113_0060816_145_1146 333
447 3300048917 Ga0496114_0020108 Ga0496114_0020108_1895_2896 333
448 3300049572 Ga0501036_0040050 Ga0501036_0040050_75_1076 333
449 3300049574 Ga0501038_0056844 Ga0501038_0056844_249_1250 333
450 3300049576 Ga0501040_0123248 Ga0501040_0123248_214_1215 333
451 3300049578 Ga0501042_0102593 Ga0501042_0102593_13_1014 333
452 3300049579 Ga0501043_0273588 Ga0501043_0273588_123_1124 333
453 3300049582 Ga0501048_0164771 Ga0501048_0164771_321_1322 333
454 3300049590 Ga0501074_0134830 Ga0501074_0134830_617_1618 333
455 3300049591 Ga0501075_0023259 Ga0501075_0023259_2443_3444 333
456 3300049741 Ga0501079_0004121 Ga0501079_0004121_419_1420 333
457 3300049742 Ga0501080_0151655 Ga0501080_0151655_690_1691 333
458 3300049742 Ga0501080_0152715 Ga0501080_0152715_437_1438 333
459 3300049742 Ga0501080_0290183 Ga0501080_0290183_258_1259 333
460 3300049822 Ga0501035_0110077 Ga0501035_0110077_1100_2101 333
461 3300050509 nmdc:mga0qj67_114492_c1 nmdc:mga0qj67_114492_c1_657_1658 333
462 3300050511 nmdc:mga08y16_145811_c1 nmdc:mga08y16_145811_c1_738_1739 333
463 3300050511 nmdc:mga08y16_177040_c1 nmdc:mga08y16_177040_c1_777_1778 333
464 3300050515 nmdc:mga0a205_61625_c1 nmdc:mga0a205_61625_c1_1631_2632 333
465 3300054114 Ga0501084_0211276 Ga0501084_0211276_193_1194 333
466 3300061734 Ga0530510_0001840 Ga0530510_0001840_2298_3299 333
467 3300061734 Ga0530510_0149701 Ga0530510_0149701_677_1678 333
468 3300005344 Ga0070661_100002567 Ga0070661_1000025677 334
469 3300005366 Ga0070659_100030020 Ga0070659_1000300202 334
470 3300005457 Ga0070662_100090976 Ga0070662_1000909763 334
471 3300005458 Ga0070681_10175455 Ga0070681_101754551 334
472 3300005548 Ga0070665_100005913 Ga0070665_10000591312 334
473 3300005563 Ga0068855_100521708 Ga0068855_1005217082 334
474 3300005564 Ga0070664_100003658 Ga0070664_1000036583 334
475 3300005577 Ga0068857_100059943 Ga0068857_1000599434 334
476 3300005719 Ga0068861_100049514 Ga0068861_1000495143 334
477 3300005719 Ga0068861_100494959 Ga0068861_1004949591 334
478 3300009098 Ga0105245_10015255 Ga0105245_100152556 334
479 3300009174 Ga0105241_10089072 Ga0105241_100890722 334
480 3300013306 Ga0163162_10150181 Ga0163162_101501812 334
481 3300014969 Ga0157376_10051163 Ga0157376_100511632 334
482 3300025911 Ga0207654_10052489 Ga0207654_100524892 334
483 3300025919 Ga0207657_10035388 Ga0207657_100353883 334
484 3300025932 Ga0207690_10005703 Ga0207690_100057032 334
485 3300025932 Ga0207690_10322267 Ga0207690_103222671 334
486 3300025942 Ga0207689_10050097 Ga0207689_100500972 334
487 3300025945 Ga0207679_10002762 Ga0207679_100027628 334
488 3300026023 Ga0207677_10087689 Ga0207677_100876891 334
489 3300026035 Ga0207703_10243871 Ga0207703_102438712 334
490 3300026118 Ga0207675_100039483 Ga0207675_1000394833 334
491 3300028379 Ga0268266_10018807 Ga0268266_100188072 334
492 3300028380 Ga0268265_10060865 Ga0268265_100608654 334
493 3300037312 Ga0395899_0000344 Ga0395899_0000344_24433_25440 334
494 3300037418 Ga0395900_0064859 Ga0395900_0064859_1689_2696 334
495 3300037418 Ga0395900_0077918 Ga0395900_0077918_878_1885 334
496 3300037418 Ga0395900_0180285 Ga0395900_0180285_504_1511 334
497 3300037471 Ga0395905_0006025 Ga0395905_0006025_3824_4831 334
498 3300037471 Ga0395905_0009860 Ga0395905_0009860_1292_2299 334
499 3300038443 Ga0395901_0000533 Ga0395901_0000533_12136_13143 334
500 3300039447 Ga0436361_0314082 Ga0436361_0314082_229_1236 334
501 3300044658 Ga0466972_0000070 Ga0466972_0000070_75813_76820 334
502 3300044658 Ga0466972_0034493 Ga0466972_0034493_560_1567 334
503 3300044683 Ga0466965_0001667 Ga0466965_0001667_8032_9039 334
504 3300044684 Ga0466966_0068935 Ga0466966_0068935_334_1341 334
505 3300044706 Ga0466964_0070986 Ga0466964_0070986_57_1064 334
506 3300044712 Ga0453684_0131363 Ga0453684_0131363_390_1397 334
507 3300044765 Ga0466970_0007209 Ga0466970_0007209_3710_4717 334
508 3300045049 Ga0466959_0006523 Ga0466959_0006523_506_1513 334
509 3300046457 Ga0495590_0073995 Ga0495590_0073995_12_1019 334
510 3300046507 Ga0495606_0016860 Ga0495606_0016860_253_1260 334
511 3300046522 Ga0495643_0004000 Ga0495643_0004000_427_1434 334
512 3300046528 Ga0495642_0026858 Ga0495642_0026858_1182_2189 334
513 3300046665 Ga0495661_0004218 Ga0495661_0004218_6172_7179 334
514 3300047443 Ga0495687_004211 Ga0495687_004211_1501_2508 334
515 3300048908 Ga0496105_0042336 Ga0496105_0042336_2704_3711 334
516 3300048910 Ga0496107_0179040 Ga0496107_0179040_258_1265 334
517 3300048911 Ga0496108_0041766 Ga0496108_0041766_498_1505 334
518 3300048912 Ga0496109_0113152 Ga0496109_0113152_682_1689 334
519 3300048913 Ga0496110_0335371 Ga0496110_0335371_50_1057 334
520 3300048914 Ga0496111_0290071 Ga0496111_0290071_179_1186 334
521 3300048917 Ga0496114_0131732 Ga0496114_0131732_467_1474 334
522 3300048917 Ga0496114_0254535 Ga0496114_0254535_527_1534 334
523 3300048924 Ga0496121_0117941 Ga0496121_0117941_459_1466 334
524 3300049742 Ga0501080_0070202 Ga0501080_0070202_1164_2171 334
525 3300049823 Ga0501044_0217377 Ga0501044_0217377_501_1508 334
526 3300002771 JGI25163J39215_1002284 JGI25163J39215_10022842 335
527 3300002773 JGI25152J39213_1000839 JGI25152J39213_100083915 335
528 3300002774 JGI25150J39212_1000639 JGI25150J39212_10006391 335
529 3300002774 JGI25150J39212_1001574 JGI25150J39212_10015747 335
530 3300002774 JGI25150J39212_1002946 JGI25150J39212_10029461 335
531 3300002987 JGI25159J45721_1000701 JGI25159J45721_10007016 335
532 3300002987 JGI25159J45721_1005270 JGI25159J45721_10052705 335
533 3300002987 JGI25159J45721_1005657 JGI25159J45721_10056572 335
534 3300003214 JGI25165J46597_1000064 JGI25165J46597_1000064172 335
535 3300003215 JGI25153J46596_10002118 JGI25153J46596_1000211812 335
536 3300003354 JGI25160J50197_1003074 JGI25160J50197_10030743 335
537 3300003374 JGI25161J50226_1000500 JGI25161J50226_10005002 335
538 3300003374 JGI25161J50226_1001505 JGI25161J50226_10015057 335
539 3300003751 Ga0055538_1000031 Ga0055538_100003115 335
540 3300003752 Ga0055539_1000041 Ga0055539_100004115 335
541 3300003756 Ga0055533_1000051 Ga0055533_1000051172 335
542 3300003759 Ga0055525_1000061 Ga0055525_100006115 335
543 3300003771 Ga0055526_1001572 Ga0055526_10015721 335
544 3300003771 Ga0055526_1004107 Ga0055526_10041079 335
545 3300003771 Ga0055526_1017481 Ga0055526_10174814 335
546 3300003773 Ga0055537_1000041 Ga0055537_100004185 335
547 3300003773 Ga0055537_1001581 Ga0055537_10015815 335
548 3300003775 Ga0055524_1000007 Ga0055524_100000713 335
549 3300003775 Ga0055524_1000153 Ga0055524_100015322 335
550 3300003775 Ga0055524_1001204 Ga0055524_10012044 335
551 3300003775 Ga0055524_1001786 Ga0055524_100178612 335
552 3300003775 Ga0055524_1005089 Ga0055524_10050897 335
553 3300003775 Ga0055524_1005404 Ga0055524_10054042 335
554 3300003784 Ga0055534_1000505 Ga0055534_10005057 335
555 3300003784 Ga0055534_1000540 Ga0055534_10005402 335
556 3300003790 Ga0055528_1000984 Ga0055528_10009846 335
557 3300003790 Ga0055528_1005770 Ga0055528_10057703 335
558 3300003794 Ga0055531_10002277 Ga0055531_1000227716 335
559 3300003841 Ga0055541_1000028 Ga0055541_100002815 335
560 3300004625 Ga0055543_1001582 Ga0055543_10015827 335
561 3300004625 Ga0055543_1002113 Ga0055543_10021136 335
562 3300005262 Ga0065165_1000404 Ga0065165_100040448 335
563 3300006948 Ga0099826_10000052 Ga0099826_1000005242 335
564 3300013102 Ga0157371_10000001 Ga0157371_10000001277 335
565 3300015261 Ga0182006_1003516 Ga0182006_10035163 335
566 3300015262 Ga0182007_10002481 Ga0182007_100024814 335
567 3300015262 Ga0182007_10019825 Ga0182007_100198252 335
568 3300015265 Ga0182005_1002989 Ga0182005_10029892 335
569 3300025208 Ga0209436_100445 Ga0209436_1004453 335
570 3300025208 Ga0209436_101852 Ga0209436_1018524 335
571 3300025208 Ga0209436_113897 Ga0209436_1138972 335
572 3300025224 Ga0209784_100039 Ga0209784_10003954 335
573 3300025225 Ga0209566_100023 Ga0209566_10002354 335
574 3300025226 Ga0209674_100040 Ga0209674_10004054 335
575 3300025230 Ga0209563_100072 Ga0209563_10007254 335
576 3300025231 Ga0207427_101009 Ga0207427_10100913 335
577 3300025233 Ga0209437_100097 Ga0209437_10009754 335
578 3300025245 Ga0207425_1000001 Ga0207425_10000011840 335
579 3300025245 Ga0207425_1003063 Ga0207425_10030635 335
580 3300025253 Ga0209677_100041 Ga0209677_10004154 335
581 3300025258 Ga0209129_1000001 Ga0209129_10000011017 335
582 3300025258 Ga0209129_1019142 Ga0209129_10191422 335
583 3300025261 Ga0209233_1000122 Ga0209233_100012254 335
584 3300025263 Ga0209565_1000009 Ga0209565_1000009267 335
585 3300025263 Ga0209565_1001365 Ga0209565_100136510 335
586 3300025263 Ga0209565_1001610 Ga0209565_10016107 335
587 3300025263 Ga0209565_1002049 Ga0209565_10020497 335
588 3300025263 Ga0209565_1004635 Ga0209565_10046355 335
589 3300025263 Ga0209565_1010335 Ga0209565_10103352 335
590 3300025273 Ga0209673_1000019 Ga0209673_1000019115 335
591 3300025273 Ga0209673_1005407 Ga0209673_10054073 335
592 3300025284 Ga0209130_1000179 Ga0209130_100017946 335
593 3300025284 Ga0209130_1001179 Ga0209130_10011793 335
594 3300025284 Ga0209130_1002928 Ga0209130_10029285 335
595 3300025291 Ga0209675_1000028 Ga0209675_1000028241 335
596 3300025291 Ga0209675_1002184 Ga0209675_10021847 335
597 3300025291 Ga0209675_1007135 Ga0209675_10071352 335
598 3300025295 Ga0209564_1000058 Ga0209564_100005853 335
599 3300025295 Ga0209564_1000376 Ga0209564_100037681 335
600 3300025295 Ga0209564_1004759 Ga0209564_10047593 335
601 3300025295 Ga0209564_1010338 Ga0209564_10103385 335
602 3300025297 Ga0209758_1000166 Ga0209758_100016670 335
603 3300025298 Ga0209050_1000446 Ga0209050_10004467 335
604 3300025298 Ga0209050_1002114 Ga0209050_10021142 335
605 3300025299 Ga0209256_1000005 Ga0209256_1000005479 335
606 3300025299 Ga0209256_1000052 Ga0209256_1000052101 335
607 3300025299 Ga0209256_1001352 Ga0209256_10013523 335
608 3300025299 Ga0209256_1002086 Ga0209256_100208615 335
609 3300025299 Ga0209256_1003952 Ga0209256_10039525 335
610 3300025299 Ga0209256_1005512 Ga0209256_10055125 335
611 3300025302 Ga0207426_1003167 Ga0207426_10031675 335
612 3300025304 Ga0209257_1000107 Ga0209257_100010779 335
613 3300025304 Ga0209257_1006960 Ga0209257_10069601 335
614 3300027666 Ga0209282_1000001 Ga0209282_10000012263 335
615 3300030736 Ga0316180_1109577 Ga0316180_11095772 335
616 3300031548 Ga0307408_100000103 Ga0307408_1000001033 335
617 3300031548 Ga0307408_100009488 Ga0307408_1000094882 335
618 3300031548 Ga0307408_100019827 Ga0307408_1000198272 335
619 3300031548 Ga0307408_100021031 Ga0307408_1000210313 335
620 3300044683 Ga0466965_0011675 Ga0466965_0011675_2842_3852 335
621 3300044765 Ga0466970_0029818 Ga0466970_0029818_1765_2775 335
622 3300046457 Ga0495590_0004337 Ga0495590_0004337_1085_2095 335
623 3300046460 Ga0495638_0043295 Ga0495638_0043295_45_1055 335
624 3300046460 Ga0495638_0099950 Ga0495638_0099950_301_1311 335
625 3300046462 Ga0495651_0095122 Ga0495651_0095122_493_1503 335
626 3300046462 Ga0495651_0169961 Ga0495651_0169961_499_1509 335
627 3300046463 Ga0495653_0048971 Ga0495653_0048971_1481_2491 335
628 3300046471 Ga0495650_0000928 Ga0495650_0000928_14328_15338 335
629 3300046471 Ga0495650_0003015 Ga0495650_0003015_2477_3490 335
630 3300046474 Ga0495605_0015313 Ga0495605_0015313_2568_3578 335
631 3300046491 Ga0495584_0001921 Ga0495584_0001921_3389_4399 335
632 3300046500 Ga0495596_0002046 Ga0495596_0002046_9387_10397 335
633 3300046501 Ga0495607_0046699 Ga0495607_0046699_950_1960 335
634 3300046501 Ga0495607_0049245 Ga0495607_0049245_570_1580 335
635 3300046506 Ga0495583_0009024 Ga0495583_0009024_164_1174 335
636 3300046507 Ga0495606_0000068 Ga0495606_0000068_114424_115434 335
637 3300046511 Ga0495608_0005915 Ga0495608_0005915_7569_8579 335
638 3300046513 Ga0495616_0000120 Ga0495616_0000120_64610_65620 335
639 3300046513 Ga0495616_0002633 Ga0495616_0002633_1833_2843 335
640 3300046513 Ga0495616_0027697 Ga0495616_0027697_1088_2098 335
641 3300046513 Ga0495616_0028538 Ga0495616_0028538_1184_2194 335
642 3300046516 Ga0495628_0001623 Ga0495628_0001623_1201_2211 335
643 3300046516 Ga0495628_0002192 Ga0495628_0002192_11462_12472 335
644 3300046518 Ga0495631_0000103 Ga0495631_0000103_54452_55462 335
645 3300046519 Ga0495632_0003558 Ga0495632_0003558_7944_8954 335
646 3300046520 Ga0495637_0000364 Ga0495637_0000364_13300_14313 335
647 3300046522 Ga0495643_0000449 Ga0495643_0000449_11702_12712 335
648 3300046522 Ga0495643_0001738 Ga0495643_0001738_2966_3976 335
649 3300046524 Ga0495648_0019050 Ga0495648_0019050_3722_4732 335
650 3300046524 Ga0495648_0046801 Ga0495648_0046801_211_1221 335
651 3300046528 Ga0495642_0059312 Ga0495642_0059312_392_1402 335
652 3300046529 Ga0495652_0021749 Ga0495652_0021749_4191_5201 335
653 3300046529 Ga0495652_0100027 Ga0495652_0100027_768_1778 335
654 3300046530 Ga0495654_0000074 Ga0495654_0000074_99376_100389 335
655 3300046530 Ga0495654_0033672 Ga0495654_0033672_436_1446 335
656 3300046538 Ga0495609_0002919 Ga0495609_0002919_6360_7370 335
657 3300046542 Ga0495597_0001279 Ga0495597_0001279_15998_17008 335
658 3300046543 Ga0495645_0128434 Ga0495645_0128434_26_1036 335
659 3300046543 Ga0495645_0153163 Ga0495645_0153163_498_1508 335
660 3300046616 Ga0495668_0000063 Ga0495668_0000063_87707_88717 335
661 3300046616 Ga0495668_0000980 Ga0495668_0000980_220_1230 335
662 3300046660 Ga0495625_0022293 Ga0495625_0022293_3457_4467 335
663 3300046660 Ga0495625_0042547 Ga0495625_0042547_1153_2163 335
664 3300046664 Ga0495659_0000722 Ga0495659_0000722_5945_6955 335
665 3300046680 Ga0495646_0002836 Ga0495646_0002836_6028_7038 335
666 3300046684 Ga0495669_0004496 Ga0495669_0004496_4633_5643 335
667 3300046690 Ga0495624_0020569 Ga0495624_0020569_1896_2906 335
668 3300046694 Ga0495649_0002697 Ga0495649_0002697_8374_9384 335
669 3300046794 Ga0495589_0005491 Ga0495589_0005491_4654_5664 335
670 3300046809 Ga0495600_0001936 Ga0495600_0001936_2562_3572 335
671 3300046810 Ga0495660_0069945 Ga0495660_0069945_64_1074 335
672 3300047318 Ga0495636_0005147 Ga0495636_0005147_1885_2895 335
673 3300047320 Ga0495672_0000956 Ga0495672_0000956_21694_22704 335
674 3300047323 Ga0495683_0040575 Ga0495683_0040575_255_1265 335
675 3300047443 Ga0495687_002155 Ga0495687_002155_7368_8378 335
676 3300047445 Ga0495677_0002777 Ga0495677_0002777_3908_4918 335
677 3300047446 Ga0495679_011995 Ga0495679_011995_2099_3109 335
678 3300047447 Ga0495685_006228 Ga0495685_006228_864_1874 335
679 3300047447 Ga0495685_019891 Ga0495685_019891_530_1540 335
680 3300047470 Ga0495681_0022851 Ga0495681_0022851_1194_2204 335
681 3300047472 Ga0495686_0001174 Ga0495686_0001174_12110_13120 335
682 3300047472 Ga0495686_0002601 Ga0495686_0002601_3204_4214 335
683 3300047472 Ga0495686_0038907 Ga0495686_0038907_782_1792 335
684 3300048091 Ga0495626_0071450 Ga0495626_0071450_404_1414 335
685 3300048927 Ga0496124_0026196 Ga0496124_0026196_1042_2052 335
686 3300048927 Ga0496124_0029862 Ga0496124_0029862_199_1209 335
687 3300049459 Ga0495678_001239 Ga0495678_001239_1395_2405 335
688 3300049459 Ga0495678_048808 Ga0495678_048808_370_1380 335
689 3300049665 Ga0501227_028380 Ga0501227_028380_146_1156 335
690 3300049775 Ga0501279_000908 Ga0501279_000908_507_1517 335
691 3300053077 Ga0495601_0015834 Ga0495601_0015834_768_1778 335
692 3300053119 Ga0500595_005770 Ga0500595_005770_4042_5052 335
693 3300053154 Ga0500619_001217 Ga0500619_001217_3188_4198 335
694 iso_pu_bacteria 2643221603 2644028245 335
695 3300042876 Ga0451577_0005356 Ga0451577_0005356_11475_12485 336
696 3300042876 Ga0451577_0077190 Ga0451577_0077190_851_1861 336
697 2162886007 SwRhRL2b_contig_602634 SwRhRL2b_0771.00000120 337
698 3300005289 Ga0065704_10075032 Ga0065704_100750323 337
699 3300031239 Ga0265328_10009570 Ga0265328_100095704 337
700 3300031344 Ga0265316_10067899 Ga0265316_100678992 337
701 3300042876 Ga0451577_0020957 Ga0451577_0020957_1127_2140 337
702 3300044712 Ga0453684_0121483 Ga0453684_0121483_1090_2103 337
703 3300045051 Ga0451576_0033607 Ga0451576_0033607_3473_4486 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01384

PHO4

Phosphate transporter family

34

333

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l85-assembly1.cif.gz_A the sodium-dependent phosphate transporter 0.9004 9 337
6l85-assembly1.cif.gz_A the sodium-dependent phosphate transporter 0.8773 9 337
6vq7-assembly1.cif.gz_g error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.2921 52 251
6vq7-assembly1.cif.gz_g error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.2848 52 251
7d06-assembly1.cif.gz_D cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.2844 54 328
ID Description Score Start End Superfamily
af_P38361_8_554_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8692 15 325 3.40.50.2020
af_P38361_8_554_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8033 15 325 3.40.50.2020
af_A0A1D6H4R6_249_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3435 85 322 1.20.1250.20
af_A0A1D6H4R6_249_412_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3363 85 322 1.20.1250.20
af_I1N7G8_11_135_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.3346 133 238 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A7W0UP37-F1-model_v4 Inorganic phosphate transporter 0.9847 146 324 GO:0005315
GO:0016020
GO:0035435
AF-A0A7V2LXL0-F1-model_v4 Inorganic phosphate transporter 0.984 12 336 GO:0005315
GO:0016020
GO:0035435
AF-A0A538GE76-F1-model_v4 Inorganic phosphate transporter 0.9838 9 337 GO:0005315
GO:0016020
GO:0035435
AF-A0A346N0I1-F1-model_v4 Inorganic phosphate transporter 0.9832 7 336 GO:0005315
GO:0016020
GO:0035435
AF-A0A3N8PF03-F1-model_v4 Anion permease 0.9829 115 306 GO:0005315
GO:0016020
GO:0035435

Feature Viewer

pLDDT pTM Quality
88.97 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map