F476274

General Info

Members Datasets Scaffolds Average Seq Length
703 307 696 333

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_10010275|Ga0157375_100102753
Length 398
Sequence LRLQRRDDEQQRDRDGHGLGEQEPGFAHRFGEGSERLSDARRDDNDAMASTAPLPLAITMGDAAGIGPEIIARLFQRGEAAGAFVVGDVAVMRGAAGIVGGLLPVARLEDPGQLADVPPDCLPVLQVEGLPADLMSAPVGRVDARCGRAAAVSIERAVRLVQQGQASAIVTAPIHKEALAAAGVPYPGHTEMLQALASDGGKAPPVRMMLANDELRTVLVTIHLSLRKAIDAVTFDAVLETIRIAHAAAVRQGLVRPRIAVAGLNPHAGEGGLFGEEEATVIAPAIAAAQAEGIDASGPHPPDTVFMRARNAPDHAGEFDLVVAMTHDHGLIPVKYLGVEHGVNVTLGLPFVRTSPDHGTALDIAGRGIADPASLGAAVRMARALAAGGGAVSASSAP

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
3 2643221585 Pelomonas sp. Root662 Isolate Unclassified
4 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
5 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
6 2643221656 Pelomonas sp. Root405 Isolate Unclassified
7 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
173 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
189 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
190 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
200 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
203 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
204 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
211 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
212 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
221 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
222 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
223 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
224 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
232 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
256 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
257 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
260 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
277 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
278 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
279 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
280 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
281 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
292 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
296 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
299 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
300 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
301 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
302 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
303 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
304 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
305 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.25
Nodule 0.28
Rhizoplane 4.27
Rhizosphere 80.09
Stem 0
Stem Tuber 0
Unclassified 6.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10002128 3300003215 Bacteria 11587
2 rootH1_10006656 3300003316 Bacteria 7826
3 rootL2_10000250 3300003322 Bacteria 7648
4 rootL2_10034863 3300003322 Bacteria 7265
5 Ga0055524_1000013 3300003775 Bacteria 259850
6 Ga0065707_10110598 3300005295 Bacteria 2424
7 Ga0070658_10152954 3300005327 Bacteria 1932
8 Ga0070676_10011649 3300005328 Bacteria 4784
9 Ga0070676_10044423 3300005328 Bacteria 2586
10 Ga0070676_10058888 3300005328 Bacteria 2277
11 Ga0070676_10063389 3300005328 Bacteria 2202
12 Ga0070676_10089154 3300005328 Bacteria 1886
13 Ga0070683_100093359 3300005329 Bacteria 2827
14 Ga0070690_100010106 3300005330 Bacteria 5481
15 Ga0070690_100041032 3300005330 Bacteria 2928
16 Ga0070670_100001787 3300005331 Bacteria 17505
17 Ga0070670_100024831 3300005331 Bacteria 5155
18 Ga0070670_100108547 3300005331 Bacteria 2391
19 Ga0070670_100122898 3300005331 Bacteria 2239
20 Ga0070670_100265957 3300005331 Bacteria 1496
21 Ga0070670_100298270 3300005331 Bacteria 1409
22 Ga0070677_10002828 3300005333 Bacteria 5562
23 Ga0070677_10031652 3300005333 Bacteria 2023
24 Ga0070677_10031921 3300005333 Bacteria 2017
25 Ga0068869_100030141 3300005334 Bacteria 3806
26 Ga0068869_100037947 3300005334 Bacteria 3429
27 Ga0068869_100124510 3300005334 Bacteria 1975
28 Ga0068869_100302818 3300005334 Bacteria 1291
29 Ga0070666_10000496 3300005335 Bacteria 23684
30 Ga0070666_10116227 3300005335 Bacteria 1853
31 Ga0070680_100024697 3300005336 Bacteria 4804
32 Ga0068868_100000966 3300005338 Bacteria 19576
33 Ga0068868_100003181 3300005338 Bacteria 11428
34 Ga0068868_100023991 3300005338 Bacteria 4623
35 Ga0070660_100000909 3300005339 Bacteria 19789
36 Ga0070687_100053057 3300005343 Bacteria 2107
37 Ga0070661_100000636 3300005344 Bacteria 26031
38 Ga0070661_100007516 3300005344 Bacteria 7517
39 Ga0070661_100140699 3300005344 Bacteria 1818
40 Ga0070668_100133068 3300005347 Bacteria 1997
41 Ga0070669_100002645 3300005353 Bacteria 12924
42 Ga0070669_100045050 3300005353 Bacteria 3214
43 Ga0070669_100107174 3300005353 Bacteria 2116
44 Ga0070669_100126813 3300005353 Bacteria 1954
45 Ga0070669_100254068 3300005353 Bacteria 1400
46 Ga0070675_100005641 3300005354 Bacteria 9582
47 Ga0070675_100062018 3300005354 Bacteria 3088
48 Ga0070675_100087022 3300005354 Bacteria 2612
49 Ga0070675_100148377 3300005354 Bacteria 2009
50 Ga0070675_100424737 3300005354 Bacteria 1189
51 Ga0070671_100002643 3300005355 Bacteria 13868
52 Ga0070671_100003392 3300005355 Bacteria 12430
53 Ga0070671_100009715 3300005355 Bacteria 7728
54 Ga0070671_100009932 3300005355 Bacteria 7644
55 Ga0070671_100029988 3300005355 Bacteria 4488
56 Ga0070671_100295238 3300005355 Bacteria 1379
57 Ga0070674_100004218 3300005356 Bacteria 8168
58 Ga0070674_100025270 3300005356 Bacteria 3865
59 Ga0070674_100036594 3300005356 Bacteria 3296
60 Ga0070673_100013730 3300005364 Bacteria 5616
61 Ga0070673_100030938 3300005364 Bacteria 4012
62 Ga0070673_100040882 3300005364 Bacteria 3560
63 Ga0070673_100119932 3300005364 Bacteria 2192
64 Ga0070659_100028796 3300005366 Bacteria 4291
65 Ga0070659_100039647 3300005366 Bacteria 3678
66 Ga0070659_100168563 3300005366 Bacteria 1793
67 Ga0070667_100006624 3300005367 Bacteria 9629
68 Ga0070667_100008184 3300005367 Bacteria 8666
69 Ga0070667_100136299 3300005367 Bacteria 2147
70 Ga0070667_100165418 3300005367 Bacteria 1951
71 Ga0070667_100187177 3300005367 Bacteria 1832
72 Ga0070667_100292652 3300005367 Bacteria 1465
73 Ga0070709_10025522 3300005434 Bacteria 3492
74 Ga0070713_100152036 3300005436 Bacteria 2060
75 Ga0070710_10020518 3300005437 Bacteria 3429
76 Ga0070711_100002891 3300005439 Bacteria 9895
77 Ga0070705_100030059 3300005440 Bacteria 2996
78 Ga0070708_100106722 3300005445 Bacteria 2571
79 Ga0070663_100040907 3300005455 Bacteria 3248
80 Ga0070663_100062911 3300005455 Bacteria 2677
81 Ga0070678_100000952 3300005456 Bacteria 14892
82 Ga0070678_100005704 3300005456 Bacteria 7232
83 Ga0070678_100013205 3300005456 Bacteria 5169
84 Ga0070678_100027929 3300005456 Bacteria 3839
85 Ga0070662_100044407 3300005457 Bacteria 3183
86 Ga0070662_100173804 3300005457 Bacteria 1694
87 Ga0070662_100179155 3300005457 Bacteria 1670
88 Ga0070681_10009885 3300005458 Bacteria 9400
89 Ga0070681_10216574 3300005458 Bacteria 1831
90 Ga0068867_100001379 3300005459 Bacteria 16789
91 Ga0068867_100025230 3300005459 Bacteria 4264
92 Ga0068867_100026510 3300005459 Bacteria 4162
93 Ga0068867_100033912 3300005459 Bacteria 3700
94 Ga0068867_100080690 3300005459 Bacteria 2451
95 Ga0070706_100000463 3300005467 Bacteria 48079
96 Ga0070707_100030724 3300005468 Bacteria 5116
97 Ga0070699_100292090 3300005518 Bacteria 1462
98 Ga0070679_100037901 3300005530 Bacteria 4790
99 Ga0068853_100021221 3300005539 Bacteria 5410
100 Ga0068853_100044587 3300005539 Bacteria 3797
101 Ga0068853_100071486 3300005539 Bacteria 3022
102 Ga0068853_100080473 3300005539 Bacteria 2850
103 Ga0070672_100000327 3300005543 Bacteria 27160
104 Ga0070672_100008932 3300005543 Bacteria 6886
105 Ga0070672_100013536 3300005543 Bacteria 5766
106 Ga0070672_100030950 3300005543 Bacteria 4025
107 Ga0070672_100061511 3300005543 Bacteria 2960
108 Ga0070695_100001403 3300005545 Bacteria 13343
109 Ga0070665_100016149 3300005548 Bacteria 7493
110 Ga0070665_100090124 3300005548 Bacteria 3072
111 Ga0070665_100118105 3300005548 Bacteria 2654
112 Ga0070665_100175373 3300005548 Bacteria 2144
113 Ga0068855_100002063 3300005563 Bacteria 24904
114 Ga0068855_100008847 3300005563 Bacteria 12171
115 Ga0068855_100011163 3300005563 Bacteria 10845
116 Ga0068855_100037807 3300005563 Bacteria 5737
117 Ga0068855_100247241 3300005563 Bacteria 1990
118 Ga0070664_100059347 3300005564 Bacteria 3254
119 Ga0070664_100144594 3300005564 Bacteria 2096
120 Ga0070664_100288019 3300005564 Bacteria 1482
121 Ga0068857_100095305 3300005577 Bacteria 2666
122 Ga0068854_100009863 3300005578 Bacteria 6176
123 Ga0068854_100056055 3300005578 Bacteria 2839
124 Ga0068854_100062788 3300005578 Bacteria 2695
125 Ga0068856_100007776 3300005614 Bacteria 10473
126 Ga0068856_100023461 3300005614 Bacteria 5998
127 Ga0070702_100058361 3300005615 Bacteria 2235
128 Ga0068852_100012439 3300005616 Bacteria 6463
129 Ga0068852_100044322 3300005616 Bacteria 3776
130 Ga0068852_100054883 3300005616 Bacteria 3436
131 Ga0068852_100106018 3300005616 Bacteria 2547
132 Ga0068852_100182111 3300005616 Bacteria 1976
133 Ga0068859_100061938 3300005617 Bacteria 3770
134 Ga0068859_100084220 3300005617 Bacteria 3224
135 Ga0068859_100117044 3300005617 Bacteria 2730
136 Ga0068864_100002065 3300005618 Bacteria 16597
137 Ga0068864_100013594 3300005618 Bacteria 6748
138 Ga0068864_100030622 3300005618 Bacteria 4562
139 Ga0068864_100094268 3300005618 Bacteria 2645
140 Ga0068864_100228734 3300005618 Bacteria 1719
141 Ga0068866_10007547 3300005718 Bacteria 4557
142 Ga0068866_10020078 3300005718 Bacteria 3055
143 Ga0068861_100002250 3300005719 Bacteria 12540
144 Ga0068861_100157022 3300005719 Bacteria 1872
145 Ga0068851_10020954 3300005834 Bacteria 3170
146 Ga0068851_10033595 3300005834 Bacteria 2557
147 Ga0068863_100006983 3300005841 Bacteria 11070
148 Ga0068863_100040147 3300005841 Bacteria 4450
149 Ga0068863_100134799 3300005841 Bacteria 2359
150 Ga0068863_100328099 3300005841 Bacteria 1487
151 Ga0068858_100002641 3300005842 Bacteria 18052
152 Ga0068858_100008614 3300005842 Bacteria 9799
153 Ga0068858_100016336 3300005842 Bacteria 6973
154 Ga0068858_100027116 3300005842 Bacteria 5322
155 Ga0068858_100180458 3300005842 Bacteria 1993
156 Ga0068860_100000823 3300005843 Bacteria 34706
157 Ga0068860_100040723 3300005843 Bacteria 4439
158 Ga0068860_100044975 3300005843 Bacteria 4208
159 Ga0068860_100057773 3300005843 Bacteria 3688
160 Ga0068860_100087594 3300005843 Bacteria 2964
161 Ga0068860_100089174 3300005843 Bacteria 2936
162 Ga0068862_100014372 3300005844 Bacteria 6567
163 Ga0068862_100016973 3300005844 Bacteria 6059
164 Ga0068862_100050504 3300005844 Bacteria 3555
165 Ga0068862_100175150 3300005844 Bacteria 1923
166 Ga0068862_100226709 3300005844 Bacteria 1694
167 Ga0075365_10025870 3300006038 Bacteria 3719
168 Ga0075368_10036251 3300006042 Bacteria 1927
169 Ga0075364_10011121 3300006051 Bacteria 5463
170 Ga0070715_10000669 3300006163 Bacteria 9159
171 Ga0070716_100001421 3300006173 Bacteria 10639
172 Ga0070712_100000683 3300006175 Bacteria 20066
173 Ga0075362_10016795 3300006177 Bacteria 3004
174 Ga0075362_10091899 3300006177 Bacteria 1409
175 Ga0075367_10034681 3300006178 Bacteria 2916
176 Ga0075366_10001536 3300006195 Bacteria 11547
177 Ga0075366_10001610 3300006195 Bacteria 11306
178 Ga0075366_10002629 3300006195 Bacteria 9242
179 Ga0075366_10008876 3300006195 Bacteria 5599
180 Ga0075366_10012726 3300006195 Bacteria 4780
181 Ga0075366_10044465 3300006195 Bacteria 2632
182 Ga0097621_100004475 3300006237 Bacteria 9740
183 Ga0097621_100009247 3300006237 Bacteria 7149
184 Ga0097621_100025499 3300006237 Bacteria 4626
185 Ga0097621_100044671 3300006237 Bacteria 3575
186 Ga0097621_100050121 3300006237 Bacteria 3394
187 Ga0097621_100052288 3300006237 Bacteria 3328
188 Ga0075370_10001367 3300006353 Bacteria 10507
189 Ga0075370_10009019 3300006353 Bacteria 5159
190 Ga0075370_10009182 3300006353 Bacteria 5121
191 Ga0075370_10038105 3300006353 Bacteria 2705
192 Ga0075370_10042740 3300006353 Bacteria 2560
193 Ga0068871_100004794 3300006358 Bacteria 9457
194 Ga0068871_100056504 3300006358 Bacteria 3191
195 Ga0068871_100072915 3300006358 Bacteria 2829
196 Ga0068871_100078626 3300006358 Bacteria 2728
197 Ga0068871_100126845 3300006358 Bacteria 2160
198 Ga0068871_100126957 3300006358 Bacteria 2160
199 Ga0068871_100190535 3300006358 Bacteria 1766
200 Ga0075434_100094316 3300006871 Bacteria 2997
201 Ga0068865_100007445 3300006881 Bacteria 6735
202 Ga0068865_100012354 3300006881 Bacteria 5373
203 Ga0068865_100033691 3300006881 Bacteria 3430
204 Ga0068865_100050149 3300006881 Bacteria 2882
205 Ga0068865_100054640 3300006881 Bacteria 2776
206 Ga0068865_100331961 3300006881 Bacteria 1226
207 Ga0097620_100061943 3300006931 Bacteria 3770
208 Ga0097620_100084217 3300006931 Bacteria 3224
209 Ga0097620_100117044 3300006931 Bacteria 2730
210 Ga0079104_1000070 3300006946 Bacteria 153879
211 Ga0105240_10030834 3300009093 Bacteria 6965
212 Ga0105240_10035695 3300009093 Bacteria 6405
213 Ga0105240_10194801 3300009093 Bacteria 2380
214 Ga0105245_10005446 3300009098 Bacteria 11181
215 Ga0105245_10084750 3300009098 Bacteria 2904
216 Ga0105245_10394429 3300009098 Bacteria 1382
217 Ga0105247_10008379 3300009101 Bacteria 6302
218 Ga0114129_10062014 3300009147 Bacteria 5224
219 Ga0105243_10025417 3300009148 Bacteria 4526
220 Ga0105243_10113366 3300009148 Bacteria 2273
221 Ga0105243_10283022 3300009148 Bacteria 1494
222 Ga0105242_10000422 3300009176 Bacteria 33749
223 Ga0105242_10014535 3300009176 Bacteria 6099
224 Ga0105242_10209939 3300009176 Bacteria 1735
225 Ga0105248_10005804 3300009177 Bacteria 13570
226 Ga0105248_10008369 3300009177 Bacteria 11361
227 Ga0105248_10182510 3300009177 Bacteria 2364
228 Ga0105248_10191942 3300009177 Bacteria 2302
229 Ga0105248_10293031 3300009177 Bacteria 1832
230 Ga0105237_10007447 3300009545 Bacteria 11978
231 Ga0105237_10033124 3300009545 Bacteria 5234
232 Ga0105237_10058014 3300009545 Bacteria 3874
233 Ga0105237_10303567 3300009545 Bacteria 1599
234 Ga0105238_10005477 3300009551 Bacteria 12552
235 Ga0105238_10008443 3300009551 Bacteria 10312
236 Ga0105238_10022383 3300009551 Bacteria 6441
237 Ga0105238_10070959 3300009551 Bacteria 3481
238 Ga0105249_10032646 3300009553 Bacteria 4710
239 Ga0105239_10008715 3300010375 Bacteria 11480
240 Ga0105239_10010780 3300010375 Bacteria 10211
241 Ga0105239_10034479 3300010375 Bacteria 5558
242 Ga0105246_10259916 3300011119 Bacteria 1383
243 Ga0157373_10087172 3300013100 Bacteria 2200
244 Ga0157370_10093444 3300013104 Bacteria 2822
245 Ga0157370_10144917 3300013104 Bacteria 2212
246 Ga0157370_10174765 3300013104 Bacteria 1996
247 Ga0157370_10189636 3300013104 Bacteria 1908
248 Ga0157369_10014701 3300013105 Bacteria 8830
249 Ga0157374_10001660 3300013296 Bacteria 18628
250 Ga0157374_10003108 3300013296 Bacteria 13934
251 Ga0157374_10063603 3300013296 Bacteria 3461
252 Ga0157378_10001703 3300013297 Bacteria 19776
253 Ga0157378_10002030 3300013297 Bacteria 18126
254 Ga0163162_10002252 3300013306 Bacteria 18114
255 Ga0163162_10009296 3300013306 Bacteria 9558
256 Ga0163162_10132660 3300013306 Bacteria 2600
257 Ga0163162_10255314 3300013306 Bacteria 1885
258 Ga0157372_10011061 3300013307 Bacteria 9602
259 Ga0157372_10031276 3300013307 Bacteria 5827
260 Ga0157372_10038836 3300013307 Bacteria 5253
261 Ga0157372_10096556 3300013307 Bacteria 3368
262 Ga0157372_10122021 3300013307 Bacteria 2994
263 Ga0157372_10217093 3300013307 Bacteria 2217
264 Ga0157375_10008892 3300013308 Bacteria 8789
265 Ga0157375_10010275 3300013308 Bacteria 8238
266 Ga0157375_10015508 3300013308 Bacteria 6823
267 Ga0157375_10037041 3300013308 Bacteria 4670
268 Ga0157375_10048027 3300013308 Bacteria 4173
269 Ga0157375_10068709 3300013308 Bacteria 3546
270 Ga0157375_10130491 3300013308 Bacteria 2632
271 Ga0163163_10009458 3300014325 Bacteria 8703
272 Ga0163163_10162706 3300014325 Bacteria 2277
273 Ga0157380_10125730 3300014326 Bacteria 2179
274 Ga0157380_10158858 3300014326 Bacteria 1962
275 Ga0157380_10230760 3300014326 Bacteria 1662
276 Ga0157377_10001539 3300014745 Bacteria 10025
277 Ga0157379_10018511 3300014968 Bacteria 6144
278 Ga0157379_10045148 3300014968 Bacteria 3934
279 Ga0157379_10050000 3300014968 Bacteria 3731
280 Ga0157379_10078692 3300014968 Bacteria 2953
281 Ga0157379_10145427 3300014968 Bacteria 2138
282 Ga0157379_10235467 3300014968 Bacteria 1660
283 Ga0163161_10013100 3300017792 Bacteria 5764
284 Ga0163161_10020889 3300017792 Bacteria 4599
285 Ga0163161_10023850 3300017792 Bacteria 4318
286 Ga0163161_10052922 3300017792 Bacteria 2943
287 Ga0163161_10136534 3300017792 Bacteria 1854
288 Ga0213872_10000113 3300021361 Bacteria 74827
289 Ga0213872_10018226 3300021361 Bacteria 3238
290 Ga0213872_10039667 3300021361 Bacteria 2149
291 Ga0213872_10050960 3300021361 Bacteria 1879
292 Ga0213876_10008872 3300021384 Bacteria 5424
293 Ga0213876_10014753 3300021384 Bacteria 4140
294 Ga0209258_101087 3300025242 Bacteria 11629
295 Ga0209759_1001263 3300025256 Bacteria 15243
296 Ga0209758_1000281 3300025297 Bacteria 100826
297 Ga0209050_1009044 3300025298 Bacteria 5182
298 Ga0209256_1000061 3300025299 Bacteria 260890
299 Ga0209051_1013888 3300025303 Bacteria 3797
300 Ga0207697_10087719 3300025315 Bacteria 1317
301 Ga0207656_10011679 3300025321 Bacteria 3322
302 Ga0207682_10005442 3300025893 Bacteria 5181
303 Ga0207682_10041078 3300025893 Bacteria 1887
304 Ga0207682_10095697 3300025893 Bacteria 1293
305 Ga0207692_10003475 3300025898 Bacteria 6158
306 Ga0207642_10035995 3300025899 Bacteria 2120
307 Ga0207688_10027409 3300025901 Bacteria 3134
308 Ga0207680_10039968 3300025903 Bacteria 2725
309 Ga0207680_10068247 3300025903 Bacteria 2193
310 Ga0207680_10167364 3300025903 Bacteria 1478
311 Ga0207685_10003015 3300025905 Bacteria 3999
312 Ga0207699_10013467 3300025906 Bacteria 4188
313 Ga0207645_10008229 3300025907 Bacteria 7294
314 Ga0207645_10009608 3300025907 Bacteria 6683
315 Ga0207645_10017792 3300025907 Bacteria 4685
316 Ga0207645_10032025 3300025907 Bacteria 3381
317 Ga0207645_10074137 3300025907 Bacteria 2179
318 Ga0207643_10061809 3300025908 Bacteria 2139
319 Ga0207705_10000461 3300025909 Bacteria 34817
320 Ga0207705_10089825 3300025909 Bacteria 2248
321 Ga0207684_10003939 3300025910 Bacteria 14206
322 Ga0207707_10001730 3300025912 Bacteria 20053
323 Ga0207707_10002994 3300025912 Bacteria 15031
324 Ga0207707_10174919 3300025912 Bacteria 1875
325 Ga0207695_10009980 3300025913 Bacteria 11666
326 Ga0207695_10221476 3300025913 Bacteria 1799
327 Ga0207695_10311458 3300025913 Bacteria 1464
328 Ga0207671_10008972 3300025914 Bacteria 8414
329 Ga0207671_10116263 3300025914 Bacteria 2040
330 Ga0207671_10149745 3300025914 Bacteria 1802
331 Ga0207693_10000226 3300025915 Bacteria 51496
332 Ga0207663_10039520 3300025916 Bacteria 2859
333 Ga0207657_10002447 3300025919 Bacteria 20063
334 Ga0207649_10000085 3300025920 Bacteria 79657
335 Ga0207649_10012683 3300025920 Bacteria 4683
336 Ga0207649_10016552 3300025920 Bacteria 4161
337 Ga0207652_10002306 3300025921 Bacteria 16170
338 Ga0207652_10109191 3300025921 Bacteria 2452
339 Ga0207646_10321392 3300025922 Bacteria 1398
340 Ga0207681_10000424 3300025923 Bacteria 29435
341 Ga0207681_10004628 3300025923 Bacteria 8460
342 Ga0207681_10047590 3300025923 Bacteria 2891
343 Ga0207681_10109204 3300025923 Bacteria 2009
344 Ga0207694_10003938 3300025924 Bacteria 11712
345 Ga0207694_10008832 3300025924 Bacteria 7600
346 Ga0207694_10041705 3300025924 Bacteria 3538
347 Ga0207650_10000149 3300025925 Bacteria 83837
348 Ga0207650_10010685 3300025925 Bacteria 6307
349 Ga0207650_10039118 3300025925 Bacteria 3466
350 Ga0207650_10062620 3300025925 Bacteria 2780
351 Ga0207650_10069218 3300025925 Bacteria 2651
352 Ga0207650_10200209 3300025925 Bacteria 1599
353 Ga0207659_10000394 3300025926 Bacteria 26304
354 Ga0207659_10002170 3300025926 Bacteria 11657
355 Ga0207659_10031709 3300025926 Bacteria 3621
356 Ga0207659_10066937 3300025926 Bacteria 2609
357 Ga0207659_10328888 3300025926 Bacteria 1263
358 Ga0207687_10038820 3300025927 Bacteria 3256
359 Ga0207644_10000264 3300025931 Bacteria 35311
360 Ga0207644_10002319 3300025931 Bacteria 12312
361 Ga0207644_10017259 3300025931 Bacteria 4871
362 Ga0207644_10031742 3300025931 Bacteria 3682
363 Ga0207644_10174053 3300025931 Bacteria 1682
364 Ga0207644_10267767 3300025931 Bacteria 1368
365 Ga0207706_10007947 3300025933 Bacteria 9793
366 Ga0207706_10028272 3300025933 Bacteria 5008
367 Ga0207706_10041510 3300025933 Bacteria 4078
368 Ga0207706_10048763 3300025933 Bacteria 3745
369 Ga0207706_10101629 3300025933 Bacteria 2530
370 Ga0207686_10008165 3300025934 Bacteria 5647
371 Ga0207709_10021219 3300025935 Bacteria 3674
372 Ga0207709_10137274 3300025935 Bacteria 1676
373 Ga0207669_10000874 3300025937 Bacteria 12794
374 Ga0207669_10047443 3300025937 Bacteria 2545
375 Ga0207669_10096535 3300025937 Bacteria 1940
376 Ga0207704_10003695 3300025938 Bacteria 6959
377 Ga0207704_10037018 3300025938 Bacteria 2814
378 Ga0207704_10037630 3300025938 Bacteria 2796
379 Ga0207704_10038038 3300025938 Bacteria 2786
380 Ga0207704_10049925 3300025938 Bacteria 2521
381 Ga0207704_10061926 3300025938 Bacteria 2324
382 Ga0207665_10002356 3300025939 Bacteria 12761
383 Ga0207691_10001736 3300025940 Bacteria 21490
384 Ga0207691_10004404 3300025940 Bacteria 13651
385 Ga0207691_10042781 3300025940 Bacteria 4174
386 Ga0207691_10055607 3300025940 Bacteria 3606
387 Ga0207691_10056181 3300025940 Bacteria 3587
388 Ga0207691_10092669 3300025940 Bacteria 2705
389 Ga0207691_10324767 3300025940 Bacteria 1319
390 Ga0207711_10003550 3300025941 Bacteria 13509
391 Ga0207711_10036357 3300025941 Bacteria 4179
392 Ga0207711_10067265 3300025941 Bacteria 3101
393 Ga0207711_10246570 3300025941 Bacteria 1639
394 Ga0207689_10012167 3300025942 Bacteria 7365
395 Ga0207689_10067809 3300025942 Bacteria 2932
396 Ga0207689_10071441 3300025942 Bacteria 2851
397 Ga0207667_10007788 3300025949 Bacteria 12808
398 Ga0207667_10009716 3300025949 Bacteria 11312
399 Ga0207667_10059045 3300025949 Bacteria 4020
400 Ga0207667_10199060 3300025949 Bacteria 2055
401 Ga0207651_10001608 3300025960 Bacteria 10344
402 Ga0207651_10003954 3300025960 Bacteria 7360
403 Ga0207651_10019939 3300025960 Bacteria 4033
404 Ga0207651_10035009 3300025960 Bacteria 3259
405 Ga0207651_10098284 3300025960 Bacteria 2164
406 Ga0207668_10046854 3300025972 Bacteria 2956
407 Ga0207668_10065442 3300025972 Bacteria 2573
408 Ga0207668_10287968 3300025972 Bacteria 1350
409 Ga0207640_10087385 3300025981 Bacteria 2149
410 Ga0207658_10004072 3300025986 Bacteria 10205
411 Ga0207658_10029010 3300025986 Bacteria 3902
412 Ga0207658_10032571 3300025986 Bacteria 3710
413 Ga0207658_10281639 3300025986 Bacteria 1425
414 Ga0207677_10001522 3300026023 Bacteria 12255
415 Ga0207677_10004585 3300026023 Bacteria 7430
416 Ga0207677_10196687 3300026023 Bacteria 1599
417 Ga0207703_10001816 3300026035 Bacteria 19028
418 Ga0207703_10040071 3300026035 Bacteria 3747
419 Ga0207703_10257075 3300026035 Bacteria 1577
420 Ga0207639_10013580 3300026041 Bacteria 5705
421 Ga0207639_10108451 3300026041 Bacteria 2257
422 Ga0207678_10020289 3300026067 Bacteria 5831
423 Ga0207678_10173876 3300026067 Bacteria 1839
424 Ga0207702_10004429 3300026078 Bacteria 12481
425 Ga0207702_10024931 3300026078 Bacteria 4962
426 Ga0207702_10036893 3300026078 Bacteria 4089
427 Ga0207702_10135709 3300026078 Bacteria 2220
428 Ga0207641_10003329 3300026088 Bacteria 14294
429 Ga0207641_10028126 3300026088 Bacteria 4643
430 Ga0207641_10044236 3300026088 Bacteria 3744
431 Ga0207641_10044397 3300026088 Bacteria 3738
432 Ga0207641_10123935 3300026088 Bacteria 2310
433 Ga0207641_10185668 3300026088 Bacteria 1907
434 Ga0207648_10000179 3300026089 Bacteria 66602
435 Ga0207648_10024008 3300026089 Bacteria 5450
436 Ga0207648_10027230 3300026089 Bacteria 5077
437 Ga0207648_10029524 3300026089 Bacteria 4862
438 Ga0207648_10051674 3300026089 Bacteria 3592
439 Ga0207648_10135496 3300026089 Bacteria 2169
440 Ga0207676_10002741 3300026095 Bacteria 12542
441 Ga0207676_10003295 3300026095 Bacteria 11473
442 Ga0207676_10047568 3300026095 Bacteria 3325
443 Ga0207676_10062009 3300026095 Bacteria 2963
444 Ga0207676_10085730 3300026095 Bacteria 2571
445 Ga0207676_10155154 3300026095 Bacteria 1977
446 Ga0207674_10018099 3300026116 Bacteria 7668
447 Ga0207674_10020989 3300026116 Bacteria 7045
448 Ga0207674_10078656 3300026116 Bacteria 3303
449 Ga0207674_10211001 3300026116 Bacteria 1891
450 Ga0207674_10341074 3300026116 Bacteria 1449
451 Ga0207675_100002243 3300026118 Bacteria 19223
452 Ga0207675_100080158 3300026118 Bacteria 3060
453 Ga0207675_100176154 3300026118 Bacteria 2046
454 Ga0207683_10001388 3300026121 Bacteria 21837
455 Ga0207683_10007622 3300026121 Bacteria 9271
456 Ga0207683_10025374 3300026121 Bacteria 5113
457 Ga0207683_10090500 3300026121 Bacteria 2725
458 Ga0207683_10102902 3300026121 Bacteria 2551
459 Ga0207683_10119563 3300026121 Bacteria 2364
460 Ga0207683_10149637 3300026121 Bacteria 2106
461 Ga0207683_10160625 3300026121 Bacteria 2031
462 Ga0207683_10260444 3300026121 Bacteria 1584
463 Ga0207683_10415163 3300026121 Bacteria 1239
464 Ga0207698_10004036 3300026142 Bacteria 8910
465 Ga0207698_10046930 3300026142 Bacteria 3267
466 Ga0207698_10094985 3300026142 Bacteria 2453
467 Ga0207698_10273476 3300026142 Bacteria 1558
468 Ga0209281_1000103 3300027111 Bacteria 221425
469 Ga0209813_10052711 3300027866 Bacteria 1277
470 Ga0268266_10009191 3300028379 Bacteria 8719
471 Ga0268265_10023957 3300028380 Bacteria 4311
472 Ga0268264_10000613 3300028381 Bacteria 42687
473 Ga0268264_10001082 3300028381 Bacteria 26946
474 Ga0268264_10044615 3300028381 Bacteria 3678
475 Ga0268264_10091805 3300028381 Bacteria 2620
476 Ga0268264_10099709 3300028381 Bacteria 2521
477 Ga0307517_10003685 3300028786 Bacteria 23834
478 Ga0307515_10000609 3300028794 Bacteria 83557
479 Ga0307515_10003934 3300028794 Bacteria 31018
480 Ga0307515_10018282 3300028794 Bacteria 12704
481 Ga0307515_10068536 3300028794 Bacteria 4872
482 Ga0307515_10084430 3300028794 Bacteria 4078
483 Ga0307515_10220473 3300028794 Bacteria 1716
484 Ga0265338_10027921 3300028800 Bacteria 5647
485 Ga0307512_10024260 3300030522 Bacteria 5401
486 Ga0307512_10113364 3300030522 Bacteria 1774
487 Ga0265340_10000215 3300031247 Bacteria 29446
488 Ga0265331_10000006 3300031250 Bacteria 418907
489 Ga0265331_10001400 3300031250 Bacteria 17708
490 Ga0265327_10000074 3300031251 Bacteria 214435
491 Ga0307513_10041969 3300031456 Bacteria 5043
492 Ga0307513_10136038 3300031456 Bacteria 2393
493 Ga0307513_10160179 3300031456 Bacteria 2144
494 Ga0307509_10000991 3300031507 Bacteria 48763
495 Ga0307509_10012132 3300031507 Bacteria 10335
496 Ga0307509_10110656 3300031507 Bacteria 2752
497 Ga0307509_10166310 3300031507 Bacteria 2093
498 Ga0307509_10206176 3300031507 Bacteria 1796
499 Ga0307408_100000109 3300031548 Bacteria 91284
500 Ga0307408_100060925 3300031548 Bacteria 2753
501 Ga0307408_100080895 3300031548 Bacteria 2428
502 Ga0307508_10000404 3300031616 Bacteria 51734
503 Ga0307508_10002244 3300031616 Bacteria 20612
504 Ga0307508_10011564 3300031616 Bacteria 8064
505 Ga0307514_10005041 3300031649 Bacteria 11946
506 Ga0265314_10006970 3300031711 Bacteria 9885
507 Ga0307516_10009071 3300031730 Bacteria 11141
508 Ga0307516_10034968 3300031730 Bacteria 5045
509 Ga0307405_10026024 3300031731 Bacteria 3368
510 Ga0307405_10026574 3300031731 Bacteria 3342
511 Ga0307413_10161764 3300031824 Bacteria 1574
512 Ga0307410_10008211 3300031852 Bacteria 5777
513 Ga0307410_10066471 3300031852 Bacteria 2484
514 Ga0307412_10155129 3300031911 Bacteria 1694
515 Ga0307412_10174563 3300031911 Bacteria 1610
516 Ga0307409_100000580 3300031995 Bacteria 15944
517 Ga0307416_100003986 3300032002 Bacteria 8801
518 Ga0307416_100112413 3300032002 Bacteria 2404
519 Ga0307411_10001682 3300032005 Bacteria 9259
520 Ga0307415_100057645 3300032126 Bacteria 2670
521 Ga0307507_10169072 3300033179 Bacteria 1593
522 Ga0307510_10003212 3300033180 Bacteria 19002
523 Ga0373940_0008318 3300035088 Bacteria 2376
524 Ga0373939_0000040 3300035114 Bacteria 45617
525 Ga0373956_0097612 3300035119 Bacteria 1360
526 Ga0373960_0003560 3300035121 Bacteria 3531
527 Ga0373931_0000637 3300035691 Bacteria 14552
528 Ga0373931_0009522 3300035691 Bacteria 4644
529 Ga0373935_0156141 3300035692 Bacteria 1552
530 Ga0373927_0016224 3300035695 Bacteria 4915
531 Ga0373927_0106110 3300035695 Bacteria 1829
532 Ga0373937_0074519 3300036401 Bacteria 3132
533 Ga0373925_0002526 3300037068 Bacteria 14599
534 Ga0373925_0080885 3300037068 Bacteria 2470
535 Ga0373925_0169703 3300037068 Bacteria 1722
536 Ga0395899_0029032 3300037312 Bacteria 4161
537 Ga0395899_0129381 3300037312 Bacteria 1804
538 Ga0395900_0039620 3300037418 Bacteria 4854
539 Ga0395900_0318423 3300037418 Bacteria 1536
540 Ga0395898_0076400 3300037466 Bacteria 3234
541 Ga0395898_0248639 3300037466 Bacteria 1696
542 Ga0395905_0002614 3300037471 Bacteria 19812
543 Ga0395905_0066715 3300037471 Bacteria 3370
544 Ga0395905_0402319 3300037471 Bacteria 1264
545 Ga0395901_0010183 3300038443 Bacteria 9526
546 Ga0436365_0282050 3300039437 Bacteria 19500
547 Ga0436365_0379537 3300039437 Bacteria 1406
548 Ga0436365_0798167 3300039437 Bacteria 89850
549 Ga0436365_0919918 3300039437 Bacteria 6141
550 Ga0436360_0603279 3300039438 Bacteria 16040
551 Ga0436361_0287659 3300039447 Bacteria 26995
552 Ga0436361_0402753 3300039447 Bacteria 4849
553 Ga0436361_1069868 3300039447 Bacteria 1535
554 Ga0436361_1199473 3300039447 Bacteria 2545
555 Ga0436361_1204227 3300039447 Bacteria 5673
556 Ga0436363_1431319 3300039450 Bacteria 5047
557 Ga0436362_0319271 3300039453 Bacteria 2653
558 Ga0451843_0341877 3300041509 Bacteria 1526
559 Ga0439455_0010959 3300042012 Bacteria 2004
560 Ga0439460_0006753 3300042461 Bacteria 2854
561 Ga0451577_0004221 3300042876 Bacteria 15320
562 Ga0466969_0000169 3300044656 Bacteria 35088
563 Ga0466969_0008057 3300044656 Bacteria 5596
564 Ga0466965_0025409 3300044683 Bacteria 2866
565 Ga0466966_0007854 3300044684 Bacteria 7059
566 Ga0466961_0027475 3300044693 Bacteria 3659
567 Ga0466964_0001613 3300044706 Bacteria 7783
568 Ga0453684_0005216 3300044712 Bacteria 26063
569 Ga0453684_0180547 3300044712 Bacteria 2478
570 Ga0466971_0013051 3300044719 Bacteria 3644
571 Ga0466960_0116224 3300044901 Bacteria 1396
572 Ga0451576_0012835 3300045051 Bacteria 9398
573 Ga0451576_0023117 3300045051 Bacteria 6735
574 Ga0466967_0133234 3300045976 Bacteria 2309
575 Ga0466967_0506172 3300045976 Bacteria 1186
576 Ga0495592_0000083 3300046454 Bacteria 83092
577 Ga0495629_0104459 3300046459 Bacteria 1976
578 Ga0495650_0011466 3300046471 Bacteria 4852
579 Ga0495650_0060119 3300046471 Bacteria 1527
580 Ga0495580_0224655 3300046472 Bacteria 1290
581 Ga0495606_0058276 3300046507 Bacteria 2483
582 Ga0495610_0074955 3300046512 Bacteria 1568
583 Ga0495632_0002758 3300046519 Bacteria 13043
584 Ga0495645_0142984 3300046543 Bacteria 1668
585 Ga0495625_0018316 3300046660 Bacteria 5469
586 Ga0495658_0196473 3300046683 Bacteria 1256
587 Ga0495649_0003342 3300046694 Bacteria 10883
588 Ga0495686_0003513 3300047472 Bacteria 13526
589 Ga0495626_0040110 3300048091 Bacteria 2213
590 Ga0496100_0005821 3300048903 Bacteria 6668
591 Ga0496100_0057927 3300048903 Bacteria 2540
592 Ga0496101_0011587 3300048904 Bacteria 5855
593 Ga0496102_0014383 3300048905 Bacteria 6875
594 Ga0496102_0094074 3300048905 Bacteria 2776
595 Ga0496103_0031670 3300048906 Bacteria 3224
596 Ga0496104_0058299 3300048907 Bacteria 3655
597 Ga0496104_0097609 3300048907 Bacteria 2812
598 Ga0496104_0134910 3300048907 Bacteria 2371
599 Ga0496106_0016627 3300048909 Bacteria 5443
600 Ga0496106_0033112 3300048909 Bacteria 3854
601 Ga0496106_0038095 3300048909 Bacteria 3598
602 Ga0496107_0011507 3300048910 Bacteria 6163
603 Ga0496107_0017284 3300048910 Bacteria 5072
604 Ga0496108_0011606 3300048911 Bacteria 7167
605 Ga0496108_0019013 3300048911 Bacteria 5635
606 Ga0496108_0067003 3300048911 Bacteria 3028
607 Ga0496108_0166495 3300048911 Bacteria 1906
608 Ga0496109_0010074 3300048912 Bacteria 8065
609 Ga0496109_0013606 3300048912 Bacteria 7065
610 Ga0496109_0387928 3300048912 Bacteria 1320
611 Ga0496110_0011389 3300048913 Bacteria 7277
612 Ga0496110_0034981 3300048913 Bacteria 4355
613 Ga0496111_0009868 3300048914 Bacteria 6381
614 Ga0496112_0017102 3300048915 Bacteria 6808
615 Ga0496112_0104845 3300048915 Bacteria 2797
616 Ga0496113_0044655 3300048916 Bacteria 3284
617 Ga0496114_0003309 3300048917 Bacteria 12378
618 Ga0496114_0272278 3300048917 Bacteria 1492
619 Ga0496115_0004612 3300048918 Bacteria 9979
620 Ga0501031_0054300 3300049568 Bacteria 2611
621 Ga0501031_0159857 3300049568 Bacteria 1473
622 Ga0501032_0000651 3300049569 Bacteria 28215
623 Ga0501033_0006575 3300049570 Bacteria 9094
624 Ga0501034_0012898 3300049571 Bacteria 8620
625 Ga0501034_0029742 3300049571 Bacteria 5553
626 Ga0501036_0369029 3300049572 Bacteria 1198
627 Ga0501037_0312492 3300049573 Bacteria 1089
628 Ga0501038_0000021 3300049574 Bacteria 151672
629 Ga0501038_0133203 3300049574 Bacteria 2038
630 Ga0501039_0000026 3300049575 Bacteria 150606
631 Ga0501043_0003753 3300049579 Bacteria 12481
632 Ga0501043_0071116 3300049579 Bacteria 2733
633 Ga0501046_0000075 3300049580 Bacteria 104000
634 Ga0501046_0030351 3300049580 Bacteria 4387
635 Ga0501046_0230894 3300049580 Bacteria 1367
636 Ga0501047_0000081 3300049581 Bacteria 122697
637 Ga0501047_0031526 3300049581 Bacteria 5112
638 Ga0501048_0002636 3300049582 Bacteria 13718
639 Ga0501072_0194403 3300049588 Bacteria 1618
640 Ga0501076_0195730 3300049592 Bacteria 1650
641 Ga0501198_000012 3300049649 Bacteria 113529
642 Ga0501222_000010 3300049662 Bacteria 113536
643 Ga0501227_006790 3300049665 Bacteria 2455
644 Ga0501235_019206 3300049669 Bacteria 1516
645 Ga0501221_007083 3300049704 Bacteria 1913
646 Ga0501229_000069 3300049706 Bacteria 10281
647 Ga0501080_0370509 3300049742 Bacteria 1291
648 Ga0501083_0137717 3300049744 Bacteria 1599
649 Ga0501035_0001105 3300049822 Bacteria 28277
650 Ga0501035_0156257 3300049822 Bacteria 1977
651 Ga0501035_0386710 3300049822 Bacteria 1166
652 Ga0501044_0038851 3300049823 Bacteria 4970
653 Ga0501045_0059695 3300049824 Bacteria 2795
654 nmdc:mga03683_177594_c1 3300050489 Bacteria 970
655 nmdc:mga03683_33244_c1 3300050489 Bacteria 2079
656 nmdc:mga03n38_2428_c1 3300050490 Bacteria 5755
657 nmdc:mga0yw44_3749_c1 3300050492 Bacteria 6809
658 nmdc:mga0k408_10242_c1 3300050493 Bacteria 5068
659 nmdc:mga0k408_1156_c1 3300050493 Bacteria 14438
660 nmdc:mga0k408_117328_c1 3300050493 Bacteria 1575
661 nmdc:mga0k408_14208_c1 3300050493 Bacteria 4383
662 nmdc:mga0k408_142255_c1 3300050493 Bacteria 1427
663 nmdc:mga0k408_153858_c1 3300050493 Bacteria 1370
664 nmdc:mga0k408_20310_c1 3300050493 Bacteria 3720
665 nmdc:mga0k408_287_c1 3300050493 Bacteria 27526
666 nmdc:mga0k408_3129_c1 3300050493 Bacteria 8767
667 nmdc:mga0k408_4278_c1 3300050493 Bacteria 7582
668 nmdc:mga0k408_92091_c1 3300050493 Bacteria 1782
669 nmdc:mga06z11_10413_c1 3300050494 Bacteria 3962
670 nmdc:mga06z11_23826_c1 3300050494 Bacteria 2881
671 nmdc:mga06z11_40191_c1 3300050494 Bacteria 2333
672 nmdc:mga07m45_12296_c1 3300050496 Bacteria 4521
673 nmdc:mga07m45_140193_c1 3300050496 Bacteria 1400
674 nmdc:mga07m45_147389_c1 3300050496 Bacteria 1364
675 nmdc:mga07m45_15059_c1 3300050496 Bacteria 4130
676 nmdc:mga07m45_38077_c1 3300050496 Bacteria 2683
677 nmdc:mga07m45_49137_c1 3300050496 Bacteria 2374
678 nmdc:mga07m45_50364_c1 3300050496 Bacteria 2347
679 nmdc:mga07m45_81176_c1 3300050496 Bacteria 1852
680 nmdc:mga07m45_824_c1 3300050496 Bacteria 13393
681 nmdc:mga05p37_88196_c1 3300050507 Bacteria 3824
682 nmdc:mga0sz30_1941_c1 3300050516 Bacteria 7388
683 Ga0500578_0096754 3300053086 Bacteria 1871
684 Ga0500647_0104864 3300053091 Bacteria 1348
685 Ga0500562_000199 3300053108 Bacteria 16293
686 Ga0500595_005191 3300053119 Bacteria 5713
687 Ga0500559_0000019 3300053136 Bacteria 134862
688 Ga0500568_0001428 3300053139 Bacteria 15495
689 Ga0500568_0002988 3300053139 Bacteria 9674
690 Ga0500588_0004285 3300053146 Bacteria 3079
691 Ga0500590_001769 3300053148 Bacteria 9106
692 Ga0500619_000171 3300053154 Bacteria 15684
693 Ga0500645_001960 3300053730 Bacteria 9727
694 Ga0500587_000346 3300053739 Bacteria 5273
695 Ga0501082_0061699 3300060353 Bacteria 3227
696 Ga0466962_0107277 3300061719 Bacteria 1343

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100094316 Ga0075434_1000943162 271
2 3300049574 Ga0501038_0133203 Ga0501038_0133203_24_884 272
3 3300005335 Ga0070666_10000496 Ga0070666_1000049617 277
4 3300005355 Ga0070671_100009932 Ga0070671_1000099325 277
5 3300005367 Ga0070667_100006624 Ga0070667_1000066244 277
6 3300005437 Ga0070710_10020518 Ga0070710_100205182 277
7 3300005439 Ga0070711_100002891 Ga0070711_1000028914 277
8 3300005440 Ga0070705_100030059 Ga0070705_1000300592 277
9 3300005456 Ga0070678_100000952 Ga0070678_10000095213 277
10 3300005459 Ga0068867_100080690 Ga0068867_1000806902 277
11 3300035121 Ga0373960_0003560 Ga0373960_0003560_903_1868 277
12 3300048915 Ga0496112_0104845 Ga0496112_0104845_1280_2245 277
13 3300050493 nmdc:mga0k408_92091_c1 nmdc:mga0k408_92091_c1_24_878 278
14 3300039437 Ga0436365_0379537 Ga0436365_0379537_368_1246 282
15 3300039437 Ga0436365_0919918 Ga0436365_0919918_3196_4074 282
16 3300039453 Ga0436362_0319271 Ga0436362_0319271_287_1165 282
17 3300005355 Ga0070671_100029988 Ga0070671_1000299883 286
18 3300005616 Ga0068852_100054883 Ga0068852_1000548832 286
19 3300025931 Ga0207644_10031742 Ga0207644_100317423 286
20 3300026121 Ga0207683_10149637 Ga0207683_101496372 286
21 3300005339 Ga0070660_100000909 Ga0070660_1000009098 290
22 3300013100 Ga0157373_10087172 Ga0157373_100871722 290
23 3300013104 Ga0157370_10144917 Ga0157370_101449172 290
24 3300013307 Ga0157372_10122021 Ga0157372_101220213 290
25 3300031250 Ga0265331_10000006 Ga0265331_1000000642 290
26 3300031250 Ga0265331_10001400 Ga0265331_1000140015 290
27 3300031711 Ga0265314_10006970 Ga0265314_1000697010 290
28 3300041509 Ga0451843_0341877 Ga0451843_0341877_619_1512 290
29 3300049568 Ga0501031_0054300 Ga0501031_0054300_416_1324 290
30 3300049568 Ga0501031_0159857 Ga0501031_0159857_26_940 290
31 3300049570 Ga0501033_0006575 Ga0501033_0006575_1264_2172 290
32 3300049571 Ga0501034_0029742 Ga0501034_0029742_333_1241 290
33 3300049572 Ga0501036_0369029 Ga0501036_0369029_153_1061 290
34 3300049573 Ga0501037_0312492 Ga0501037_0312492_63_971 290
35 3300049581 Ga0501047_0031526 Ga0501047_0031526_2149_3057 290
36 3300049744 Ga0501083_0137717 Ga0501083_0137717_374_1282 290
37 3300049822 Ga0501035_0156257 Ga0501035_0156257_134_1048 290
38 3300049822 Ga0501035_0386710 Ga0501035_0386710_192_1106 290
39 3300049823 Ga0501044_0038851 Ga0501044_0038851_1620_2534 290
40 3300050489 nmdc:mga03683_177594_c1 nmdc:mga03683_177594_c1_58_960 290
41 3300060353 Ga0501082_0061699 Ga0501082_0061699_1909_2817 290
42 3300005548 Ga0070665_100016149 Ga0070665_1000161495 291
43 3300005614 Ga0068856_100023461 Ga0068856_1000234614 291
44 3300005718 Ga0068866_10007547 Ga0068866_100075474 291
45 3300005841 Ga0068863_100006983 Ga0068863_10000698310 291
46 3300005842 Ga0068858_100002641 Ga0068858_10000264114 291
47 3300006163 Ga0070715_10000669 Ga0070715_100006694 291
48 3300006173 Ga0070716_100001421 Ga0070716_1000014216 291
49 3300006175 Ga0070712_100000683 Ga0070712_1000006837 291
50 3300006237 Ga0097621_100009247 Ga0097621_1000092473 291
51 3300006358 Ga0068871_100190535 Ga0068871_1001905352 291
52 3300009098 Ga0105245_10005446 Ga0105245_1000544610 291
53 3300009101 Ga0105247_10008379 Ga0105247_100083797 291
54 3300009176 Ga0105242_10000422 Ga0105242_1000042214 291
55 3300009177 Ga0105248_10008369 Ga0105248_100083696 291
56 3300009545 Ga0105237_10058014 Ga0105237_100580143 291
57 3300010375 Ga0105239_10008715 Ga0105239_100087156 291
58 3300013296 Ga0157374_10001660 Ga0157374_1000166016 291
59 3300013297 Ga0157378_10002030 Ga0157378_1000203014 291
60 3300013306 Ga0163162_10009296 Ga0163162_100092968 291
61 3300013307 Ga0157372_10038836 Ga0157372_100388363 291
62 3300013307 Ga0157372_10217093 Ga0157372_102170932 291
63 3300013308 Ga0157375_10037041 Ga0157375_100370415 291
64 3300014325 Ga0163163_10162706 Ga0163163_101627062 291
65 3300014968 Ga0157379_10050000 Ga0157379_100500005 291
66 3300025898 Ga0207692_10003475 Ga0207692_100034754 291
67 3300025903 Ga0207680_10039968 Ga0207680_100399682 291
68 3300025905 Ga0207685_10003015 Ga0207685_100030155 291
69 3300025915 Ga0207693_10000226 Ga0207693_1000022639 291
70 3300025916 Ga0207663_10039520 Ga0207663_100395203 291
71 3300025927 Ga0207687_10038820 Ga0207687_100388203 291
72 3300025931 Ga0207644_10174053 Ga0207644_101740532 291
73 3300025939 Ga0207665_10002356 Ga0207665_100023567 291
74 3300025941 Ga0207711_10067265 Ga0207711_100672652 291
75 3300025986 Ga0207658_10032571 Ga0207658_100325714 291
76 3300026023 Ga0207677_10196687 Ga0207677_101966872 291
77 3300026035 Ga0207703_10040071 Ga0207703_100400712 291
78 3300026078 Ga0207702_10024931 Ga0207702_100249313 291
79 3300026088 Ga0207641_10185668 Ga0207641_101856682 291
80 3300026089 Ga0207648_10135496 Ga0207648_101354962 291
81 3300026121 Ga0207683_10001388 Ga0207683_1000138813 291
82 3300028381 Ga0268264_10099709 Ga0268264_100997092 291
83 3300039437 Ga0436365_0798167 Ga0436365_0798167_69687_70598 291
84 3300048903 Ga0496100_0005821 Ga0496100_0005821_1428_2393 291
85 3300048904 Ga0496101_0011587 Ga0496101_0011587_734_1699 291
86 3300048905 Ga0496102_0094074 Ga0496102_0094074_1547_2512 291
87 3300048906 Ga0496103_0031670 Ga0496103_0031670_250_1215 291
88 3300048907 Ga0496104_0097609 Ga0496104_0097609_875_1840 291
89 3300048909 Ga0496106_0016627 Ga0496106_0016627_1297_2262 291
90 3300048910 Ga0496107_0011507 Ga0496107_0011507_597_1562 291
91 3300048911 Ga0496108_0019013 Ga0496108_0019013_4398_5363 291
92 3300048912 Ga0496109_0013606 Ga0496109_0013606_5284_6249 291
93 3300048913 Ga0496110_0011389 Ga0496110_0011389_4407_5372 291
94 3300048914 Ga0496111_0009868 Ga0496111_0009868_4011_4976 291
95 3300048915 Ga0496112_0017102 Ga0496112_0017102_4398_5363 291
96 3300048916 Ga0496113_0044655 Ga0496113_0044655_826_1791 291
97 3300048917 Ga0496114_0003309 Ga0496114_0003309_6091_7056 291
98 3300048918 Ga0496115_0004612 Ga0496115_0004612_4084_5049 291
99 3300005353 Ga0070669_100107174 Ga0070669_1001071742 293
100 3300005434 Ga0070709_10025522 Ga0070709_100255222 293
101 3300005518 Ga0070699_100292090 Ga0070699_1002920901 293
102 3300005545 Ga0070695_100001403 Ga0070695_1000014039 293
103 3300025906 Ga0207699_10013467 Ga0207699_100134673 293
104 3300009177 Ga0105248_10191942 Ga0105248_101919422 296
105 3300025903 Ga0207680_10167364 Ga0207680_101673642 296
106 3300006353 Ga0075370_10009182 Ga0075370_100091823 297
107 3300005458 Ga0070681_10216574 Ga0070681_102165742 298
108 3300005563 Ga0068855_100011163 Ga0068855_1000111632 298
109 3300009551 Ga0105238_10008443 Ga0105238_100084436 298
110 3300025909 Ga0207705_10000461 Ga0207705_1000046110 298
111 3300025912 Ga0207707_10001730 Ga0207707_100017302 298
112 3300025912 Ga0207707_10174919 Ga0207707_101749192 298
113 3300025919 Ga0207657_10002447 Ga0207657_1000244716 298
114 3300025921 Ga0207652_10002306 Ga0207652_100023063 298
115 3300025921 Ga0207652_10109191 Ga0207652_101091912 298
116 3300025924 Ga0207694_10008832 Ga0207694_100088322 298
117 3300025949 Ga0207667_10009716 Ga0207667_100097165 298
118 3300026067 Ga0207678_10173876 Ga0207678_101738763 298
119 3300028800 Ga0265338_10027921 Ga0265338_100279217 298
120 3300006881 Ga0068865_100331961 Ga0068865_1003319611 299
121 3300031247 Ga0265340_10000215 Ga0265340_100002154 299
122 3300031251 Ga0265327_10000074 Ga0265327_10000074182 299
123 3300005344 Ga0070661_100000636 Ga0070661_10000063613 300
124 3300009093 Ga0105240_10194801 Ga0105240_101948012 300
125 3300013104 Ga0157370_10174765 Ga0157370_101747652 300
126 3300017792 Ga0163161_10136534 Ga0163161_101365341 300
127 3300025920 Ga0207649_10000085 Ga0207649_1000008512 300
128 3300026121 Ga0207683_10415163 Ga0207683_104151631 300
129 3300035088 Ga0373940_0008318 Ga0373940_0008318_1010_2014 300
130 3300035114 Ga0373939_0000040 Ga0373939_0000040_31358_32362 300
131 3300035691 Ga0373931_0000637 Ga0373931_0000637_4760_5764 300
132 3300049579 Ga0501043_0071116 Ga0501043_0071116_191_1147 300
133 3300049580 Ga0501046_0030351 Ga0501046_0030351_2479_3441 300
134 3300049742 Ga0501080_0370509 Ga0501080_0370509_132_1088 300
135 3300005336 Ga0070680_100024697 Ga0070680_1000246972 301
136 3300005366 Ga0070659_100039647 Ga0070659_1000396472 301
137 3300005530 Ga0070679_100037901 Ga0070679_1000379013 301
138 3300006358 Ga0068871_100072915 Ga0068871_1000729152 301
139 3300006358 Ga0068871_100126957 Ga0068871_1001269572 301
140 3300013105 Ga0157369_10014701 Ga0157369_100147015 301
141 3300013307 Ga0157372_10011061 Ga0157372_100110612 301
142 3300021384 Ga0213876_10008872 Ga0213876_100088724 301
143 3300026116 Ga0207674_10211001 Ga0207674_102110012 301
144 3300045976 Ga0466967_0506172 Ga0466967_0506172_13_987 301
145 3300032005 Ga0307411_10001682 Ga0307411_100016828 302
146 3300049665 Ga0501227_006790 Ga0501227_006790_1012_2088 302
147 3300049669 Ga0501235_019206 Ga0501235_019206_31_1053 302
148 3300049704 Ga0501221_007083 Ga0501221_007083_814_1821 302
149 3300049706 Ga0501229_000069 Ga0501229_000069_9203_10210 302
150 3300021384 Ga0213876_10014753 Ga0213876_100147532 303
151 3300039437 Ga0436365_0282050 Ga0436365_0282050_5433_6443 303
152 3300044656 Ga0466969_0000169 Ga0466969_0000169_3825_4901 304
153 3300005327 Ga0070658_10152954 Ga0070658_101529542 305
154 3300005331 Ga0070670_100298270 Ga0070670_1002982701 305
155 3300005455 Ga0070663_100062911 Ga0070663_1000629112 305
156 3300005616 Ga0068852_100182111 Ga0068852_1001821112 305
157 3300006358 Ga0068871_100056504 Ga0068871_1000565042 305
158 3300025940 Ga0207691_10324767 Ga0207691_103247671 305
159 3300026121 Ga0207683_10119563 Ga0207683_101195631 305
160 3300005618 Ga0068864_100228734 Ga0068864_1002287342 306
161 3300026095 Ga0207676_10155154 Ga0207676_101551542 306
162 3300005436 Ga0070713_100152036 Ga0070713_1001520362 307
163 3300026116 Ga0207674_10020989 Ga0207674_100209893 307
164 3300050493 nmdc:mga0k408_117328_c1 nmdc:mga0k408_117328_c1_405_1418 307
165 3300050496 nmdc:mga07m45_824_c1 nmdc:mga07m45_824_c1_6626_7639 307
166 3300014326 Ga0157380_10230760 Ga0157380_102307602 308
167 3300031548 Ga0307408_100080895 Ga0307408_1000808952 308
168 3300031731 Ga0307405_10026574 Ga0307405_100265742 308
169 3300031995 Ga0307409_100000580 Ga0307409_10000058017 308
170 3300032002 Ga0307416_100003986 Ga0307416_1000039867 308
171 3300032126 Ga0307415_100057645 Ga0307415_1000576452 308
172 3300005331 Ga0070670_100001787 Ga0070670_10000178710 309
173 3300005367 Ga0070667_100165418 Ga0070667_1001654182 309
174 3300005456 Ga0070678_100027929 Ga0070678_1000279293 309
175 3300005618 Ga0068864_100013594 Ga0068864_10001359411 309
176 3300006358 Ga0068871_100078626 Ga0068871_1000786262 309
177 3300009551 Ga0105238_10022383 Ga0105238_100223833 309
178 3300014968 Ga0157379_10078692 Ga0157379_100786923 309
179 3300025926 Ga0207659_10066937 Ga0207659_100669372 309
180 3300025940 Ga0207691_10004404 Ga0207691_100044045 309
181 3300026088 Ga0207641_10044397 Ga0207641_100443972 309
182 3300044901 Ga0466960_0116224 Ga0466960_0116224_62_1069 309
183 3300053091 Ga0500647_0104864 Ga0500647_0104864_359_1321 309
184 3300053146 Ga0500588_0004285 Ga0500588_0004285_1015_1980 309
185 3300005467 Ga0070706_100000463 Ga0070706_10000046317 310
186 3300005468 Ga0070707_100030724 Ga0070707_1000307245 310
187 3300005843 Ga0068860_100044975 Ga0068860_1000449753 310
188 3300025910 Ga0207684_10003939 Ga0207684_100039397 310
189 3300025922 Ga0207646_10321392 Ga0207646_103213922 310
190 3300005844 Ga0068862_100226709 Ga0068862_1002267092 311
191 3300009553 Ga0105249_10032646 Ga0105249_100326464 311
192 3300025315 Ga0207697_10087719 Ga0207697_100877192 311
193 3300005328 Ga0070676_10058888 Ga0070676_100588882 312
194 3300005330 Ga0070690_100010106 Ga0070690_1000101064 312
195 3300005331 Ga0070670_100265957 Ga0070670_1002659571 312
196 3300005333 Ga0070677_10031921 Ga0070677_100319211 312
197 3300005334 Ga0068869_100124510 Ga0068869_1001245102 312
198 3300005347 Ga0070668_100133068 Ga0070668_1001330682 312
199 3300005353 Ga0070669_100254068 Ga0070669_1002540681 312
200 3300005355 Ga0070671_100002643 Ga0070671_1000026435 312
201 3300005355 Ga0070671_100295238 Ga0070671_1002952381 312
202 3300005356 Ga0070674_100025270 Ga0070674_1000252702 312
203 3300005366 Ga0070659_100168563 Ga0070659_1001685631 312
204 3300005457 Ga0070662_100044407 Ga0070662_1000444072 312
205 3300005457 Ga0070662_100179155 Ga0070662_1001791552 312
206 3300005458 Ga0070681_10009885 Ga0070681_1000988511 312
207 3300005459 Ga0068867_100025230 Ga0068867_1000252302 312
208 3300005543 Ga0070672_100030950 Ga0070672_1000309502 312
209 3300005616 Ga0068852_100044322 Ga0068852_1000443222 312
210 3300005617 Ga0068859_100061938 Ga0068859_1000619382 312
211 3300005618 Ga0068864_100094268 Ga0068864_1000942682 312
212 3300005718 Ga0068866_10020078 Ga0068866_100200782 312
213 3300005719 Ga0068861_100157022 Ga0068861_1001570222 312
214 3300005841 Ga0068863_100134799 Ga0068863_1001347992 312
215 3300005841 Ga0068863_100328099 Ga0068863_1003280992 312
216 3300005842 Ga0068858_100180458 Ga0068858_1001804582 312
217 3300005843 Ga0068860_100089174 Ga0068860_1000891742 312
218 3300006042 Ga0075368_10036251 Ga0075368_100362512 312
219 3300006237 Ga0097621_100004475 Ga0097621_10000447514 312
220 3300006881 Ga0068865_100012354 Ga0068865_1000123544 312
221 3300006931 Ga0097620_100061943 Ga0097620_1000619432 312
222 3300009177 Ga0105248_10005804 Ga0105248_1000580415 312
223 3300013308 Ga0157375_10130491 Ga0157375_101304912 312
224 3300017792 Ga0163161_10013100 Ga0163161_100131005 312
225 3300017792 Ga0163161_10023850 Ga0163161_100238504 312
226 3300025893 Ga0207682_10095697 Ga0207682_100956972 312
227 3300025899 Ga0207642_10035995 Ga0207642_100359952 312
228 3300025907 Ga0207645_10017792 Ga0207645_100177922 312
229 3300025912 Ga0207707_10002994 Ga0207707_100029942 312
230 3300025923 Ga0207681_10000424 Ga0207681_100004242 312
231 3300025925 Ga0207650_10200209 Ga0207650_102002092 312
232 3300025931 Ga0207644_10000264 Ga0207644_1000026415 312
233 3300025931 Ga0207644_10267767 Ga0207644_102677671 312
234 3300025933 Ga0207706_10028272 Ga0207706_100282723 312
235 3300025933 Ga0207706_10041510 Ga0207706_100415102 312
236 3300025935 Ga0207709_10021219 Ga0207709_100212192 312
237 3300025937 Ga0207669_10096535 Ga0207669_100965352 312
238 3300025938 Ga0207704_10037630 Ga0207704_100376302 312
239 3300025940 Ga0207691_10055607 Ga0207691_100556072 312
240 3300025941 Ga0207711_10003550 Ga0207711_1000355015 312
241 3300025942 Ga0207689_10071441 Ga0207689_100714412 312
242 3300025972 Ga0207668_10046854 Ga0207668_100468543 312
243 3300025986 Ga0207658_10004072 Ga0207658_100040724 312
244 3300025986 Ga0207658_10029010 Ga0207658_100290102 312
245 3300026035 Ga0207703_10001816 Ga0207703_100018162 312
246 3300026088 Ga0207641_10028126 Ga0207641_100281262 312
247 3300026088 Ga0207641_10044236 Ga0207641_100442364 312
248 3300026089 Ga0207648_10027230 Ga0207648_100272302 312
249 3300026095 Ga0207676_10047568 Ga0207676_100475682 312
250 3300026118 Ga0207675_100080158 Ga0207675_1000801583 312
251 3300026142 Ga0207698_10046930 Ga0207698_100469303 312
252 3300028381 Ga0268264_10001082 Ga0268264_100010822 312
253 3300006881 Ga0068865_100050149 Ga0068865_1000501492 313
254 3300025938 Ga0207704_10038038 Ga0207704_100380382 313
255 3300049649 Ga0501198_000012 Ga0501198_000012_89229_90272 313
256 3300049662 Ga0501222_000010 Ga0501222_000010_89235_90278 313
257 3300005328 Ga0070676_10089154 Ga0070676_100891542 314
258 3300005331 Ga0070670_100024831 Ga0070670_1000248317 314
259 3300005333 Ga0070677_10031652 Ga0070677_100316522 314
260 3300005353 Ga0070669_100045050 Ga0070669_1000450502 314
261 3300005364 Ga0070673_100119932 Ga0070673_1001199322 314
262 3300005367 Ga0070667_100292652 Ga0070667_1002926522 314
263 3300005543 Ga0070672_100013536 Ga0070672_1000135362 314
264 3300005617 Ga0068859_100117044 Ga0068859_1001170442 314
265 3300005719 Ga0068861_100002250 Ga0068861_1000022503 314
266 3300005843 Ga0068860_100000823 Ga0068860_10000082328 314
267 3300005844 Ga0068862_100050504 Ga0068862_1000505042 314
268 3300006881 Ga0068865_100007445 Ga0068865_1000074455 314
269 3300006931 Ga0097620_100117044 Ga0097620_1001170442 314
270 3300011119 Ga0105246_10259916 Ga0105246_102599162 314
271 3300013297 Ga0157378_10001703 Ga0157378_1000170311 314
272 3300013308 Ga0157375_10048027 Ga0157375_100480272 314
273 3300025907 Ga0207645_10009608 Ga0207645_100096083 314
274 3300025923 Ga0207681_10109204 Ga0207681_101092041 314
275 3300025925 Ga0207650_10010685 Ga0207650_100106852 314
276 3300025926 Ga0207659_10031709 Ga0207659_100317092 314
277 3300025933 Ga0207706_10048763 Ga0207706_100487632 314
278 3300025938 Ga0207704_10003695 Ga0207704_100036955 314
279 3300025940 Ga0207691_10056181 Ga0207691_100561812 314
280 3300025940 Ga0207691_10092669 Ga0207691_100926692 314
281 3300025960 Ga0207651_10035009 Ga0207651_100350092 314
282 3300025960 Ga0207651_10098284 Ga0207651_100982842 314
283 3300025972 Ga0207668_10065442 Ga0207668_100654422 314
284 3300026089 Ga0207648_10000179 Ga0207648_1000017946 314
285 3300026118 Ga0207675_100002243 Ga0207675_10000224318 314
286 3300026142 Ga0207698_10273476 Ga0207698_102734762 314
287 3300028380 Ga0268265_10023957 Ga0268265_100239572 314
288 3300028381 Ga0268264_10000613 Ga0268264_1000061323 314
289 3300050493 nmdc:mga0k408_142255_c1 nmdc:mga0k408_142255_c1_264_1295 314
290 3300005329 Ga0070683_100093359 Ga0070683_1000933592 315
291 3300005548 Ga0070665_100090124 Ga0070665_1000901242 315
292 3300005563 Ga0068855_100247241 Ga0068855_1002472412 315
293 3300025913 Ga0207695_10311458 Ga0207695_103114582 315
294 3300025949 Ga0207667_10199060 Ga0207667_101990602 315
295 3300028379 Ga0268266_10009191 Ga0268266_100091916 315
296 3300031649 Ga0307514_10005041 Ga0307514_100050412 315
297 3300037418 Ga0395900_0039620 Ga0395900_0039620_143_1138 315
298 3300038443 Ga0395901_0010183 Ga0395901_0010183_3021_4016 315
299 3300046471 Ga0495650_0011466 Ga0495650_0011466_3466_4623 315
300 3300048911 Ga0496108_0067003 Ga0496108_0067003_1388_2461 315
301 3300048912 Ga0496109_0387928 Ga0496109_0387928_135_1199 315
302 3300049569 Ga0501032_0000651 Ga0501032_0000651_17090_18091 315
303 3300049571 Ga0501034_0012898 Ga0501034_0012898_381_1382 315
304 3300049574 Ga0501038_0000021 Ga0501038_0000021_57167_58168 315
305 3300049575 Ga0501039_0000026 Ga0501039_0000026_57151_58152 315
306 3300049579 Ga0501043_0003753 Ga0501043_0003753_4421_5422 315
307 3300049580 Ga0501046_0230894 Ga0501046_0230894_348_1349 315
308 3300049822 Ga0501035_0001105 Ga0501035_0001105_4308_5309 315
309 3300053119 Ga0500595_005191 Ga0500595_005191_3234_4214 315
310 3300005844 Ga0068862_100175150 Ga0068862_1001751502 316
311 3300021361 Ga0213872_10039667 Ga0213872_100396672 316
312 3300021361 Ga0213872_10050960 Ga0213872_100509602 316
313 3300025913 Ga0207695_10221476 Ga0207695_102214762 316
314 3300031911 Ga0307412_10155129 Ga0307412_101551292 316
315 3300032002 Ga0307416_100112413 Ga0307416_1001124132 316
316 3300037312 Ga0395899_0129381 Ga0395899_0129381_374_1360 316
317 3300039438 Ga0436360_0603279 Ga0436360_0603279_8671_9669 316
318 3300039447 Ga0436361_0402753 Ga0436361_0402753_3362_4360 316
319 3300039447 Ga0436361_1069868 Ga0436361_1069868_223_1221 316
320 3300039447 Ga0436361_1199473 Ga0436361_1199473_1277_2281 316
321 3300049588 Ga0501072_0194403 Ga0501072_0194403_279_1277 316
322 3300006195 Ga0075366_10001610 Ga0075366_100016106 317
323 3300006353 Ga0075370_10009019 Ga0075370_100090194 317
324 3300014968 Ga0157379_10235467 Ga0157379_102354672 317
325 3300025914 Ga0207671_10149745 Ga0207671_101497452 317
326 3300025924 Ga0207694_10003938 Ga0207694_100039386 317
327 3300026118 Ga0207675_100176154 Ga0207675_1001761542 317
328 3300036401 Ga0373937_0074519 Ga0373937_0074519_454_1491 317
329 3300037466 Ga0395898_0248639 Ga0395898_0248639_633_1676 317
330 3300050493 nmdc:mga0k408_14208_c1 nmdc:mga0k408_14208_c1_1834_2838 317
331 3300053108 Ga0500562_000199 Ga0500562_000199_191_1210 317
332 3300014968 Ga0157379_10145427 Ga0157379_101454272 318
333 3300031548 Ga0307408_100000109 Ga0307408_10000010934 318
334 3300053139 Ga0500568_0001428 Ga0500568_0001428_1388_2398 318
335 3300005331 Ga0070670_100122898 Ga0070670_1001228982 319
336 3300005354 Ga0070675_100062018 Ga0070675_1000620182 319
337 3300005367 Ga0070667_100008184 Ga0070667_1000081843 319
338 3300005543 Ga0070672_100008932 Ga0070672_1000089323 319
339 3300005563 Ga0068855_100008847 Ga0068855_10000884714 319
340 3300006237 Ga0097621_100044671 Ga0097621_1000446712 319
341 3300013306 Ga0163162_10002252 Ga0163162_1000225220 319
342 3300013308 Ga0157375_10015508 Ga0157375_100155085 319
343 3300025925 Ga0207650_10039118 Ga0207650_100391182 319
344 3300025925 Ga0207650_10062620 Ga0207650_100626202 319
345 3300025949 Ga0207667_10007788 Ga0207667_100077883 319
346 3300026095 Ga0207676_10002741 Ga0207676_100027417 319
347 3300026121 Ga0207683_10025374 Ga0207683_100253743 319
348 3300035695 Ga0373927_0106110 Ga0373927_0106110_463_1464 319
349 3300037068 Ga0373925_0080885 Ga0373925_0080885_478_1479 319
350 3300037312 Ga0395899_0029032 Ga0395899_0029032_1639_2649 319
351 3300037418 Ga0395900_0318423 Ga0395900_0318423_135_1145 319
352 3300037466 Ga0395898_0076400 Ga0395898_0076400_794_1804 319
353 3300049592 Ga0501076_0195730 Ga0501076_0195730_534_1634 319
354 3300050494 nmdc:mga06z11_40191_c1 nmdc:mga06z11_40191_c1_1258_2310 319
355 3300050496 nmdc:mga07m45_50364_c1 nmdc:mga07m45_50364_c1_1257_2309 319
356 iso_pu_bacteria 2523231067 2523469167 319
357 iso_pu_bacteria 2738543031 2739347344 319
358 3300013104 Ga0157370_10093444 Ga0157370_100934442 320
359 3300050489 nmdc:mga03683_33244_c1 nmdc:mga03683_33244_c1_224_1237 320
360 3300009148 Ga0105243_10025417 Ga0105243_100254173 321
361 3300009176 Ga0105242_10014535 Ga0105242_100145352 321
362 3300025242 Ga0209258_101087 Ga0209258_10108713 321
363 3300025934 Ga0207686_10008165 Ga0207686_100081652 321
364 3300025937 Ga0207669_10047443 Ga0207669_100474432 321
365 3300031852 Ga0307410_10066471 Ga0307410_100664713 321
366 3300035695 Ga0373927_0016224 Ga0373927_0016224_232_1230 321
367 3300037068 Ga0373925_0002526 Ga0373925_0002526_2996_3994 321
368 3300005328 Ga0070676_10011649 Ga0070676_100116496 322
369 3300005333 Ga0070677_10002828 Ga0070677_100028282 322
370 3300005334 Ga0068869_100030141 Ga0068869_1000301412 322
371 3300005338 Ga0068868_100003181 Ga0068868_10000318110 322
372 3300005353 Ga0070669_100002645 Ga0070669_1000026453 322
373 3300005354 Ga0070675_100005641 Ga0070675_1000056419 322
374 3300005355 Ga0070671_100009715 Ga0070671_1000097155 322
375 3300005364 Ga0070673_100040882 Ga0070673_1000408822 322
376 3300005366 Ga0070659_100028796 Ga0070659_1000287964 322
377 3300005456 Ga0070678_100013205 Ga0070678_1000132051 322
378 3300005459 Ga0068867_100001379 Ga0068867_10000137910 322
379 3300005539 Ga0068853_100021221 Ga0068853_1000212212 322
380 3300005543 Ga0070672_100000327 Ga0070672_10000032724 322
381 3300005548 Ga0070665_100118105 Ga0070665_1001181053 322
382 3300005618 Ga0068864_100030622 Ga0068864_1000306222 322
383 3300006237 Ga0097621_100052288 Ga0097621_1000522882 322
384 3300006881 Ga0068865_100054640 Ga0068865_1000546402 322
385 3300009098 Ga0105245_10394429 Ga0105245_103944291 322
386 3300013306 Ga0163162_10255314 Ga0163162_102553142 322
387 3300014326 Ga0157380_10158858 Ga0157380_101588582 322
388 3300017792 Ga0163161_10052922 Ga0163161_100529222 322
389 3300025893 Ga0207682_10005442 Ga0207682_100054424 322
390 3300025908 Ga0207643_10061809 Ga0207643_100618092 322
391 3300025923 Ga0207681_10004628 Ga0207681_100046283 322
392 3300025925 Ga0207650_10000149 Ga0207650_1000014969 322
393 3300025926 Ga0207659_10000394 Ga0207659_100003949 322
394 3300025931 Ga0207644_10017259 Ga0207644_100172593 322
395 3300025937 Ga0207669_10000874 Ga0207669_1000087412 322
396 3300025938 Ga0207704_10049925 Ga0207704_100499252 322
397 3300025940 Ga0207691_10001736 Ga0207691_1000173618 322
398 3300025960 Ga0207651_10003954 Ga0207651_100039543 322
399 3300025981 Ga0207640_10087385 Ga0207640_100873852 322
400 3300026088 Ga0207641_10123935 Ga0207641_101239352 322
401 3300026089 Ga0207648_10029524 Ga0207648_100295242 322
402 3300026095 Ga0207676_10085730 Ga0207676_100857302 322
403 3300026116 Ga0207674_10341074 Ga0207674_103410742 322
404 3300026121 Ga0207683_10102902 Ga0207683_101029022 322
405 3300026121 Ga0207683_10160625 Ga0207683_101606252 322
406 3300026121 Ga0207683_10260444 Ga0207683_102604442 322
407 3300046543 Ga0495645_0142984 Ga0495645_0142984_324_1379 322
408 3300048907 Ga0496104_0134910 Ga0496104_0134910_535_1551 322
409 iso_pu_bacteria 2643221654 2644301375 322
410 3300006195 Ga0075366_10002629 Ga0075366_100026297 323
411 3300021361 Ga0213872_10000113 Ga0213872_1000011310 323
412 3300021361 Ga0213872_10018226 Ga0213872_100182261 323
413 3300039447 Ga0436361_0287659 Ga0436361_0287659_15524_16525 323
414 3300039447 Ga0436361_1204227 Ga0436361_1204227_66_1067 323
415 3300045051 Ga0451576_0023117 Ga0451576_0023117_1522_2508 323
416 3300050493 nmdc:mga0k408_153858_c1 nmdc:mga0k408_153858_c1_103_1185 323
417 3300005445 Ga0070708_100106722 Ga0070708_1001067222 324
418 3300025256 Ga0209759_1001263 Ga0209759_10012634 324
419 3300006177 Ga0075362_10091899 Ga0075362_100918992 325
420 3300031507 Ga0307509_10012132 Ga0307509_100121323 325
421 3300039450 Ga0436363_1431319 Ga0436363_1431319_975_2075 325
422 3300003775 Ga0055524_1000013 Ga0055524_1000013246 326
423 3300005367 Ga0070667_100136299 Ga0070667_1001362992 326
424 3300006946 Ga0079104_1000070 Ga0079104_100007050 326
425 3300009147 Ga0114129_10062014 Ga0114129_100620147 326
426 3300025298 Ga0209050_1009044 Ga0209050_10090445 326
427 3300025299 Ga0209256_1000061 Ga0209256_1000061248 326
428 3300025986 Ga0207658_10281639 Ga0207658_102816392 326
429 3300027111 Ga0209281_1000103 Ga0209281_100010350 326
430 3300028786 Ga0307517_10003685 Ga0307517_100036855 326
431 3300031507 Ga0307509_10206176 Ga0307509_102061762 326
432 3300031730 Ga0307516_10034968 Ga0307516_100349683 326
433 3300033179 Ga0307507_10169072 Ga0307507_101690722 326
434 3300042012 Ga0439455_0010959 Ga0439455_0010959_578_1591 326
435 3300050507 nmdc:mga05p37_88196_c1 nmdc:mga05p37_88196_c1_321_1343 326
436 iso_pu_bacteria 2585428062 2587754197 326
437 3300005843 Ga0068860_100057773 Ga0068860_1000577732 327
438 3300006195 Ga0075366_10001536 Ga0075366_100015367 327
439 3300025914 Ga0207671_10116263 Ga0207671_101162632 327
440 3300026121 Ga0207683_10090500 Ga0207683_100905002 327
441 3300028381 Ga0268264_10091805 Ga0268264_100918051 327
442 3300037471 Ga0395905_0066715 Ga0395905_0066715_1432_2454 327
443 3300050493 nmdc:mga0k408_1156_c1 nmdc:mga0k408_1156_c1_6598_7632 327
444 3300005844 Ga0068862_100014372 Ga0068862_1000143726 328
445 3300009148 Ga0105243_10113366 Ga0105243_101133662 328
446 3300025935 Ga0207709_10137274 Ga0207709_101372742 328
447 3300026078 Ga0207702_10135709 Ga0207702_101357092 328
448 3300044712 Ga0453684_0180547 Ga0453684_0180547_89_1114 328
449 3300045051 Ga0451576_0012835 Ga0451576_0012835_7832_8842 328
450 3300050496 nmdc:mga07m45_140193_c1 nmdc:mga07m45_140193_c1_223_1248 328
451 3300050496 nmdc:mga07m45_38077_c1 nmdc:mga07m45_38077_c1_832_1863 328
452 iso_pu_bacteria 2643221644 2644247026 328
453 3300042876 Ga0451577_0004221 Ga0451577_0004221_2251_3285 329
454 3300044712 Ga0453684_0005216 Ga0453684_0005216_10318_11343 329
455 3300005295 Ga0065707_10110598 Ga0065707_101105983 330
456 3300005548 Ga0070665_100175373 Ga0070665_1001753732 330
457 3300009093 Ga0105240_10030834 Ga0105240_100308345 330
458 3300009545 Ga0105237_10007447 Ga0105237_100074475 330
459 3300009551 Ga0105238_10070959 Ga0105238_100709593 330
460 3300010375 Ga0105239_10010780 Ga0105239_100107804 330
461 3300025913 Ga0207695_10009980 Ga0207695_1000998016 330
462 3300025914 Ga0207671_10008972 Ga0207671_1000897211 330
463 3300025924 Ga0207694_10041705 Ga0207694_100417052 330
464 3300025925 Ga0207650_10069218 Ga0207650_100692182 330
465 3300026041 Ga0207639_10013580 Ga0207639_100135802 330
466 3300028794 Ga0307515_10000609 Ga0307515_1000060920 330
467 3300028794 Ga0307515_10003934 Ga0307515_1000393418 330
468 3300030522 Ga0307512_10113364 Ga0307512_101133642 330
469 3300031456 Ga0307513_10041969 Ga0307513_100419692 330
470 3300031456 Ga0307513_10136038 Ga0307513_101360382 330
471 3300031507 Ga0307509_10110656 Ga0307509_101106562 330
472 3300031616 Ga0307508_10000404 Ga0307508_1000040433 330
473 3300031911 Ga0307412_10174563 Ga0307412_101745632 330
474 3300035119 Ga0373956_0097612 Ga0373956_0097612_110_1219 330
475 3300035692 Ga0373935_0156141 Ga0373935_0156141_176_1285 330
476 3300037068 Ga0373925_0169703 Ga0373925_0169703_437_1546 330
477 3300046459 Ga0495629_0104459 Ga0495629_0104459_617_1759 330
478 3300048917 Ga0496114_0272278 Ga0496114_0272278_341_1381 330
479 3300053148 Ga0500590_001769 Ga0500590_001769_4436_5449 330
480 3300003322 rootL2_10034863 rootL2_100348632 331
481 3300005328 Ga0070676_10044423 Ga0070676_100444232 331
482 3300005354 Ga0070675_100148377 Ga0070675_1001483772 331
483 3300005563 Ga0068855_100002063 Ga0068855_10000206320 331
484 3300005844 Ga0068862_100016973 Ga0068862_1000169735 331
485 3300025303 Ga0209051_1013888 Ga0209051_10138884 331
486 3300031730 Ga0307516_10009071 Ga0307516_1000907116 331
487 3300037471 Ga0395905_0002614 Ga0395905_0002614_4937_5980 331
488 3300048905 Ga0496102_0014383 Ga0496102_0014383_441_1502 331
489 3300050496 nmdc:mga07m45_147389_c1 nmdc:mga07m45_147389_c1_117_1133 331
490 iso_pu_bacteria 2643221585 2643936494 331
491 iso_pu_bacteria 2643221656 2644317850 331
492 3300003316 rootH1_10006656 rootH1_100066565 332
493 3300003322 rootL2_10000250 rootL2_100002505 332
494 3300005328 Ga0070676_10063389 Ga0070676_100633892 332
495 3300005330 Ga0070690_100041032 Ga0070690_1000410322 332
496 3300005331 Ga0070670_100108547 Ga0070670_1001085472 332
497 3300005334 Ga0068869_100037947 Ga0068869_1000379472 332
498 3300005335 Ga0070666_10116227 Ga0070666_101162272 332
499 3300005338 Ga0068868_100000966 Ga0068868_10000096619 332
500 3300005338 Ga0068868_100023991 Ga0068868_1000239912 332
501 3300005343 Ga0070687_100053057 Ga0070687_1000530572 332
502 3300005344 Ga0070661_100007516 Ga0070661_1000075164 332
503 3300005344 Ga0070661_100140699 Ga0070661_1001406992 332
504 3300005353 Ga0070669_100126813 Ga0070669_1001268132 332
505 3300005354 Ga0070675_100087022 Ga0070675_1000870222 332
506 3300005354 Ga0070675_100424737 Ga0070675_1004247371 332
507 3300005355 Ga0070671_100003392 Ga0070671_10000339210 332
508 3300005356 Ga0070674_100004218 Ga0070674_1000042184 332
509 3300005356 Ga0070674_100036594 Ga0070674_1000365943 332
510 3300005364 Ga0070673_100013730 Ga0070673_1000137303 332
511 3300005364 Ga0070673_100030938 Ga0070673_1000309384 332
512 3300005367 Ga0070667_100187177 Ga0070667_1001871772 332
513 3300005456 Ga0070678_100005704 Ga0070678_1000057045 332
514 3300005459 Ga0068867_100026510 Ga0068867_1000265102 332
515 3300005459 Ga0068867_100033912 Ga0068867_1000339122 332
516 3300005539 Ga0068853_100071486 Ga0068853_1000714862 332
517 3300005539 Ga0068853_100080473 Ga0068853_1000804733 332
518 3300005543 Ga0070672_100061511 Ga0070672_1000615113 332
519 3300005563 Ga0068855_100037807 Ga0068855_1000378073 332
520 3300005564 Ga0070664_100059347 Ga0070664_1000593472 332
521 3300005564 Ga0070664_100144594 Ga0070664_1001445942 332
522 3300005564 Ga0070664_100288019 Ga0070664_1002880192 332
523 3300005578 Ga0068854_100009863 Ga0068854_1000098636 332
524 3300005578 Ga0068854_100062788 Ga0068854_1000627882 332
525 3300005614 Ga0068856_100007776 Ga0068856_10000777611 332
526 3300005615 Ga0070702_100058361 Ga0070702_1000583612 332
527 3300005616 Ga0068852_100012439 Ga0068852_1000124393 332
528 3300005616 Ga0068852_100106018 Ga0068852_1001060182 332
529 3300005617 Ga0068859_100084220 Ga0068859_1000842202 332
530 3300005618 Ga0068864_100002065 Ga0068864_1000020657 332
531 3300005834 Ga0068851_10020954 Ga0068851_100209543 332
532 3300005834 Ga0068851_10033595 Ga0068851_100335952 332
533 3300005841 Ga0068863_100040147 Ga0068863_1000401474 332
534 3300005842 Ga0068858_100008614 Ga0068858_1000086143 332
535 3300005842 Ga0068858_100016336 Ga0068858_1000163363 332
536 3300005842 Ga0068858_100027116 Ga0068858_1000271161 332
537 3300005843 Ga0068860_100040723 Ga0068860_1000407232 332
538 3300005843 Ga0068860_100087594 Ga0068860_1000875943 332
539 3300006038 Ga0075365_10025870 Ga0075365_100258702 332
540 3300006178 Ga0075367_10034681 Ga0075367_100346813 332
541 3300006195 Ga0075366_10008876 Ga0075366_100088762 332
542 3300006195 Ga0075366_10012726 Ga0075366_100127263 332
543 3300006195 Ga0075366_10044465 Ga0075366_100444653 332
544 3300006237 Ga0097621_100025499 Ga0097621_1000254992 332
545 3300006237 Ga0097621_100050121 Ga0097621_1000501213 332
546 3300006353 Ga0075370_10001367 Ga0075370_100013673 332
547 3300006353 Ga0075370_10038105 Ga0075370_100381052 332
548 3300006358 Ga0068871_100004794 Ga0068871_1000047947 332
549 3300006358 Ga0068871_100126845 Ga0068871_1001268452 332
550 3300006881 Ga0068865_100033691 Ga0068865_1000336912 332
551 3300006931 Ga0097620_100084217 Ga0097620_1000842172 332
552 3300009176 Ga0105242_10209939 Ga0105242_102099392 332
553 3300009177 Ga0105248_10182510 Ga0105248_101825102 332
554 3300009177 Ga0105248_10293031 Ga0105248_102930312 332
555 3300009545 Ga0105237_10303567 Ga0105237_103035672 332
556 3300009551 Ga0105238_10005477 Ga0105238_100054776 332
557 3300013104 Ga0157370_10189636 Ga0157370_101896361 332
558 3300013296 Ga0157374_10003108 Ga0157374_1000310811 332
559 3300013296 Ga0157374_10063603 Ga0157374_100636032 332
560 3300013306 Ga0163162_10132660 Ga0163162_101326602 332
561 3300013307 Ga0157372_10031276 Ga0157372_100312762 332
562 3300013307 Ga0157372_10096556 Ga0157372_100965562 332
563 3300013308 Ga0157375_10008892 Ga0157375_100088921 332
564 3300013308 Ga0157375_10010275 Ga0157375_100102753 332
565 3300013308 Ga0157375_10068709 Ga0157375_100687092 332
566 3300014325 Ga0163163_10009458 Ga0163163_1000945813 332
567 3300014326 Ga0157380_10125730 Ga0157380_101257302 332
568 3300014745 Ga0157377_10001539 Ga0157377_100015397 332
569 3300014968 Ga0157379_10018511 Ga0157379_100185112 332
570 3300014968 Ga0157379_10045148 Ga0157379_100451482 332
571 3300017792 Ga0163161_10020889 Ga0163161_100208893 332
572 3300025321 Ga0207656_10011679 Ga0207656_100116793 332
573 3300025893 Ga0207682_10041078 Ga0207682_100410782 332
574 3300025901 Ga0207688_10027409 Ga0207688_100274092 332
575 3300025903 Ga0207680_10068247 Ga0207680_100682472 332
576 3300025907 Ga0207645_10008229 Ga0207645_100082292 332
577 3300025907 Ga0207645_10032025 Ga0207645_100320253 332
578 3300025907 Ga0207645_10074137 Ga0207645_100741372 332
579 3300025909 Ga0207705_10089825 Ga0207705_100898252 332
580 3300025920 Ga0207649_10012683 Ga0207649_100126832 332
581 3300025920 Ga0207649_10016552 Ga0207649_100165525 332
582 3300025923 Ga0207681_10047590 Ga0207681_100475902 332
583 3300025926 Ga0207659_10002170 Ga0207659_100021703 332
584 3300025926 Ga0207659_10328888 Ga0207659_103288882 332
585 3300025931 Ga0207644_10002319 Ga0207644_1000231910 332
586 3300025933 Ga0207706_10007947 Ga0207706_100079478 332
587 3300025938 Ga0207704_10037018 Ga0207704_100370182 332
588 3300025938 Ga0207704_10061926 Ga0207704_100619262 332
589 3300025940 Ga0207691_10042781 Ga0207691_100427813 332
590 3300025941 Ga0207711_10036357 Ga0207711_100363572 332
591 3300025941 Ga0207711_10246570 Ga0207711_102465702 332
592 3300025942 Ga0207689_10012167 Ga0207689_100121673 332
593 3300025942 Ga0207689_10067809 Ga0207689_100678092 332
594 3300025949 Ga0207667_10059045 Ga0207667_100590452 332
595 3300025960 Ga0207651_10001608 Ga0207651_100016088 332
596 3300025960 Ga0207651_10019939 Ga0207651_100199393 332
597 3300025972 Ga0207668_10287968 Ga0207668_102879682 332
598 3300026023 Ga0207677_10001522 Ga0207677_1000152212 332
599 3300026023 Ga0207677_10004585 Ga0207677_100045854 332
600 3300026035 Ga0207703_10257075 Ga0207703_102570752 332
601 3300026067 Ga0207678_10020289 Ga0207678_100202892 332
602 3300026078 Ga0207702_10004429 Ga0207702_1000442914 332
603 3300026078 Ga0207702_10036893 Ga0207702_100368932 332
604 3300026088 Ga0207641_10003329 Ga0207641_1000332918 332
605 3300026089 Ga0207648_10024008 Ga0207648_100240082 332
606 3300026089 Ga0207648_10051674 Ga0207648_100516742 332
607 3300026095 Ga0207676_10003295 Ga0207676_100032952 332
608 3300026095 Ga0207676_10062009 Ga0207676_100620093 332
609 3300026116 Ga0207674_10078656 Ga0207674_100786562 332
610 3300026121 Ga0207683_10007622 Ga0207683_100076228 332
611 3300026142 Ga0207698_10004036 Ga0207698_100040362 332
612 3300026142 Ga0207698_10094985 Ga0207698_100949852 332
613 3300027866 Ga0209813_10052711 Ga0209813_100527112 332
614 3300028381 Ga0268264_10044615 Ga0268264_100446152 332
615 3300028794 Ga0307515_10018282 Ga0307515_100182828 332
616 3300028794 Ga0307515_10068536 Ga0307515_100685362 332
617 3300028794 Ga0307515_10084430 Ga0307515_100844302 332
618 3300028794 Ga0307515_10220473 Ga0307515_102204732 332
619 3300030522 Ga0307512_10024260 Ga0307512_100242607 332
620 3300031456 Ga0307513_10160179 Ga0307513_101601792 332
621 3300031507 Ga0307509_10000991 Ga0307509_1000099114 332
622 3300031507 Ga0307509_10166310 Ga0307509_101663102 332
623 3300031548 Ga0307408_100060925 Ga0307408_1000609252 332
624 3300031616 Ga0307508_10002244 Ga0307508_1000224413 332
625 3300031616 Ga0307508_10011564 Ga0307508_1001156412 332
626 3300031731 Ga0307405_10026024 Ga0307405_100260242 332
627 3300031824 Ga0307413_10161764 Ga0307413_101617642 332
628 3300031852 Ga0307410_10008211 Ga0307410_100082112 332
629 3300033180 Ga0307510_10003212 Ga0307510_1000321220 332
630 3300035691 Ga0373931_0009522 Ga0373931_0009522_2148_3173 332
631 3300037471 Ga0395905_0402319 Ga0395905_0402319_171_1208 332
632 3300042461 Ga0439460_0006753 Ga0439460_0006753_409_1470 332
633 3300044656 Ga0466969_0008057 Ga0466969_0008057_3887_4927 332
634 3300044683 Ga0466965_0025409 Ga0466965_0025409_1611_2651 332
635 3300044684 Ga0466966_0007854 Ga0466966_0007854_1614_2654 332
636 3300044693 Ga0466961_0027475 Ga0466961_0027475_2000_3040 332
637 3300044706 Ga0466964_0001613 Ga0466964_0001613_5195_6235 332
638 3300044719 Ga0466971_0013051 Ga0466971_0013051_1746_2786 332
639 3300045976 Ga0466967_0133234 Ga0466967_0133234_1239_2279 332
640 3300046454 Ga0495592_0000083 Ga0495592_0000083_50141_51175 332
641 3300046471 Ga0495650_0060119 Ga0495650_0060119_130_1188 332
642 3300046472 Ga0495580_0224655 Ga0495580_0224655_29_1132 332
643 3300046507 Ga0495606_0058276 Ga0495606_0058276_200_1243 332
644 3300046512 Ga0495610_0074955 Ga0495610_0074955_181_1218 332
645 3300046519 Ga0495632_0002758 Ga0495632_0002758_2243_3280 332
646 3300046660 Ga0495625_0018316 Ga0495625_0018316_152_1192 332
647 3300046683 Ga0495658_0196473 Ga0495658_0196473_46_1098 332
648 3300046694 Ga0495649_0003342 Ga0495649_0003342_9131_10168 332
649 3300047472 Ga0495686_0003513 Ga0495686_0003513_5887_6909 332
650 3300048091 Ga0495626_0040110 Ga0495626_0040110_79_1116 332
651 3300048903 Ga0496100_0057927 Ga0496100_0057927_606_1700 332
652 3300048907 Ga0496104_0058299 Ga0496104_0058299_1900_2961 332
653 3300048909 Ga0496106_0033112 Ga0496106_0033112_1501_2595 332
654 3300048909 Ga0496106_0038095 Ga0496106_0038095_1543_2586 332
655 3300048910 Ga0496107_0017284 Ga0496107_0017284_2746_3840 332
656 3300048911 Ga0496108_0011606 Ga0496108_0011606_1169_2263 332
657 3300048911 Ga0496108_0166495 Ga0496108_0166495_511_1566 332
658 3300048912 Ga0496109_0010074 Ga0496109_0010074_2643_3737 332
659 3300048913 Ga0496110_0034981 Ga0496110_0034981_1852_2946 332
660 3300049580 Ga0501046_0000075 Ga0501046_0000075_76989_78041 332
661 3300049581 Ga0501047_0000081 Ga0501047_0000081_76989_78041 332
662 3300049582 Ga0501048_0002636 Ga0501048_0002636_9621_10673 332
663 3300049824 Ga0501045_0059695 Ga0501045_0059695_876_1928 332
664 3300050490 nmdc:mga03n38_2428_c1 nmdc:mga03n38_2428_c1_3239_4309 332
665 3300050492 nmdc:mga0yw44_3749_c1 nmdc:mga0yw44_3749_c1_3523_4593 332
666 3300050493 nmdc:mga0k408_20310_c1 nmdc:mga0k408_20310_c1_1991_3028 332
667 3300050493 nmdc:mga0k408_287_c1 nmdc:mga0k408_287_c1_21908_22978 332
668 3300050493 nmdc:mga0k408_3129_c1 nmdc:mga0k408_3129_c1_4236_5273 332
669 3300050493 nmdc:mga0k408_4278_c1 nmdc:mga0k408_4278_c1_1910_2956 332
670 3300050494 nmdc:mga06z11_23826_c1 nmdc:mga06z11_23826_c1_1752_2822 332
671 3300050496 nmdc:mga07m45_12296_c1 nmdc:mga07m45_12296_c1_2816_3862 332
672 3300050496 nmdc:mga07m45_15059_c1 nmdc:mga07m45_15059_c1_1836_2873 332
673 3300050496 nmdc:mga07m45_81176_c1 nmdc:mga07m45_81176_c1_566_1636 332
674 3300050516 nmdc:mga0sz30_1941_c1 nmdc:mga0sz30_1941_c1_4403_5473 332
675 3300053086 Ga0500578_0096754 Ga0500578_0096754_82_1125 332
676 3300053136 Ga0500559_0000019 Ga0500559_0000019_102513_103544 332
677 3300053139 Ga0500568_0002988 Ga0500568_0002988_6647_7684 332
678 3300053154 Ga0500619_000171 Ga0500619_000171_4331_5398 332
679 3300053730 Ga0500645_001960 Ga0500645_001960_3460_4503 332
680 3300053739 Ga0500587_000346 Ga0500587_000346_880_1911 332
681 3300061719 Ga0466962_0107277 Ga0466962_0107277_216_1256 332
682 3300003215 JGI25153J46596_10002128 JGI25153J46596_100021284 333
683 3300005334 Ga0068869_100302818 Ga0068869_1003028181 333
684 3300005455 Ga0070663_100040907 Ga0070663_1000409073 333
685 3300005457 Ga0070662_100173804 Ga0070662_1001738042 333
686 3300005539 Ga0068853_100044587 Ga0068853_1000445872 333
687 3300005577 Ga0068857_100095305 Ga0068857_1000953052 333
688 3300005578 Ga0068854_100056055 Ga0068854_1000560552 333
689 3300006051 Ga0075364_10011121 Ga0075364_100111216 333
690 3300006177 Ga0075362_10016795 Ga0075362_100167954 333
691 3300006353 Ga0075370_10042740 Ga0075370_100427402 333
692 3300009093 Ga0105240_10035695 Ga0105240_100356955 333
693 3300009098 Ga0105245_10084750 Ga0105245_100847502 333
694 3300009148 Ga0105243_10283022 Ga0105243_102830222 333
695 3300009545 Ga0105237_10033124 Ga0105237_100331245 333
696 3300010375 Ga0105239_10034479 Ga0105239_100344793 333
697 3300025297 Ga0209758_1000281 Ga0209758_100028112 333
698 3300025933 Ga0207706_10101629 Ga0207706_101016292 333
699 3300026041 Ga0207639_10108451 Ga0207639_101084513 333
700 3300026116 Ga0207674_10018099 Ga0207674_1001809910 333
701 3300050493 nmdc:mga0k408_10242_c1 nmdc:mga0k408_10242_c1_3491_4537 333
702 3300050494 nmdc:mga06z11_10413_c1 nmdc:mga06z11_10413_c1_262_1308 333
703 3300050496 nmdc:mga07m45_49137_c1 nmdc:mga07m45_49137_c1_1017_2063 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04166

PdxA

Pyridoxal phosphate biosynthetic protein PdxA

79

382

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ps6-assembly1.cif.gz_A crystal structure of e.coli pdxa 0.904 2 332
6e85-assembly1.cif.gz_B 1.25 angstrom resolution crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from klebsiella pneumoniae. 0.9029 4 332
6e85-assembly1.cif.gz_A 1.25 angstrom resolution crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from klebsiella pneumoniae. 0.899 3 332
6e85-assembly1.cif.gz_B 1.25 angstrom resolution crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from klebsiella pneumoniae. 0.895 4 332
2hi1-assembly1.cif.gz_A the structure of a putative 4-hydroxythreonine-4-phosphate dehydrogenase from salmonella typhimurium. 0.8946 3 333
ID Description Score Start End Superfamily
2hi1B00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8859 6 333 3.40.718.10
1r8kA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8813 3 332 3.40.718.10
2hi1B00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8779 6 333 3.40.718.10
1r8kA00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8683 3 332 3.40.718.10
4jqpB00 Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase 0.8488 2 332 3.40.718.10
ID Description Score Start End GO Terms
AF-Q3V819-F1-model_v4 Pyridoxal phosphate biosynthetic protein variant 0.991 175 285 GO:0016491
GO:0046872
GO:0051287
AF-A0A357AGG2-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase PdxA 0.9803 161 256 GO:0016491
GO:0046872
GO:0051287
AF-X1UB13-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase 0.9763 163 283 GO:0016491
GO:0046872
GO:0051287
AF-A0A3D6BY09-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase 0.975 201 305 GO:0016491
GO:0046872
GO:0051287
AF-A0A2X3GYC7-F1-model_v4 4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262) 0.9661 161 278 GO:0046872
GO:0050570
GO:0051287

Feature Viewer

pLDDT pTM Quality
91.48 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map