F476274
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 703 | 307 | 696 | 333 |
Family's Representative Sequence
| Representative Sequence | 3300013308|Ga0157375_10010275|Ga0157375_100102753 |
| Length | 398 |
| Sequence | LRLQRRDDEQQRDRDGHGLGEQEPGFAHRFGEGSERLSDARRDDNDAMASTAPLPLAITMGDAAGIGPEIIARLFQRGEAAGAFVVGDVAVMRGAAGIVGGLLPVARLEDPGQLADVPPDCLPVLQVEGLPADLMSAPVGRVDARCGRAAAVSIERAVRLVQQGQASAIVTAPIHKEALAAAGVPYPGHTEMLQALASDGGKAPPVRMMLANDELRTVLVTIHLSLRKAIDAVTFDAVLETIRIAHAAAVRQGLVRPRIAVAGLNPHAGEGGLFGEEEATVIAPAIAAAQAEGIDASGPHPPDTVFMRARNAPDHAGEFDLVVAMTHDHGLIPVKYLGVEHGVNVTLGLPFVRTSPDHGTALDIAGRGIADPASLGAAVRMARALAAGGGAVSASSAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 2 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 3 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 4 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 5 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 6 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 7 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 111 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 112 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 173 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 181 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 182 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 188 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 189 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 191 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 200 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 203 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 204 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 211 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 212 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 213 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 221 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 222 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 223 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 224 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 231 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 234 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 257 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 260 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 261 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 277 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 278 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 281 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 282 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 288 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 289 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 296 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 297 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 298 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 299 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 300 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 301 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 302 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 303 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 305 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 0 |
| Isolates | 1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.25 |
| Nodule | 0.28 |
| Rhizoplane | 4.27 |
| Rhizosphere | 80.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10002128 | 3300003215 | Bacteria | 11587 |
| 2 | rootH1_10006656 | 3300003316 | Bacteria | 7826 |
| 3 | rootL2_10000250 | 3300003322 | Bacteria | 7648 |
| 4 | rootL2_10034863 | 3300003322 | Bacteria | 7265 |
| 5 | Ga0055524_1000013 | 3300003775 | Bacteria | 259850 |
| 6 | Ga0065707_10110598 | 3300005295 | Bacteria | 2424 |
| 7 | Ga0070658_10152954 | 3300005327 | Bacteria | 1932 |
| 8 | Ga0070676_10011649 | 3300005328 | Bacteria | 4784 |
| 9 | Ga0070676_10044423 | 3300005328 | Bacteria | 2586 |
| 10 | Ga0070676_10058888 | 3300005328 | Bacteria | 2277 |
| 11 | Ga0070676_10063389 | 3300005328 | Bacteria | 2202 |
| 12 | Ga0070676_10089154 | 3300005328 | Bacteria | 1886 |
| 13 | Ga0070683_100093359 | 3300005329 | Bacteria | 2827 |
| 14 | Ga0070690_100010106 | 3300005330 | Bacteria | 5481 |
| 15 | Ga0070690_100041032 | 3300005330 | Bacteria | 2928 |
| 16 | Ga0070670_100001787 | 3300005331 | Bacteria | 17505 |
| 17 | Ga0070670_100024831 | 3300005331 | Bacteria | 5155 |
| 18 | Ga0070670_100108547 | 3300005331 | Bacteria | 2391 |
| 19 | Ga0070670_100122898 | 3300005331 | Bacteria | 2239 |
| 20 | Ga0070670_100265957 | 3300005331 | Bacteria | 1496 |
| 21 | Ga0070670_100298270 | 3300005331 | Bacteria | 1409 |
| 22 | Ga0070677_10002828 | 3300005333 | Bacteria | 5562 |
| 23 | Ga0070677_10031652 | 3300005333 | Bacteria | 2023 |
| 24 | Ga0070677_10031921 | 3300005333 | Bacteria | 2017 |
| 25 | Ga0068869_100030141 | 3300005334 | Bacteria | 3806 |
| 26 | Ga0068869_100037947 | 3300005334 | Bacteria | 3429 |
| 27 | Ga0068869_100124510 | 3300005334 | Bacteria | 1975 |
| 28 | Ga0068869_100302818 | 3300005334 | Bacteria | 1291 |
| 29 | Ga0070666_10000496 | 3300005335 | Bacteria | 23684 |
| 30 | Ga0070666_10116227 | 3300005335 | Bacteria | 1853 |
| 31 | Ga0070680_100024697 | 3300005336 | Bacteria | 4804 |
| 32 | Ga0068868_100000966 | 3300005338 | Bacteria | 19576 |
| 33 | Ga0068868_100003181 | 3300005338 | Bacteria | 11428 |
| 34 | Ga0068868_100023991 | 3300005338 | Bacteria | 4623 |
| 35 | Ga0070660_100000909 | 3300005339 | Bacteria | 19789 |
| 36 | Ga0070687_100053057 | 3300005343 | Bacteria | 2107 |
| 37 | Ga0070661_100000636 | 3300005344 | Bacteria | 26031 |
| 38 | Ga0070661_100007516 | 3300005344 | Bacteria | 7517 |
| 39 | Ga0070661_100140699 | 3300005344 | Bacteria | 1818 |
| 40 | Ga0070668_100133068 | 3300005347 | Bacteria | 1997 |
| 41 | Ga0070669_100002645 | 3300005353 | Bacteria | 12924 |
| 42 | Ga0070669_100045050 | 3300005353 | Bacteria | 3214 |
| 43 | Ga0070669_100107174 | 3300005353 | Bacteria | 2116 |
| 44 | Ga0070669_100126813 | 3300005353 | Bacteria | 1954 |
| 45 | Ga0070669_100254068 | 3300005353 | Bacteria | 1400 |
| 46 | Ga0070675_100005641 | 3300005354 | Bacteria | 9582 |
| 47 | Ga0070675_100062018 | 3300005354 | Bacteria | 3088 |
| 48 | Ga0070675_100087022 | 3300005354 | Bacteria | 2612 |
| 49 | Ga0070675_100148377 | 3300005354 | Bacteria | 2009 |
| 50 | Ga0070675_100424737 | 3300005354 | Bacteria | 1189 |
| 51 | Ga0070671_100002643 | 3300005355 | Bacteria | 13868 |
| 52 | Ga0070671_100003392 | 3300005355 | Bacteria | 12430 |
| 53 | Ga0070671_100009715 | 3300005355 | Bacteria | 7728 |
| 54 | Ga0070671_100009932 | 3300005355 | Bacteria | 7644 |
| 55 | Ga0070671_100029988 | 3300005355 | Bacteria | 4488 |
| 56 | Ga0070671_100295238 | 3300005355 | Bacteria | 1379 |
| 57 | Ga0070674_100004218 | 3300005356 | Bacteria | 8168 |
| 58 | Ga0070674_100025270 | 3300005356 | Bacteria | 3865 |
| 59 | Ga0070674_100036594 | 3300005356 | Bacteria | 3296 |
| 60 | Ga0070673_100013730 | 3300005364 | Bacteria | 5616 |
| 61 | Ga0070673_100030938 | 3300005364 | Bacteria | 4012 |
| 62 | Ga0070673_100040882 | 3300005364 | Bacteria | 3560 |
| 63 | Ga0070673_100119932 | 3300005364 | Bacteria | 2192 |
| 64 | Ga0070659_100028796 | 3300005366 | Bacteria | 4291 |
| 65 | Ga0070659_100039647 | 3300005366 | Bacteria | 3678 |
| 66 | Ga0070659_100168563 | 3300005366 | Bacteria | 1793 |
| 67 | Ga0070667_100006624 | 3300005367 | Bacteria | 9629 |
| 68 | Ga0070667_100008184 | 3300005367 | Bacteria | 8666 |
| 69 | Ga0070667_100136299 | 3300005367 | Bacteria | 2147 |
| 70 | Ga0070667_100165418 | 3300005367 | Bacteria | 1951 |
| 71 | Ga0070667_100187177 | 3300005367 | Bacteria | 1832 |
| 72 | Ga0070667_100292652 | 3300005367 | Bacteria | 1465 |
| 73 | Ga0070709_10025522 | 3300005434 | Bacteria | 3492 |
| 74 | Ga0070713_100152036 | 3300005436 | Bacteria | 2060 |
| 75 | Ga0070710_10020518 | 3300005437 | Bacteria | 3429 |
| 76 | Ga0070711_100002891 | 3300005439 | Bacteria | 9895 |
| 77 | Ga0070705_100030059 | 3300005440 | Bacteria | 2996 |
| 78 | Ga0070708_100106722 | 3300005445 | Bacteria | 2571 |
| 79 | Ga0070663_100040907 | 3300005455 | Bacteria | 3248 |
| 80 | Ga0070663_100062911 | 3300005455 | Bacteria | 2677 |
| 81 | Ga0070678_100000952 | 3300005456 | Bacteria | 14892 |
| 82 | Ga0070678_100005704 | 3300005456 | Bacteria | 7232 |
| 83 | Ga0070678_100013205 | 3300005456 | Bacteria | 5169 |
| 84 | Ga0070678_100027929 | 3300005456 | Bacteria | 3839 |
| 85 | Ga0070662_100044407 | 3300005457 | Bacteria | 3183 |
| 86 | Ga0070662_100173804 | 3300005457 | Bacteria | 1694 |
| 87 | Ga0070662_100179155 | 3300005457 | Bacteria | 1670 |
| 88 | Ga0070681_10009885 | 3300005458 | Bacteria | 9400 |
| 89 | Ga0070681_10216574 | 3300005458 | Bacteria | 1831 |
| 90 | Ga0068867_100001379 | 3300005459 | Bacteria | 16789 |
| 91 | Ga0068867_100025230 | 3300005459 | Bacteria | 4264 |
| 92 | Ga0068867_100026510 | 3300005459 | Bacteria | 4162 |
| 93 | Ga0068867_100033912 | 3300005459 | Bacteria | 3700 |
| 94 | Ga0068867_100080690 | 3300005459 | Bacteria | 2451 |
| 95 | Ga0070706_100000463 | 3300005467 | Bacteria | 48079 |
| 96 | Ga0070707_100030724 | 3300005468 | Bacteria | 5116 |
| 97 | Ga0070699_100292090 | 3300005518 | Bacteria | 1462 |
| 98 | Ga0070679_100037901 | 3300005530 | Bacteria | 4790 |
| 99 | Ga0068853_100021221 | 3300005539 | Bacteria | 5410 |
| 100 | Ga0068853_100044587 | 3300005539 | Bacteria | 3797 |
| 101 | Ga0068853_100071486 | 3300005539 | Bacteria | 3022 |
| 102 | Ga0068853_100080473 | 3300005539 | Bacteria | 2850 |
| 103 | Ga0070672_100000327 | 3300005543 | Bacteria | 27160 |
| 104 | Ga0070672_100008932 | 3300005543 | Bacteria | 6886 |
| 105 | Ga0070672_100013536 | 3300005543 | Bacteria | 5766 |
| 106 | Ga0070672_100030950 | 3300005543 | Bacteria | 4025 |
| 107 | Ga0070672_100061511 | 3300005543 | Bacteria | 2960 |
| 108 | Ga0070695_100001403 | 3300005545 | Bacteria | 13343 |
| 109 | Ga0070665_100016149 | 3300005548 | Bacteria | 7493 |
| 110 | Ga0070665_100090124 | 3300005548 | Bacteria | 3072 |
| 111 | Ga0070665_100118105 | 3300005548 | Bacteria | 2654 |
| 112 | Ga0070665_100175373 | 3300005548 | Bacteria | 2144 |
| 113 | Ga0068855_100002063 | 3300005563 | Bacteria | 24904 |
| 114 | Ga0068855_100008847 | 3300005563 | Bacteria | 12171 |
| 115 | Ga0068855_100011163 | 3300005563 | Bacteria | 10845 |
| 116 | Ga0068855_100037807 | 3300005563 | Bacteria | 5737 |
| 117 | Ga0068855_100247241 | 3300005563 | Bacteria | 1990 |
| 118 | Ga0070664_100059347 | 3300005564 | Bacteria | 3254 |
| 119 | Ga0070664_100144594 | 3300005564 | Bacteria | 2096 |
| 120 | Ga0070664_100288019 | 3300005564 | Bacteria | 1482 |
| 121 | Ga0068857_100095305 | 3300005577 | Bacteria | 2666 |
| 122 | Ga0068854_100009863 | 3300005578 | Bacteria | 6176 |
| 123 | Ga0068854_100056055 | 3300005578 | Bacteria | 2839 |
| 124 | Ga0068854_100062788 | 3300005578 | Bacteria | 2695 |
| 125 | Ga0068856_100007776 | 3300005614 | Bacteria | 10473 |
| 126 | Ga0068856_100023461 | 3300005614 | Bacteria | 5998 |
| 127 | Ga0070702_100058361 | 3300005615 | Bacteria | 2235 |
| 128 | Ga0068852_100012439 | 3300005616 | Bacteria | 6463 |
| 129 | Ga0068852_100044322 | 3300005616 | Bacteria | 3776 |
| 130 | Ga0068852_100054883 | 3300005616 | Bacteria | 3436 |
| 131 | Ga0068852_100106018 | 3300005616 | Bacteria | 2547 |
| 132 | Ga0068852_100182111 | 3300005616 | Bacteria | 1976 |
| 133 | Ga0068859_100061938 | 3300005617 | Bacteria | 3770 |
| 134 | Ga0068859_100084220 | 3300005617 | Bacteria | 3224 |
| 135 | Ga0068859_100117044 | 3300005617 | Bacteria | 2730 |
| 136 | Ga0068864_100002065 | 3300005618 | Bacteria | 16597 |
| 137 | Ga0068864_100013594 | 3300005618 | Bacteria | 6748 |
| 138 | Ga0068864_100030622 | 3300005618 | Bacteria | 4562 |
| 139 | Ga0068864_100094268 | 3300005618 | Bacteria | 2645 |
| 140 | Ga0068864_100228734 | 3300005618 | Bacteria | 1719 |
| 141 | Ga0068866_10007547 | 3300005718 | Bacteria | 4557 |
| 142 | Ga0068866_10020078 | 3300005718 | Bacteria | 3055 |
| 143 | Ga0068861_100002250 | 3300005719 | Bacteria | 12540 |
| 144 | Ga0068861_100157022 | 3300005719 | Bacteria | 1872 |
| 145 | Ga0068851_10020954 | 3300005834 | Bacteria | 3170 |
| 146 | Ga0068851_10033595 | 3300005834 | Bacteria | 2557 |
| 147 | Ga0068863_100006983 | 3300005841 | Bacteria | 11070 |
| 148 | Ga0068863_100040147 | 3300005841 | Bacteria | 4450 |
| 149 | Ga0068863_100134799 | 3300005841 | Bacteria | 2359 |
| 150 | Ga0068863_100328099 | 3300005841 | Bacteria | 1487 |
| 151 | Ga0068858_100002641 | 3300005842 | Bacteria | 18052 |
| 152 | Ga0068858_100008614 | 3300005842 | Bacteria | 9799 |
| 153 | Ga0068858_100016336 | 3300005842 | Bacteria | 6973 |
| 154 | Ga0068858_100027116 | 3300005842 | Bacteria | 5322 |
| 155 | Ga0068858_100180458 | 3300005842 | Bacteria | 1993 |
| 156 | Ga0068860_100000823 | 3300005843 | Bacteria | 34706 |
| 157 | Ga0068860_100040723 | 3300005843 | Bacteria | 4439 |
| 158 | Ga0068860_100044975 | 3300005843 | Bacteria | 4208 |
| 159 | Ga0068860_100057773 | 3300005843 | Bacteria | 3688 |
| 160 | Ga0068860_100087594 | 3300005843 | Bacteria | 2964 |
| 161 | Ga0068860_100089174 | 3300005843 | Bacteria | 2936 |
| 162 | Ga0068862_100014372 | 3300005844 | Bacteria | 6567 |
| 163 | Ga0068862_100016973 | 3300005844 | Bacteria | 6059 |
| 164 | Ga0068862_100050504 | 3300005844 | Bacteria | 3555 |
| 165 | Ga0068862_100175150 | 3300005844 | Bacteria | 1923 |
| 166 | Ga0068862_100226709 | 3300005844 | Bacteria | 1694 |
| 167 | Ga0075365_10025870 | 3300006038 | Bacteria | 3719 |
| 168 | Ga0075368_10036251 | 3300006042 | Bacteria | 1927 |
| 169 | Ga0075364_10011121 | 3300006051 | Bacteria | 5463 |
| 170 | Ga0070715_10000669 | 3300006163 | Bacteria | 9159 |
| 171 | Ga0070716_100001421 | 3300006173 | Bacteria | 10639 |
| 172 | Ga0070712_100000683 | 3300006175 | Bacteria | 20066 |
| 173 | Ga0075362_10016795 | 3300006177 | Bacteria | 3004 |
| 174 | Ga0075362_10091899 | 3300006177 | Bacteria | 1409 |
| 175 | Ga0075367_10034681 | 3300006178 | Bacteria | 2916 |
| 176 | Ga0075366_10001536 | 3300006195 | Bacteria | 11547 |
| 177 | Ga0075366_10001610 | 3300006195 | Bacteria | 11306 |
| 178 | Ga0075366_10002629 | 3300006195 | Bacteria | 9242 |
| 179 | Ga0075366_10008876 | 3300006195 | Bacteria | 5599 |
| 180 | Ga0075366_10012726 | 3300006195 | Bacteria | 4780 |
| 181 | Ga0075366_10044465 | 3300006195 | Bacteria | 2632 |
| 182 | Ga0097621_100004475 | 3300006237 | Bacteria | 9740 |
| 183 | Ga0097621_100009247 | 3300006237 | Bacteria | 7149 |
| 184 | Ga0097621_100025499 | 3300006237 | Bacteria | 4626 |
| 185 | Ga0097621_100044671 | 3300006237 | Bacteria | 3575 |
| 186 | Ga0097621_100050121 | 3300006237 | Bacteria | 3394 |
| 187 | Ga0097621_100052288 | 3300006237 | Bacteria | 3328 |
| 188 | Ga0075370_10001367 | 3300006353 | Bacteria | 10507 |
| 189 | Ga0075370_10009019 | 3300006353 | Bacteria | 5159 |
| 190 | Ga0075370_10009182 | 3300006353 | Bacteria | 5121 |
| 191 | Ga0075370_10038105 | 3300006353 | Bacteria | 2705 |
| 192 | Ga0075370_10042740 | 3300006353 | Bacteria | 2560 |
| 193 | Ga0068871_100004794 | 3300006358 | Bacteria | 9457 |
| 194 | Ga0068871_100056504 | 3300006358 | Bacteria | 3191 |
| 195 | Ga0068871_100072915 | 3300006358 | Bacteria | 2829 |
| 196 | Ga0068871_100078626 | 3300006358 | Bacteria | 2728 |
| 197 | Ga0068871_100126845 | 3300006358 | Bacteria | 2160 |
| 198 | Ga0068871_100126957 | 3300006358 | Bacteria | 2160 |
| 199 | Ga0068871_100190535 | 3300006358 | Bacteria | 1766 |
| 200 | Ga0075434_100094316 | 3300006871 | Bacteria | 2997 |
| 201 | Ga0068865_100007445 | 3300006881 | Bacteria | 6735 |
| 202 | Ga0068865_100012354 | 3300006881 | Bacteria | 5373 |
| 203 | Ga0068865_100033691 | 3300006881 | Bacteria | 3430 |
| 204 | Ga0068865_100050149 | 3300006881 | Bacteria | 2882 |
| 205 | Ga0068865_100054640 | 3300006881 | Bacteria | 2776 |
| 206 | Ga0068865_100331961 | 3300006881 | Bacteria | 1226 |
| 207 | Ga0097620_100061943 | 3300006931 | Bacteria | 3770 |
| 208 | Ga0097620_100084217 | 3300006931 | Bacteria | 3224 |
| 209 | Ga0097620_100117044 | 3300006931 | Bacteria | 2730 |
| 210 | Ga0079104_1000070 | 3300006946 | Bacteria | 153879 |
| 211 | Ga0105240_10030834 | 3300009093 | Bacteria | 6965 |
| 212 | Ga0105240_10035695 | 3300009093 | Bacteria | 6405 |
| 213 | Ga0105240_10194801 | 3300009093 | Bacteria | 2380 |
| 214 | Ga0105245_10005446 | 3300009098 | Bacteria | 11181 |
| 215 | Ga0105245_10084750 | 3300009098 | Bacteria | 2904 |
| 216 | Ga0105245_10394429 | 3300009098 | Bacteria | 1382 |
| 217 | Ga0105247_10008379 | 3300009101 | Bacteria | 6302 |
| 218 | Ga0114129_10062014 | 3300009147 | Bacteria | 5224 |
| 219 | Ga0105243_10025417 | 3300009148 | Bacteria | 4526 |
| 220 | Ga0105243_10113366 | 3300009148 | Bacteria | 2273 |
| 221 | Ga0105243_10283022 | 3300009148 | Bacteria | 1494 |
| 222 | Ga0105242_10000422 | 3300009176 | Bacteria | 33749 |
| 223 | Ga0105242_10014535 | 3300009176 | Bacteria | 6099 |
| 224 | Ga0105242_10209939 | 3300009176 | Bacteria | 1735 |
| 225 | Ga0105248_10005804 | 3300009177 | Bacteria | 13570 |
| 226 | Ga0105248_10008369 | 3300009177 | Bacteria | 11361 |
| 227 | Ga0105248_10182510 | 3300009177 | Bacteria | 2364 |
| 228 | Ga0105248_10191942 | 3300009177 | Bacteria | 2302 |
| 229 | Ga0105248_10293031 | 3300009177 | Bacteria | 1832 |
| 230 | Ga0105237_10007447 | 3300009545 | Bacteria | 11978 |
| 231 | Ga0105237_10033124 | 3300009545 | Bacteria | 5234 |
| 232 | Ga0105237_10058014 | 3300009545 | Bacteria | 3874 |
| 233 | Ga0105237_10303567 | 3300009545 | Bacteria | 1599 |
| 234 | Ga0105238_10005477 | 3300009551 | Bacteria | 12552 |
| 235 | Ga0105238_10008443 | 3300009551 | Bacteria | 10312 |
| 236 | Ga0105238_10022383 | 3300009551 | Bacteria | 6441 |
| 237 | Ga0105238_10070959 | 3300009551 | Bacteria | 3481 |
| 238 | Ga0105249_10032646 | 3300009553 | Bacteria | 4710 |
| 239 | Ga0105239_10008715 | 3300010375 | Bacteria | 11480 |
| 240 | Ga0105239_10010780 | 3300010375 | Bacteria | 10211 |
| 241 | Ga0105239_10034479 | 3300010375 | Bacteria | 5558 |
| 242 | Ga0105246_10259916 | 3300011119 | Bacteria | 1383 |
| 243 | Ga0157373_10087172 | 3300013100 | Bacteria | 2200 |
| 244 | Ga0157370_10093444 | 3300013104 | Bacteria | 2822 |
| 245 | Ga0157370_10144917 | 3300013104 | Bacteria | 2212 |
| 246 | Ga0157370_10174765 | 3300013104 | Bacteria | 1996 |
| 247 | Ga0157370_10189636 | 3300013104 | Bacteria | 1908 |
| 248 | Ga0157369_10014701 | 3300013105 | Bacteria | 8830 |
| 249 | Ga0157374_10001660 | 3300013296 | Bacteria | 18628 |
| 250 | Ga0157374_10003108 | 3300013296 | Bacteria | 13934 |
| 251 | Ga0157374_10063603 | 3300013296 | Bacteria | 3461 |
| 252 | Ga0157378_10001703 | 3300013297 | Bacteria | 19776 |
| 253 | Ga0157378_10002030 | 3300013297 | Bacteria | 18126 |
| 254 | Ga0163162_10002252 | 3300013306 | Bacteria | 18114 |
| 255 | Ga0163162_10009296 | 3300013306 | Bacteria | 9558 |
| 256 | Ga0163162_10132660 | 3300013306 | Bacteria | 2600 |
| 257 | Ga0163162_10255314 | 3300013306 | Bacteria | 1885 |
| 258 | Ga0157372_10011061 | 3300013307 | Bacteria | 9602 |
| 259 | Ga0157372_10031276 | 3300013307 | Bacteria | 5827 |
| 260 | Ga0157372_10038836 | 3300013307 | Bacteria | 5253 |
| 261 | Ga0157372_10096556 | 3300013307 | Bacteria | 3368 |
| 262 | Ga0157372_10122021 | 3300013307 | Bacteria | 2994 |
| 263 | Ga0157372_10217093 | 3300013307 | Bacteria | 2217 |
| 264 | Ga0157375_10008892 | 3300013308 | Bacteria | 8789 |
| 265 | Ga0157375_10010275 | 3300013308 | Bacteria | 8238 |
| 266 | Ga0157375_10015508 | 3300013308 | Bacteria | 6823 |
| 267 | Ga0157375_10037041 | 3300013308 | Bacteria | 4670 |
| 268 | Ga0157375_10048027 | 3300013308 | Bacteria | 4173 |
| 269 | Ga0157375_10068709 | 3300013308 | Bacteria | 3546 |
| 270 | Ga0157375_10130491 | 3300013308 | Bacteria | 2632 |
| 271 | Ga0163163_10009458 | 3300014325 | Bacteria | 8703 |
| 272 | Ga0163163_10162706 | 3300014325 | Bacteria | 2277 |
| 273 | Ga0157380_10125730 | 3300014326 | Bacteria | 2179 |
| 274 | Ga0157380_10158858 | 3300014326 | Bacteria | 1962 |
| 275 | Ga0157380_10230760 | 3300014326 | Bacteria | 1662 |
| 276 | Ga0157377_10001539 | 3300014745 | Bacteria | 10025 |
| 277 | Ga0157379_10018511 | 3300014968 | Bacteria | 6144 |
| 278 | Ga0157379_10045148 | 3300014968 | Bacteria | 3934 |
| 279 | Ga0157379_10050000 | 3300014968 | Bacteria | 3731 |
| 280 | Ga0157379_10078692 | 3300014968 | Bacteria | 2953 |
| 281 | Ga0157379_10145427 | 3300014968 | Bacteria | 2138 |
| 282 | Ga0157379_10235467 | 3300014968 | Bacteria | 1660 |
| 283 | Ga0163161_10013100 | 3300017792 | Bacteria | 5764 |
| 284 | Ga0163161_10020889 | 3300017792 | Bacteria | 4599 |
| 285 | Ga0163161_10023850 | 3300017792 | Bacteria | 4318 |
| 286 | Ga0163161_10052922 | 3300017792 | Bacteria | 2943 |
| 287 | Ga0163161_10136534 | 3300017792 | Bacteria | 1854 |
| 288 | Ga0213872_10000113 | 3300021361 | Bacteria | 74827 |
| 289 | Ga0213872_10018226 | 3300021361 | Bacteria | 3238 |
| 290 | Ga0213872_10039667 | 3300021361 | Bacteria | 2149 |
| 291 | Ga0213872_10050960 | 3300021361 | Bacteria | 1879 |
| 292 | Ga0213876_10008872 | 3300021384 | Bacteria | 5424 |
| 293 | Ga0213876_10014753 | 3300021384 | Bacteria | 4140 |
| 294 | Ga0209258_101087 | 3300025242 | Bacteria | 11629 |
| 295 | Ga0209759_1001263 | 3300025256 | Bacteria | 15243 |
| 296 | Ga0209758_1000281 | 3300025297 | Bacteria | 100826 |
| 297 | Ga0209050_1009044 | 3300025298 | Bacteria | 5182 |
| 298 | Ga0209256_1000061 | 3300025299 | Bacteria | 260890 |
| 299 | Ga0209051_1013888 | 3300025303 | Bacteria | 3797 |
| 300 | Ga0207697_10087719 | 3300025315 | Bacteria | 1317 |
| 301 | Ga0207656_10011679 | 3300025321 | Bacteria | 3322 |
| 302 | Ga0207682_10005442 | 3300025893 | Bacteria | 5181 |
| 303 | Ga0207682_10041078 | 3300025893 | Bacteria | 1887 |
| 304 | Ga0207682_10095697 | 3300025893 | Bacteria | 1293 |
| 305 | Ga0207692_10003475 | 3300025898 | Bacteria | 6158 |
| 306 | Ga0207642_10035995 | 3300025899 | Bacteria | 2120 |
| 307 | Ga0207688_10027409 | 3300025901 | Bacteria | 3134 |
| 308 | Ga0207680_10039968 | 3300025903 | Bacteria | 2725 |
| 309 | Ga0207680_10068247 | 3300025903 | Bacteria | 2193 |
| 310 | Ga0207680_10167364 | 3300025903 | Bacteria | 1478 |
| 311 | Ga0207685_10003015 | 3300025905 | Bacteria | 3999 |
| 312 | Ga0207699_10013467 | 3300025906 | Bacteria | 4188 |
| 313 | Ga0207645_10008229 | 3300025907 | Bacteria | 7294 |
| 314 | Ga0207645_10009608 | 3300025907 | Bacteria | 6683 |
| 315 | Ga0207645_10017792 | 3300025907 | Bacteria | 4685 |
| 316 | Ga0207645_10032025 | 3300025907 | Bacteria | 3381 |
| 317 | Ga0207645_10074137 | 3300025907 | Bacteria | 2179 |
| 318 | Ga0207643_10061809 | 3300025908 | Bacteria | 2139 |
| 319 | Ga0207705_10000461 | 3300025909 | Bacteria | 34817 |
| 320 | Ga0207705_10089825 | 3300025909 | Bacteria | 2248 |
| 321 | Ga0207684_10003939 | 3300025910 | Bacteria | 14206 |
| 322 | Ga0207707_10001730 | 3300025912 | Bacteria | 20053 |
| 323 | Ga0207707_10002994 | 3300025912 | Bacteria | 15031 |
| 324 | Ga0207707_10174919 | 3300025912 | Bacteria | 1875 |
| 325 | Ga0207695_10009980 | 3300025913 | Bacteria | 11666 |
| 326 | Ga0207695_10221476 | 3300025913 | Bacteria | 1799 |
| 327 | Ga0207695_10311458 | 3300025913 | Bacteria | 1464 |
| 328 | Ga0207671_10008972 | 3300025914 | Bacteria | 8414 |
| 329 | Ga0207671_10116263 | 3300025914 | Bacteria | 2040 |
| 330 | Ga0207671_10149745 | 3300025914 | Bacteria | 1802 |
| 331 | Ga0207693_10000226 | 3300025915 | Bacteria | 51496 |
| 332 | Ga0207663_10039520 | 3300025916 | Bacteria | 2859 |
| 333 | Ga0207657_10002447 | 3300025919 | Bacteria | 20063 |
| 334 | Ga0207649_10000085 | 3300025920 | Bacteria | 79657 |
| 335 | Ga0207649_10012683 | 3300025920 | Bacteria | 4683 |
| 336 | Ga0207649_10016552 | 3300025920 | Bacteria | 4161 |
| 337 | Ga0207652_10002306 | 3300025921 | Bacteria | 16170 |
| 338 | Ga0207652_10109191 | 3300025921 | Bacteria | 2452 |
| 339 | Ga0207646_10321392 | 3300025922 | Bacteria | 1398 |
| 340 | Ga0207681_10000424 | 3300025923 | Bacteria | 29435 |
| 341 | Ga0207681_10004628 | 3300025923 | Bacteria | 8460 |
| 342 | Ga0207681_10047590 | 3300025923 | Bacteria | 2891 |
| 343 | Ga0207681_10109204 | 3300025923 | Bacteria | 2009 |
| 344 | Ga0207694_10003938 | 3300025924 | Bacteria | 11712 |
| 345 | Ga0207694_10008832 | 3300025924 | Bacteria | 7600 |
| 346 | Ga0207694_10041705 | 3300025924 | Bacteria | 3538 |
| 347 | Ga0207650_10000149 | 3300025925 | Bacteria | 83837 |
| 348 | Ga0207650_10010685 | 3300025925 | Bacteria | 6307 |
| 349 | Ga0207650_10039118 | 3300025925 | Bacteria | 3466 |
| 350 | Ga0207650_10062620 | 3300025925 | Bacteria | 2780 |
| 351 | Ga0207650_10069218 | 3300025925 | Bacteria | 2651 |
| 352 | Ga0207650_10200209 | 3300025925 | Bacteria | 1599 |
| 353 | Ga0207659_10000394 | 3300025926 | Bacteria | 26304 |
| 354 | Ga0207659_10002170 | 3300025926 | Bacteria | 11657 |
| 355 | Ga0207659_10031709 | 3300025926 | Bacteria | 3621 |
| 356 | Ga0207659_10066937 | 3300025926 | Bacteria | 2609 |
| 357 | Ga0207659_10328888 | 3300025926 | Bacteria | 1263 |
| 358 | Ga0207687_10038820 | 3300025927 | Bacteria | 3256 |
| 359 | Ga0207644_10000264 | 3300025931 | Bacteria | 35311 |
| 360 | Ga0207644_10002319 | 3300025931 | Bacteria | 12312 |
| 361 | Ga0207644_10017259 | 3300025931 | Bacteria | 4871 |
| 362 | Ga0207644_10031742 | 3300025931 | Bacteria | 3682 |
| 363 | Ga0207644_10174053 | 3300025931 | Bacteria | 1682 |
| 364 | Ga0207644_10267767 | 3300025931 | Bacteria | 1368 |
| 365 | Ga0207706_10007947 | 3300025933 | Bacteria | 9793 |
| 366 | Ga0207706_10028272 | 3300025933 | Bacteria | 5008 |
| 367 | Ga0207706_10041510 | 3300025933 | Bacteria | 4078 |
| 368 | Ga0207706_10048763 | 3300025933 | Bacteria | 3745 |
| 369 | Ga0207706_10101629 | 3300025933 | Bacteria | 2530 |
| 370 | Ga0207686_10008165 | 3300025934 | Bacteria | 5647 |
| 371 | Ga0207709_10021219 | 3300025935 | Bacteria | 3674 |
| 372 | Ga0207709_10137274 | 3300025935 | Bacteria | 1676 |
| 373 | Ga0207669_10000874 | 3300025937 | Bacteria | 12794 |
| 374 | Ga0207669_10047443 | 3300025937 | Bacteria | 2545 |
| 375 | Ga0207669_10096535 | 3300025937 | Bacteria | 1940 |
| 376 | Ga0207704_10003695 | 3300025938 | Bacteria | 6959 |
| 377 | Ga0207704_10037018 | 3300025938 | Bacteria | 2814 |
| 378 | Ga0207704_10037630 | 3300025938 | Bacteria | 2796 |
| 379 | Ga0207704_10038038 | 3300025938 | Bacteria | 2786 |
| 380 | Ga0207704_10049925 | 3300025938 | Bacteria | 2521 |
| 381 | Ga0207704_10061926 | 3300025938 | Bacteria | 2324 |
| 382 | Ga0207665_10002356 | 3300025939 | Bacteria | 12761 |
| 383 | Ga0207691_10001736 | 3300025940 | Bacteria | 21490 |
| 384 | Ga0207691_10004404 | 3300025940 | Bacteria | 13651 |
| 385 | Ga0207691_10042781 | 3300025940 | Bacteria | 4174 |
| 386 | Ga0207691_10055607 | 3300025940 | Bacteria | 3606 |
| 387 | Ga0207691_10056181 | 3300025940 | Bacteria | 3587 |
| 388 | Ga0207691_10092669 | 3300025940 | Bacteria | 2705 |
| 389 | Ga0207691_10324767 | 3300025940 | Bacteria | 1319 |
| 390 | Ga0207711_10003550 | 3300025941 | Bacteria | 13509 |
| 391 | Ga0207711_10036357 | 3300025941 | Bacteria | 4179 |
| 392 | Ga0207711_10067265 | 3300025941 | Bacteria | 3101 |
| 393 | Ga0207711_10246570 | 3300025941 | Bacteria | 1639 |
| 394 | Ga0207689_10012167 | 3300025942 | Bacteria | 7365 |
| 395 | Ga0207689_10067809 | 3300025942 | Bacteria | 2932 |
| 396 | Ga0207689_10071441 | 3300025942 | Bacteria | 2851 |
| 397 | Ga0207667_10007788 | 3300025949 | Bacteria | 12808 |
| 398 | Ga0207667_10009716 | 3300025949 | Bacteria | 11312 |
| 399 | Ga0207667_10059045 | 3300025949 | Bacteria | 4020 |
| 400 | Ga0207667_10199060 | 3300025949 | Bacteria | 2055 |
| 401 | Ga0207651_10001608 | 3300025960 | Bacteria | 10344 |
| 402 | Ga0207651_10003954 | 3300025960 | Bacteria | 7360 |
| 403 | Ga0207651_10019939 | 3300025960 | Bacteria | 4033 |
| 404 | Ga0207651_10035009 | 3300025960 | Bacteria | 3259 |
| 405 | Ga0207651_10098284 | 3300025960 | Bacteria | 2164 |
| 406 | Ga0207668_10046854 | 3300025972 | Bacteria | 2956 |
| 407 | Ga0207668_10065442 | 3300025972 | Bacteria | 2573 |
| 408 | Ga0207668_10287968 | 3300025972 | Bacteria | 1350 |
| 409 | Ga0207640_10087385 | 3300025981 | Bacteria | 2149 |
| 410 | Ga0207658_10004072 | 3300025986 | Bacteria | 10205 |
| 411 | Ga0207658_10029010 | 3300025986 | Bacteria | 3902 |
| 412 | Ga0207658_10032571 | 3300025986 | Bacteria | 3710 |
| 413 | Ga0207658_10281639 | 3300025986 | Bacteria | 1425 |
| 414 | Ga0207677_10001522 | 3300026023 | Bacteria | 12255 |
| 415 | Ga0207677_10004585 | 3300026023 | Bacteria | 7430 |
| 416 | Ga0207677_10196687 | 3300026023 | Bacteria | 1599 |
| 417 | Ga0207703_10001816 | 3300026035 | Bacteria | 19028 |
| 418 | Ga0207703_10040071 | 3300026035 | Bacteria | 3747 |
| 419 | Ga0207703_10257075 | 3300026035 | Bacteria | 1577 |
| 420 | Ga0207639_10013580 | 3300026041 | Bacteria | 5705 |
| 421 | Ga0207639_10108451 | 3300026041 | Bacteria | 2257 |
| 422 | Ga0207678_10020289 | 3300026067 | Bacteria | 5831 |
| 423 | Ga0207678_10173876 | 3300026067 | Bacteria | 1839 |
| 424 | Ga0207702_10004429 | 3300026078 | Bacteria | 12481 |
| 425 | Ga0207702_10024931 | 3300026078 | Bacteria | 4962 |
| 426 | Ga0207702_10036893 | 3300026078 | Bacteria | 4089 |
| 427 | Ga0207702_10135709 | 3300026078 | Bacteria | 2220 |
| 428 | Ga0207641_10003329 | 3300026088 | Bacteria | 14294 |
| 429 | Ga0207641_10028126 | 3300026088 | Bacteria | 4643 |
| 430 | Ga0207641_10044236 | 3300026088 | Bacteria | 3744 |
| 431 | Ga0207641_10044397 | 3300026088 | Bacteria | 3738 |
| 432 | Ga0207641_10123935 | 3300026088 | Bacteria | 2310 |
| 433 | Ga0207641_10185668 | 3300026088 | Bacteria | 1907 |
| 434 | Ga0207648_10000179 | 3300026089 | Bacteria | 66602 |
| 435 | Ga0207648_10024008 | 3300026089 | Bacteria | 5450 |
| 436 | Ga0207648_10027230 | 3300026089 | Bacteria | 5077 |
| 437 | Ga0207648_10029524 | 3300026089 | Bacteria | 4862 |
| 438 | Ga0207648_10051674 | 3300026089 | Bacteria | 3592 |
| 439 | Ga0207648_10135496 | 3300026089 | Bacteria | 2169 |
| 440 | Ga0207676_10002741 | 3300026095 | Bacteria | 12542 |
| 441 | Ga0207676_10003295 | 3300026095 | Bacteria | 11473 |
| 442 | Ga0207676_10047568 | 3300026095 | Bacteria | 3325 |
| 443 | Ga0207676_10062009 | 3300026095 | Bacteria | 2963 |
| 444 | Ga0207676_10085730 | 3300026095 | Bacteria | 2571 |
| 445 | Ga0207676_10155154 | 3300026095 | Bacteria | 1977 |
| 446 | Ga0207674_10018099 | 3300026116 | Bacteria | 7668 |
| 447 | Ga0207674_10020989 | 3300026116 | Bacteria | 7045 |
| 448 | Ga0207674_10078656 | 3300026116 | Bacteria | 3303 |
| 449 | Ga0207674_10211001 | 3300026116 | Bacteria | 1891 |
| 450 | Ga0207674_10341074 | 3300026116 | Bacteria | 1449 |
| 451 | Ga0207675_100002243 | 3300026118 | Bacteria | 19223 |
| 452 | Ga0207675_100080158 | 3300026118 | Bacteria | 3060 |
| 453 | Ga0207675_100176154 | 3300026118 | Bacteria | 2046 |
| 454 | Ga0207683_10001388 | 3300026121 | Bacteria | 21837 |
| 455 | Ga0207683_10007622 | 3300026121 | Bacteria | 9271 |
| 456 | Ga0207683_10025374 | 3300026121 | Bacteria | 5113 |
| 457 | Ga0207683_10090500 | 3300026121 | Bacteria | 2725 |
| 458 | Ga0207683_10102902 | 3300026121 | Bacteria | 2551 |
| 459 | Ga0207683_10119563 | 3300026121 | Bacteria | 2364 |
| 460 | Ga0207683_10149637 | 3300026121 | Bacteria | 2106 |
| 461 | Ga0207683_10160625 | 3300026121 | Bacteria | 2031 |
| 462 | Ga0207683_10260444 | 3300026121 | Bacteria | 1584 |
| 463 | Ga0207683_10415163 | 3300026121 | Bacteria | 1239 |
| 464 | Ga0207698_10004036 | 3300026142 | Bacteria | 8910 |
| 465 | Ga0207698_10046930 | 3300026142 | Bacteria | 3267 |
| 466 | Ga0207698_10094985 | 3300026142 | Bacteria | 2453 |
| 467 | Ga0207698_10273476 | 3300026142 | Bacteria | 1558 |
| 468 | Ga0209281_1000103 | 3300027111 | Bacteria | 221425 |
| 469 | Ga0209813_10052711 | 3300027866 | Bacteria | 1277 |
| 470 | Ga0268266_10009191 | 3300028379 | Bacteria | 8719 |
| 471 | Ga0268265_10023957 | 3300028380 | Bacteria | 4311 |
| 472 | Ga0268264_10000613 | 3300028381 | Bacteria | 42687 |
| 473 | Ga0268264_10001082 | 3300028381 | Bacteria | 26946 |
| 474 | Ga0268264_10044615 | 3300028381 | Bacteria | 3678 |
| 475 | Ga0268264_10091805 | 3300028381 | Bacteria | 2620 |
| 476 | Ga0268264_10099709 | 3300028381 | Bacteria | 2521 |
| 477 | Ga0307517_10003685 | 3300028786 | Bacteria | 23834 |
| 478 | Ga0307515_10000609 | 3300028794 | Bacteria | 83557 |
| 479 | Ga0307515_10003934 | 3300028794 | Bacteria | 31018 |
| 480 | Ga0307515_10018282 | 3300028794 | Bacteria | 12704 |
| 481 | Ga0307515_10068536 | 3300028794 | Bacteria | 4872 |
| 482 | Ga0307515_10084430 | 3300028794 | Bacteria | 4078 |
| 483 | Ga0307515_10220473 | 3300028794 | Bacteria | 1716 |
| 484 | Ga0265338_10027921 | 3300028800 | Bacteria | 5647 |
| 485 | Ga0307512_10024260 | 3300030522 | Bacteria | 5401 |
| 486 | Ga0307512_10113364 | 3300030522 | Bacteria | 1774 |
| 487 | Ga0265340_10000215 | 3300031247 | Bacteria | 29446 |
| 488 | Ga0265331_10000006 | 3300031250 | Bacteria | 418907 |
| 489 | Ga0265331_10001400 | 3300031250 | Bacteria | 17708 |
| 490 | Ga0265327_10000074 | 3300031251 | Bacteria | 214435 |
| 491 | Ga0307513_10041969 | 3300031456 | Bacteria | 5043 |
| 492 | Ga0307513_10136038 | 3300031456 | Bacteria | 2393 |
| 493 | Ga0307513_10160179 | 3300031456 | Bacteria | 2144 |
| 494 | Ga0307509_10000991 | 3300031507 | Bacteria | 48763 |
| 495 | Ga0307509_10012132 | 3300031507 | Bacteria | 10335 |
| 496 | Ga0307509_10110656 | 3300031507 | Bacteria | 2752 |
| 497 | Ga0307509_10166310 | 3300031507 | Bacteria | 2093 |
| 498 | Ga0307509_10206176 | 3300031507 | Bacteria | 1796 |
| 499 | Ga0307408_100000109 | 3300031548 | Bacteria | 91284 |
| 500 | Ga0307408_100060925 | 3300031548 | Bacteria | 2753 |
| 501 | Ga0307408_100080895 | 3300031548 | Bacteria | 2428 |
| 502 | Ga0307508_10000404 | 3300031616 | Bacteria | 51734 |
| 503 | Ga0307508_10002244 | 3300031616 | Bacteria | 20612 |
| 504 | Ga0307508_10011564 | 3300031616 | Bacteria | 8064 |
| 505 | Ga0307514_10005041 | 3300031649 | Bacteria | 11946 |
| 506 | Ga0265314_10006970 | 3300031711 | Bacteria | 9885 |
| 507 | Ga0307516_10009071 | 3300031730 | Bacteria | 11141 |
| 508 | Ga0307516_10034968 | 3300031730 | Bacteria | 5045 |
| 509 | Ga0307405_10026024 | 3300031731 | Bacteria | 3368 |
| 510 | Ga0307405_10026574 | 3300031731 | Bacteria | 3342 |
| 511 | Ga0307413_10161764 | 3300031824 | Bacteria | 1574 |
| 512 | Ga0307410_10008211 | 3300031852 | Bacteria | 5777 |
| 513 | Ga0307410_10066471 | 3300031852 | Bacteria | 2484 |
| 514 | Ga0307412_10155129 | 3300031911 | Bacteria | 1694 |
| 515 | Ga0307412_10174563 | 3300031911 | Bacteria | 1610 |
| 516 | Ga0307409_100000580 | 3300031995 | Bacteria | 15944 |
| 517 | Ga0307416_100003986 | 3300032002 | Bacteria | 8801 |
| 518 | Ga0307416_100112413 | 3300032002 | Bacteria | 2404 |
| 519 | Ga0307411_10001682 | 3300032005 | Bacteria | 9259 |
| 520 | Ga0307415_100057645 | 3300032126 | Bacteria | 2670 |
| 521 | Ga0307507_10169072 | 3300033179 | Bacteria | 1593 |
| 522 | Ga0307510_10003212 | 3300033180 | Bacteria | 19002 |
| 523 | Ga0373940_0008318 | 3300035088 | Bacteria | 2376 |
| 524 | Ga0373939_0000040 | 3300035114 | Bacteria | 45617 |
| 525 | Ga0373956_0097612 | 3300035119 | Bacteria | 1360 |
| 526 | Ga0373960_0003560 | 3300035121 | Bacteria | 3531 |
| 527 | Ga0373931_0000637 | 3300035691 | Bacteria | 14552 |
| 528 | Ga0373931_0009522 | 3300035691 | Bacteria | 4644 |
| 529 | Ga0373935_0156141 | 3300035692 | Bacteria | 1552 |
| 530 | Ga0373927_0016224 | 3300035695 | Bacteria | 4915 |
| 531 | Ga0373927_0106110 | 3300035695 | Bacteria | 1829 |
| 532 | Ga0373937_0074519 | 3300036401 | Bacteria | 3132 |
| 533 | Ga0373925_0002526 | 3300037068 | Bacteria | 14599 |
| 534 | Ga0373925_0080885 | 3300037068 | Bacteria | 2470 |
| 535 | Ga0373925_0169703 | 3300037068 | Bacteria | 1722 |
| 536 | Ga0395899_0029032 | 3300037312 | Bacteria | 4161 |
| 537 | Ga0395899_0129381 | 3300037312 | Bacteria | 1804 |
| 538 | Ga0395900_0039620 | 3300037418 | Bacteria | 4854 |
| 539 | Ga0395900_0318423 | 3300037418 | Bacteria | 1536 |
| 540 | Ga0395898_0076400 | 3300037466 | Bacteria | 3234 |
| 541 | Ga0395898_0248639 | 3300037466 | Bacteria | 1696 |
| 542 | Ga0395905_0002614 | 3300037471 | Bacteria | 19812 |
| 543 | Ga0395905_0066715 | 3300037471 | Bacteria | 3370 |
| 544 | Ga0395905_0402319 | 3300037471 | Bacteria | 1264 |
| 545 | Ga0395901_0010183 | 3300038443 | Bacteria | 9526 |
| 546 | Ga0436365_0282050 | 3300039437 | Bacteria | 19500 |
| 547 | Ga0436365_0379537 | 3300039437 | Bacteria | 1406 |
| 548 | Ga0436365_0798167 | 3300039437 | Bacteria | 89850 |
| 549 | Ga0436365_0919918 | 3300039437 | Bacteria | 6141 |
| 550 | Ga0436360_0603279 | 3300039438 | Bacteria | 16040 |
| 551 | Ga0436361_0287659 | 3300039447 | Bacteria | 26995 |
| 552 | Ga0436361_0402753 | 3300039447 | Bacteria | 4849 |
| 553 | Ga0436361_1069868 | 3300039447 | Bacteria | 1535 |
| 554 | Ga0436361_1199473 | 3300039447 | Bacteria | 2545 |
| 555 | Ga0436361_1204227 | 3300039447 | Bacteria | 5673 |
| 556 | Ga0436363_1431319 | 3300039450 | Bacteria | 5047 |
| 557 | Ga0436362_0319271 | 3300039453 | Bacteria | 2653 |
| 558 | Ga0451843_0341877 | 3300041509 | Bacteria | 1526 |
| 559 | Ga0439455_0010959 | 3300042012 | Bacteria | 2004 |
| 560 | Ga0439460_0006753 | 3300042461 | Bacteria | 2854 |
| 561 | Ga0451577_0004221 | 3300042876 | Bacteria | 15320 |
| 562 | Ga0466969_0000169 | 3300044656 | Bacteria | 35088 |
| 563 | Ga0466969_0008057 | 3300044656 | Bacteria | 5596 |
| 564 | Ga0466965_0025409 | 3300044683 | Bacteria | 2866 |
| 565 | Ga0466966_0007854 | 3300044684 | Bacteria | 7059 |
| 566 | Ga0466961_0027475 | 3300044693 | Bacteria | 3659 |
| 567 | Ga0466964_0001613 | 3300044706 | Bacteria | 7783 |
| 568 | Ga0453684_0005216 | 3300044712 | Bacteria | 26063 |
| 569 | Ga0453684_0180547 | 3300044712 | Bacteria | 2478 |
| 570 | Ga0466971_0013051 | 3300044719 | Bacteria | 3644 |
| 571 | Ga0466960_0116224 | 3300044901 | Bacteria | 1396 |
| 572 | Ga0451576_0012835 | 3300045051 | Bacteria | 9398 |
| 573 | Ga0451576_0023117 | 3300045051 | Bacteria | 6735 |
| 574 | Ga0466967_0133234 | 3300045976 | Bacteria | 2309 |
| 575 | Ga0466967_0506172 | 3300045976 | Bacteria | 1186 |
| 576 | Ga0495592_0000083 | 3300046454 | Bacteria | 83092 |
| 577 | Ga0495629_0104459 | 3300046459 | Bacteria | 1976 |
| 578 | Ga0495650_0011466 | 3300046471 | Bacteria | 4852 |
| 579 | Ga0495650_0060119 | 3300046471 | Bacteria | 1527 |
| 580 | Ga0495580_0224655 | 3300046472 | Bacteria | 1290 |
| 581 | Ga0495606_0058276 | 3300046507 | Bacteria | 2483 |
| 582 | Ga0495610_0074955 | 3300046512 | Bacteria | 1568 |
| 583 | Ga0495632_0002758 | 3300046519 | Bacteria | 13043 |
| 584 | Ga0495645_0142984 | 3300046543 | Bacteria | 1668 |
| 585 | Ga0495625_0018316 | 3300046660 | Bacteria | 5469 |
| 586 | Ga0495658_0196473 | 3300046683 | Bacteria | 1256 |
| 587 | Ga0495649_0003342 | 3300046694 | Bacteria | 10883 |
| 588 | Ga0495686_0003513 | 3300047472 | Bacteria | 13526 |
| 589 | Ga0495626_0040110 | 3300048091 | Bacteria | 2213 |
| 590 | Ga0496100_0005821 | 3300048903 | Bacteria | 6668 |
| 591 | Ga0496100_0057927 | 3300048903 | Bacteria | 2540 |
| 592 | Ga0496101_0011587 | 3300048904 | Bacteria | 5855 |
| 593 | Ga0496102_0014383 | 3300048905 | Bacteria | 6875 |
| 594 | Ga0496102_0094074 | 3300048905 | Bacteria | 2776 |
| 595 | Ga0496103_0031670 | 3300048906 | Bacteria | 3224 |
| 596 | Ga0496104_0058299 | 3300048907 | Bacteria | 3655 |
| 597 | Ga0496104_0097609 | 3300048907 | Bacteria | 2812 |
| 598 | Ga0496104_0134910 | 3300048907 | Bacteria | 2371 |
| 599 | Ga0496106_0016627 | 3300048909 | Bacteria | 5443 |
| 600 | Ga0496106_0033112 | 3300048909 | Bacteria | 3854 |
| 601 | Ga0496106_0038095 | 3300048909 | Bacteria | 3598 |
| 602 | Ga0496107_0011507 | 3300048910 | Bacteria | 6163 |
| 603 | Ga0496107_0017284 | 3300048910 | Bacteria | 5072 |
| 604 | Ga0496108_0011606 | 3300048911 | Bacteria | 7167 |
| 605 | Ga0496108_0019013 | 3300048911 | Bacteria | 5635 |
| 606 | Ga0496108_0067003 | 3300048911 | Bacteria | 3028 |
| 607 | Ga0496108_0166495 | 3300048911 | Bacteria | 1906 |
| 608 | Ga0496109_0010074 | 3300048912 | Bacteria | 8065 |
| 609 | Ga0496109_0013606 | 3300048912 | Bacteria | 7065 |
| 610 | Ga0496109_0387928 | 3300048912 | Bacteria | 1320 |
| 611 | Ga0496110_0011389 | 3300048913 | Bacteria | 7277 |
| 612 | Ga0496110_0034981 | 3300048913 | Bacteria | 4355 |
| 613 | Ga0496111_0009868 | 3300048914 | Bacteria | 6381 |
| 614 | Ga0496112_0017102 | 3300048915 | Bacteria | 6808 |
| 615 | Ga0496112_0104845 | 3300048915 | Bacteria | 2797 |
| 616 | Ga0496113_0044655 | 3300048916 | Bacteria | 3284 |
| 617 | Ga0496114_0003309 | 3300048917 | Bacteria | 12378 |
| 618 | Ga0496114_0272278 | 3300048917 | Bacteria | 1492 |
| 619 | Ga0496115_0004612 | 3300048918 | Bacteria | 9979 |
| 620 | Ga0501031_0054300 | 3300049568 | Bacteria | 2611 |
| 621 | Ga0501031_0159857 | 3300049568 | Bacteria | 1473 |
| 622 | Ga0501032_0000651 | 3300049569 | Bacteria | 28215 |
| 623 | Ga0501033_0006575 | 3300049570 | Bacteria | 9094 |
| 624 | Ga0501034_0012898 | 3300049571 | Bacteria | 8620 |
| 625 | Ga0501034_0029742 | 3300049571 | Bacteria | 5553 |
| 626 | Ga0501036_0369029 | 3300049572 | Bacteria | 1198 |
| 627 | Ga0501037_0312492 | 3300049573 | Bacteria | 1089 |
| 628 | Ga0501038_0000021 | 3300049574 | Bacteria | 151672 |
| 629 | Ga0501038_0133203 | 3300049574 | Bacteria | 2038 |
| 630 | Ga0501039_0000026 | 3300049575 | Bacteria | 150606 |
| 631 | Ga0501043_0003753 | 3300049579 | Bacteria | 12481 |
| 632 | Ga0501043_0071116 | 3300049579 | Bacteria | 2733 |
| 633 | Ga0501046_0000075 | 3300049580 | Bacteria | 104000 |
| 634 | Ga0501046_0030351 | 3300049580 | Bacteria | 4387 |
| 635 | Ga0501046_0230894 | 3300049580 | Bacteria | 1367 |
| 636 | Ga0501047_0000081 | 3300049581 | Bacteria | 122697 |
| 637 | Ga0501047_0031526 | 3300049581 | Bacteria | 5112 |
| 638 | Ga0501048_0002636 | 3300049582 | Bacteria | 13718 |
| 639 | Ga0501072_0194403 | 3300049588 | Bacteria | 1618 |
| 640 | Ga0501076_0195730 | 3300049592 | Bacteria | 1650 |
| 641 | Ga0501198_000012 | 3300049649 | Bacteria | 113529 |
| 642 | Ga0501222_000010 | 3300049662 | Bacteria | 113536 |
| 643 | Ga0501227_006790 | 3300049665 | Bacteria | 2455 |
| 644 | Ga0501235_019206 | 3300049669 | Bacteria | 1516 |
| 645 | Ga0501221_007083 | 3300049704 | Bacteria | 1913 |
| 646 | Ga0501229_000069 | 3300049706 | Bacteria | 10281 |
| 647 | Ga0501080_0370509 | 3300049742 | Bacteria | 1291 |
| 648 | Ga0501083_0137717 | 3300049744 | Bacteria | 1599 |
| 649 | Ga0501035_0001105 | 3300049822 | Bacteria | 28277 |
| 650 | Ga0501035_0156257 | 3300049822 | Bacteria | 1977 |
| 651 | Ga0501035_0386710 | 3300049822 | Bacteria | 1166 |
| 652 | Ga0501044_0038851 | 3300049823 | Bacteria | 4970 |
| 653 | Ga0501045_0059695 | 3300049824 | Bacteria | 2795 |
| 654 | nmdc:mga03683_177594_c1 | 3300050489 | Bacteria | 970 |
| 655 | nmdc:mga03683_33244_c1 | 3300050489 | Bacteria | 2079 |
| 656 | nmdc:mga03n38_2428_c1 | 3300050490 | Bacteria | 5755 |
| 657 | nmdc:mga0yw44_3749_c1 | 3300050492 | Bacteria | 6809 |
| 658 | nmdc:mga0k408_10242_c1 | 3300050493 | Bacteria | 5068 |
| 659 | nmdc:mga0k408_1156_c1 | 3300050493 | Bacteria | 14438 |
| 660 | nmdc:mga0k408_117328_c1 | 3300050493 | Bacteria | 1575 |
| 661 | nmdc:mga0k408_14208_c1 | 3300050493 | Bacteria | 4383 |
| 662 | nmdc:mga0k408_142255_c1 | 3300050493 | Bacteria | 1427 |
| 663 | nmdc:mga0k408_153858_c1 | 3300050493 | Bacteria | 1370 |
| 664 | nmdc:mga0k408_20310_c1 | 3300050493 | Bacteria | 3720 |
| 665 | nmdc:mga0k408_287_c1 | 3300050493 | Bacteria | 27526 |
| 666 | nmdc:mga0k408_3129_c1 | 3300050493 | Bacteria | 8767 |
| 667 | nmdc:mga0k408_4278_c1 | 3300050493 | Bacteria | 7582 |
| 668 | nmdc:mga0k408_92091_c1 | 3300050493 | Bacteria | 1782 |
| 669 | nmdc:mga06z11_10413_c1 | 3300050494 | Bacteria | 3962 |
| 670 | nmdc:mga06z11_23826_c1 | 3300050494 | Bacteria | 2881 |
| 671 | nmdc:mga06z11_40191_c1 | 3300050494 | Bacteria | 2333 |
| 672 | nmdc:mga07m45_12296_c1 | 3300050496 | Bacteria | 4521 |
| 673 | nmdc:mga07m45_140193_c1 | 3300050496 | Bacteria | 1400 |
| 674 | nmdc:mga07m45_147389_c1 | 3300050496 | Bacteria | 1364 |
| 675 | nmdc:mga07m45_15059_c1 | 3300050496 | Bacteria | 4130 |
| 676 | nmdc:mga07m45_38077_c1 | 3300050496 | Bacteria | 2683 |
| 677 | nmdc:mga07m45_49137_c1 | 3300050496 | Bacteria | 2374 |
| 678 | nmdc:mga07m45_50364_c1 | 3300050496 | Bacteria | 2347 |
| 679 | nmdc:mga07m45_81176_c1 | 3300050496 | Bacteria | 1852 |
| 680 | nmdc:mga07m45_824_c1 | 3300050496 | Bacteria | 13393 |
| 681 | nmdc:mga05p37_88196_c1 | 3300050507 | Bacteria | 3824 |
| 682 | nmdc:mga0sz30_1941_c1 | 3300050516 | Bacteria | 7388 |
| 683 | Ga0500578_0096754 | 3300053086 | Bacteria | 1871 |
| 684 | Ga0500647_0104864 | 3300053091 | Bacteria | 1348 |
| 685 | Ga0500562_000199 | 3300053108 | Bacteria | 16293 |
| 686 | Ga0500595_005191 | 3300053119 | Bacteria | 5713 |
| 687 | Ga0500559_0000019 | 3300053136 | Bacteria | 134862 |
| 688 | Ga0500568_0001428 | 3300053139 | Bacteria | 15495 |
| 689 | Ga0500568_0002988 | 3300053139 | Bacteria | 9674 |
| 690 | Ga0500588_0004285 | 3300053146 | Bacteria | 3079 |
| 691 | Ga0500590_001769 | 3300053148 | Bacteria | 9106 |
| 692 | Ga0500619_000171 | 3300053154 | Bacteria | 15684 |
| 693 | Ga0500645_001960 | 3300053730 | Bacteria | 9727 |
| 694 | Ga0500587_000346 | 3300053739 | Bacteria | 5273 |
| 695 | Ga0501082_0061699 | 3300060353 | Bacteria | 3227 |
| 696 | Ga0466962_0107277 | 3300061719 | Bacteria | 1343 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_100094316 | Ga0075434_1000943162 | 271 |
| 2 | 3300049574 | Ga0501038_0133203 | Ga0501038_0133203_24_884 | 272 |
| 3 | 3300005335 | Ga0070666_10000496 | Ga0070666_1000049617 | 277 |
| 4 | 3300005355 | Ga0070671_100009932 | Ga0070671_1000099325 | 277 |
| 5 | 3300005367 | Ga0070667_100006624 | Ga0070667_1000066244 | 277 |
| 6 | 3300005437 | Ga0070710_10020518 | Ga0070710_100205182 | 277 |
| 7 | 3300005439 | Ga0070711_100002891 | Ga0070711_1000028914 | 277 |
| 8 | 3300005440 | Ga0070705_100030059 | Ga0070705_1000300592 | 277 |
| 9 | 3300005456 | Ga0070678_100000952 | Ga0070678_10000095213 | 277 |
| 10 | 3300005459 | Ga0068867_100080690 | Ga0068867_1000806902 | 277 |
| 11 | 3300035121 | Ga0373960_0003560 | Ga0373960_0003560_903_1868 | 277 |
| 12 | 3300048915 | Ga0496112_0104845 | Ga0496112_0104845_1280_2245 | 277 |
| 13 | 3300050493 | nmdc:mga0k408_92091_c1 | nmdc:mga0k408_92091_c1_24_878 | 278 |
| 14 | 3300039437 | Ga0436365_0379537 | Ga0436365_0379537_368_1246 | 282 |
| 15 | 3300039437 | Ga0436365_0919918 | Ga0436365_0919918_3196_4074 | 282 |
| 16 | 3300039453 | Ga0436362_0319271 | Ga0436362_0319271_287_1165 | 282 |
| 17 | 3300005355 | Ga0070671_100029988 | Ga0070671_1000299883 | 286 |
| 18 | 3300005616 | Ga0068852_100054883 | Ga0068852_1000548832 | 286 |
| 19 | 3300025931 | Ga0207644_10031742 | Ga0207644_100317423 | 286 |
| 20 | 3300026121 | Ga0207683_10149637 | Ga0207683_101496372 | 286 |
| 21 | 3300005339 | Ga0070660_100000909 | Ga0070660_1000009098 | 290 |
| 22 | 3300013100 | Ga0157373_10087172 | Ga0157373_100871722 | 290 |
| 23 | 3300013104 | Ga0157370_10144917 | Ga0157370_101449172 | 290 |
| 24 | 3300013307 | Ga0157372_10122021 | Ga0157372_101220213 | 290 |
| 25 | 3300031250 | Ga0265331_10000006 | Ga0265331_1000000642 | 290 |
| 26 | 3300031250 | Ga0265331_10001400 | Ga0265331_1000140015 | 290 |
| 27 | 3300031711 | Ga0265314_10006970 | Ga0265314_1000697010 | 290 |
| 28 | 3300041509 | Ga0451843_0341877 | Ga0451843_0341877_619_1512 | 290 |
| 29 | 3300049568 | Ga0501031_0054300 | Ga0501031_0054300_416_1324 | 290 |
| 30 | 3300049568 | Ga0501031_0159857 | Ga0501031_0159857_26_940 | 290 |
| 31 | 3300049570 | Ga0501033_0006575 | Ga0501033_0006575_1264_2172 | 290 |
| 32 | 3300049571 | Ga0501034_0029742 | Ga0501034_0029742_333_1241 | 290 |
| 33 | 3300049572 | Ga0501036_0369029 | Ga0501036_0369029_153_1061 | 290 |
| 34 | 3300049573 | Ga0501037_0312492 | Ga0501037_0312492_63_971 | 290 |
| 35 | 3300049581 | Ga0501047_0031526 | Ga0501047_0031526_2149_3057 | 290 |
| 36 | 3300049744 | Ga0501083_0137717 | Ga0501083_0137717_374_1282 | 290 |
| 37 | 3300049822 | Ga0501035_0156257 | Ga0501035_0156257_134_1048 | 290 |
| 38 | 3300049822 | Ga0501035_0386710 | Ga0501035_0386710_192_1106 | 290 |
| 39 | 3300049823 | Ga0501044_0038851 | Ga0501044_0038851_1620_2534 | 290 |
| 40 | 3300050489 | nmdc:mga03683_177594_c1 | nmdc:mga03683_177594_c1_58_960 | 290 |
| 41 | 3300060353 | Ga0501082_0061699 | Ga0501082_0061699_1909_2817 | 290 |
| 42 | 3300005548 | Ga0070665_100016149 | Ga0070665_1000161495 | 291 |
| 43 | 3300005614 | Ga0068856_100023461 | Ga0068856_1000234614 | 291 |
| 44 | 3300005718 | Ga0068866_10007547 | Ga0068866_100075474 | 291 |
| 45 | 3300005841 | Ga0068863_100006983 | Ga0068863_10000698310 | 291 |
| 46 | 3300005842 | Ga0068858_100002641 | Ga0068858_10000264114 | 291 |
| 47 | 3300006163 | Ga0070715_10000669 | Ga0070715_100006694 | 291 |
| 48 | 3300006173 | Ga0070716_100001421 | Ga0070716_1000014216 | 291 |
| 49 | 3300006175 | Ga0070712_100000683 | Ga0070712_1000006837 | 291 |
| 50 | 3300006237 | Ga0097621_100009247 | Ga0097621_1000092473 | 291 |
| 51 | 3300006358 | Ga0068871_100190535 | Ga0068871_1001905352 | 291 |
| 52 | 3300009098 | Ga0105245_10005446 | Ga0105245_1000544610 | 291 |
| 53 | 3300009101 | Ga0105247_10008379 | Ga0105247_100083797 | 291 |
| 54 | 3300009176 | Ga0105242_10000422 | Ga0105242_1000042214 | 291 |
| 55 | 3300009177 | Ga0105248_10008369 | Ga0105248_100083696 | 291 |
| 56 | 3300009545 | Ga0105237_10058014 | Ga0105237_100580143 | 291 |
| 57 | 3300010375 | Ga0105239_10008715 | Ga0105239_100087156 | 291 |
| 58 | 3300013296 | Ga0157374_10001660 | Ga0157374_1000166016 | 291 |
| 59 | 3300013297 | Ga0157378_10002030 | Ga0157378_1000203014 | 291 |
| 60 | 3300013306 | Ga0163162_10009296 | Ga0163162_100092968 | 291 |
| 61 | 3300013307 | Ga0157372_10038836 | Ga0157372_100388363 | 291 |
| 62 | 3300013307 | Ga0157372_10217093 | Ga0157372_102170932 | 291 |
| 63 | 3300013308 | Ga0157375_10037041 | Ga0157375_100370415 | 291 |
| 64 | 3300014325 | Ga0163163_10162706 | Ga0163163_101627062 | 291 |
| 65 | 3300014968 | Ga0157379_10050000 | Ga0157379_100500005 | 291 |
| 66 | 3300025898 | Ga0207692_10003475 | Ga0207692_100034754 | 291 |
| 67 | 3300025903 | Ga0207680_10039968 | Ga0207680_100399682 | 291 |
| 68 | 3300025905 | Ga0207685_10003015 | Ga0207685_100030155 | 291 |
| 69 | 3300025915 | Ga0207693_10000226 | Ga0207693_1000022639 | 291 |
| 70 | 3300025916 | Ga0207663_10039520 | Ga0207663_100395203 | 291 |
| 71 | 3300025927 | Ga0207687_10038820 | Ga0207687_100388203 | 291 |
| 72 | 3300025931 | Ga0207644_10174053 | Ga0207644_101740532 | 291 |
| 73 | 3300025939 | Ga0207665_10002356 | Ga0207665_100023567 | 291 |
| 74 | 3300025941 | Ga0207711_10067265 | Ga0207711_100672652 | 291 |
| 75 | 3300025986 | Ga0207658_10032571 | Ga0207658_100325714 | 291 |
| 76 | 3300026023 | Ga0207677_10196687 | Ga0207677_101966872 | 291 |
| 77 | 3300026035 | Ga0207703_10040071 | Ga0207703_100400712 | 291 |
| 78 | 3300026078 | Ga0207702_10024931 | Ga0207702_100249313 | 291 |
| 79 | 3300026088 | Ga0207641_10185668 | Ga0207641_101856682 | 291 |
| 80 | 3300026089 | Ga0207648_10135496 | Ga0207648_101354962 | 291 |
| 81 | 3300026121 | Ga0207683_10001388 | Ga0207683_1000138813 | 291 |
| 82 | 3300028381 | Ga0268264_10099709 | Ga0268264_100997092 | 291 |
| 83 | 3300039437 | Ga0436365_0798167 | Ga0436365_0798167_69687_70598 | 291 |
| 84 | 3300048903 | Ga0496100_0005821 | Ga0496100_0005821_1428_2393 | 291 |
| 85 | 3300048904 | Ga0496101_0011587 | Ga0496101_0011587_734_1699 | 291 |
| 86 | 3300048905 | Ga0496102_0094074 | Ga0496102_0094074_1547_2512 | 291 |
| 87 | 3300048906 | Ga0496103_0031670 | Ga0496103_0031670_250_1215 | 291 |
| 88 | 3300048907 | Ga0496104_0097609 | Ga0496104_0097609_875_1840 | 291 |
| 89 | 3300048909 | Ga0496106_0016627 | Ga0496106_0016627_1297_2262 | 291 |
| 90 | 3300048910 | Ga0496107_0011507 | Ga0496107_0011507_597_1562 | 291 |
| 91 | 3300048911 | Ga0496108_0019013 | Ga0496108_0019013_4398_5363 | 291 |
| 92 | 3300048912 | Ga0496109_0013606 | Ga0496109_0013606_5284_6249 | 291 |
| 93 | 3300048913 | Ga0496110_0011389 | Ga0496110_0011389_4407_5372 | 291 |
| 94 | 3300048914 | Ga0496111_0009868 | Ga0496111_0009868_4011_4976 | 291 |
| 95 | 3300048915 | Ga0496112_0017102 | Ga0496112_0017102_4398_5363 | 291 |
| 96 | 3300048916 | Ga0496113_0044655 | Ga0496113_0044655_826_1791 | 291 |
| 97 | 3300048917 | Ga0496114_0003309 | Ga0496114_0003309_6091_7056 | 291 |
| 98 | 3300048918 | Ga0496115_0004612 | Ga0496115_0004612_4084_5049 | 291 |
| 99 | 3300005353 | Ga0070669_100107174 | Ga0070669_1001071742 | 293 |
| 100 | 3300005434 | Ga0070709_10025522 | Ga0070709_100255222 | 293 |
| 101 | 3300005518 | Ga0070699_100292090 | Ga0070699_1002920901 | 293 |
| 102 | 3300005545 | Ga0070695_100001403 | Ga0070695_1000014039 | 293 |
| 103 | 3300025906 | Ga0207699_10013467 | Ga0207699_100134673 | 293 |
| 104 | 3300009177 | Ga0105248_10191942 | Ga0105248_101919422 | 296 |
| 105 | 3300025903 | Ga0207680_10167364 | Ga0207680_101673642 | 296 |
| 106 | 3300006353 | Ga0075370_10009182 | Ga0075370_100091823 | 297 |
| 107 | 3300005458 | Ga0070681_10216574 | Ga0070681_102165742 | 298 |
| 108 | 3300005563 | Ga0068855_100011163 | Ga0068855_1000111632 | 298 |
| 109 | 3300009551 | Ga0105238_10008443 | Ga0105238_100084436 | 298 |
| 110 | 3300025909 | Ga0207705_10000461 | Ga0207705_1000046110 | 298 |
| 111 | 3300025912 | Ga0207707_10001730 | Ga0207707_100017302 | 298 |
| 112 | 3300025912 | Ga0207707_10174919 | Ga0207707_101749192 | 298 |
| 113 | 3300025919 | Ga0207657_10002447 | Ga0207657_1000244716 | 298 |
| 114 | 3300025921 | Ga0207652_10002306 | Ga0207652_100023063 | 298 |
| 115 | 3300025921 | Ga0207652_10109191 | Ga0207652_101091912 | 298 |
| 116 | 3300025924 | Ga0207694_10008832 | Ga0207694_100088322 | 298 |
| 117 | 3300025949 | Ga0207667_10009716 | Ga0207667_100097165 | 298 |
| 118 | 3300026067 | Ga0207678_10173876 | Ga0207678_101738763 | 298 |
| 119 | 3300028800 | Ga0265338_10027921 | Ga0265338_100279217 | 298 |
| 120 | 3300006881 | Ga0068865_100331961 | Ga0068865_1003319611 | 299 |
| 121 | 3300031247 | Ga0265340_10000215 | Ga0265340_100002154 | 299 |
| 122 | 3300031251 | Ga0265327_10000074 | Ga0265327_10000074182 | 299 |
| 123 | 3300005344 | Ga0070661_100000636 | Ga0070661_10000063613 | 300 |
| 124 | 3300009093 | Ga0105240_10194801 | Ga0105240_101948012 | 300 |
| 125 | 3300013104 | Ga0157370_10174765 | Ga0157370_101747652 | 300 |
| 126 | 3300017792 | Ga0163161_10136534 | Ga0163161_101365341 | 300 |
| 127 | 3300025920 | Ga0207649_10000085 | Ga0207649_1000008512 | 300 |
| 128 | 3300026121 | Ga0207683_10415163 | Ga0207683_104151631 | 300 |
| 129 | 3300035088 | Ga0373940_0008318 | Ga0373940_0008318_1010_2014 | 300 |
| 130 | 3300035114 | Ga0373939_0000040 | Ga0373939_0000040_31358_32362 | 300 |
| 131 | 3300035691 | Ga0373931_0000637 | Ga0373931_0000637_4760_5764 | 300 |
| 132 | 3300049579 | Ga0501043_0071116 | Ga0501043_0071116_191_1147 | 300 |
| 133 | 3300049580 | Ga0501046_0030351 | Ga0501046_0030351_2479_3441 | 300 |
| 134 | 3300049742 | Ga0501080_0370509 | Ga0501080_0370509_132_1088 | 300 |
| 135 | 3300005336 | Ga0070680_100024697 | Ga0070680_1000246972 | 301 |
| 136 | 3300005366 | Ga0070659_100039647 | Ga0070659_1000396472 | 301 |
| 137 | 3300005530 | Ga0070679_100037901 | Ga0070679_1000379013 | 301 |
| 138 | 3300006358 | Ga0068871_100072915 | Ga0068871_1000729152 | 301 |
| 139 | 3300006358 | Ga0068871_100126957 | Ga0068871_1001269572 | 301 |
| 140 | 3300013105 | Ga0157369_10014701 | Ga0157369_100147015 | 301 |
| 141 | 3300013307 | Ga0157372_10011061 | Ga0157372_100110612 | 301 |
| 142 | 3300021384 | Ga0213876_10008872 | Ga0213876_100088724 | 301 |
| 143 | 3300026116 | Ga0207674_10211001 | Ga0207674_102110012 | 301 |
| 144 | 3300045976 | Ga0466967_0506172 | Ga0466967_0506172_13_987 | 301 |
| 145 | 3300032005 | Ga0307411_10001682 | Ga0307411_100016828 | 302 |
| 146 | 3300049665 | Ga0501227_006790 | Ga0501227_006790_1012_2088 | 302 |
| 147 | 3300049669 | Ga0501235_019206 | Ga0501235_019206_31_1053 | 302 |
| 148 | 3300049704 | Ga0501221_007083 | Ga0501221_007083_814_1821 | 302 |
| 149 | 3300049706 | Ga0501229_000069 | Ga0501229_000069_9203_10210 | 302 |
| 150 | 3300021384 | Ga0213876_10014753 | Ga0213876_100147532 | 303 |
| 151 | 3300039437 | Ga0436365_0282050 | Ga0436365_0282050_5433_6443 | 303 |
| 152 | 3300044656 | Ga0466969_0000169 | Ga0466969_0000169_3825_4901 | 304 |
| 153 | 3300005327 | Ga0070658_10152954 | Ga0070658_101529542 | 305 |
| 154 | 3300005331 | Ga0070670_100298270 | Ga0070670_1002982701 | 305 |
| 155 | 3300005455 | Ga0070663_100062911 | Ga0070663_1000629112 | 305 |
| 156 | 3300005616 | Ga0068852_100182111 | Ga0068852_1001821112 | 305 |
| 157 | 3300006358 | Ga0068871_100056504 | Ga0068871_1000565042 | 305 |
| 158 | 3300025940 | Ga0207691_10324767 | Ga0207691_103247671 | 305 |
| 159 | 3300026121 | Ga0207683_10119563 | Ga0207683_101195631 | 305 |
| 160 | 3300005618 | Ga0068864_100228734 | Ga0068864_1002287342 | 306 |
| 161 | 3300026095 | Ga0207676_10155154 | Ga0207676_101551542 | 306 |
| 162 | 3300005436 | Ga0070713_100152036 | Ga0070713_1001520362 | 307 |
| 163 | 3300026116 | Ga0207674_10020989 | Ga0207674_100209893 | 307 |
| 164 | 3300050493 | nmdc:mga0k408_117328_c1 | nmdc:mga0k408_117328_c1_405_1418 | 307 |
| 165 | 3300050496 | nmdc:mga07m45_824_c1 | nmdc:mga07m45_824_c1_6626_7639 | 307 |
| 166 | 3300014326 | Ga0157380_10230760 | Ga0157380_102307602 | 308 |
| 167 | 3300031548 | Ga0307408_100080895 | Ga0307408_1000808952 | 308 |
| 168 | 3300031731 | Ga0307405_10026574 | Ga0307405_100265742 | 308 |
| 169 | 3300031995 | Ga0307409_100000580 | Ga0307409_10000058017 | 308 |
| 170 | 3300032002 | Ga0307416_100003986 | Ga0307416_1000039867 | 308 |
| 171 | 3300032126 | Ga0307415_100057645 | Ga0307415_1000576452 | 308 |
| 172 | 3300005331 | Ga0070670_100001787 | Ga0070670_10000178710 | 309 |
| 173 | 3300005367 | Ga0070667_100165418 | Ga0070667_1001654182 | 309 |
| 174 | 3300005456 | Ga0070678_100027929 | Ga0070678_1000279293 | 309 |
| 175 | 3300005618 | Ga0068864_100013594 | Ga0068864_10001359411 | 309 |
| 176 | 3300006358 | Ga0068871_100078626 | Ga0068871_1000786262 | 309 |
| 177 | 3300009551 | Ga0105238_10022383 | Ga0105238_100223833 | 309 |
| 178 | 3300014968 | Ga0157379_10078692 | Ga0157379_100786923 | 309 |
| 179 | 3300025926 | Ga0207659_10066937 | Ga0207659_100669372 | 309 |
| 180 | 3300025940 | Ga0207691_10004404 | Ga0207691_100044045 | 309 |
| 181 | 3300026088 | Ga0207641_10044397 | Ga0207641_100443972 | 309 |
| 182 | 3300044901 | Ga0466960_0116224 | Ga0466960_0116224_62_1069 | 309 |
| 183 | 3300053091 | Ga0500647_0104864 | Ga0500647_0104864_359_1321 | 309 |
| 184 | 3300053146 | Ga0500588_0004285 | Ga0500588_0004285_1015_1980 | 309 |
| 185 | 3300005467 | Ga0070706_100000463 | Ga0070706_10000046317 | 310 |
| 186 | 3300005468 | Ga0070707_100030724 | Ga0070707_1000307245 | 310 |
| 187 | 3300005843 | Ga0068860_100044975 | Ga0068860_1000449753 | 310 |
| 188 | 3300025910 | Ga0207684_10003939 | Ga0207684_100039397 | 310 |
| 189 | 3300025922 | Ga0207646_10321392 | Ga0207646_103213922 | 310 |
| 190 | 3300005844 | Ga0068862_100226709 | Ga0068862_1002267092 | 311 |
| 191 | 3300009553 | Ga0105249_10032646 | Ga0105249_100326464 | 311 |
| 192 | 3300025315 | Ga0207697_10087719 | Ga0207697_100877192 | 311 |
| 193 | 3300005328 | Ga0070676_10058888 | Ga0070676_100588882 | 312 |
| 194 | 3300005330 | Ga0070690_100010106 | Ga0070690_1000101064 | 312 |
| 195 | 3300005331 | Ga0070670_100265957 | Ga0070670_1002659571 | 312 |
| 196 | 3300005333 | Ga0070677_10031921 | Ga0070677_100319211 | 312 |
| 197 | 3300005334 | Ga0068869_100124510 | Ga0068869_1001245102 | 312 |
| 198 | 3300005347 | Ga0070668_100133068 | Ga0070668_1001330682 | 312 |
| 199 | 3300005353 | Ga0070669_100254068 | Ga0070669_1002540681 | 312 |
| 200 | 3300005355 | Ga0070671_100002643 | Ga0070671_1000026435 | 312 |
| 201 | 3300005355 | Ga0070671_100295238 | Ga0070671_1002952381 | 312 |
| 202 | 3300005356 | Ga0070674_100025270 | Ga0070674_1000252702 | 312 |
| 203 | 3300005366 | Ga0070659_100168563 | Ga0070659_1001685631 | 312 |
| 204 | 3300005457 | Ga0070662_100044407 | Ga0070662_1000444072 | 312 |
| 205 | 3300005457 | Ga0070662_100179155 | Ga0070662_1001791552 | 312 |
| 206 | 3300005458 | Ga0070681_10009885 | Ga0070681_1000988511 | 312 |
| 207 | 3300005459 | Ga0068867_100025230 | Ga0068867_1000252302 | 312 |
| 208 | 3300005543 | Ga0070672_100030950 | Ga0070672_1000309502 | 312 |
| 209 | 3300005616 | Ga0068852_100044322 | Ga0068852_1000443222 | 312 |
| 210 | 3300005617 | Ga0068859_100061938 | Ga0068859_1000619382 | 312 |
| 211 | 3300005618 | Ga0068864_100094268 | Ga0068864_1000942682 | 312 |
| 212 | 3300005718 | Ga0068866_10020078 | Ga0068866_100200782 | 312 |
| 213 | 3300005719 | Ga0068861_100157022 | Ga0068861_1001570222 | 312 |
| 214 | 3300005841 | Ga0068863_100134799 | Ga0068863_1001347992 | 312 |
| 215 | 3300005841 | Ga0068863_100328099 | Ga0068863_1003280992 | 312 |
| 216 | 3300005842 | Ga0068858_100180458 | Ga0068858_1001804582 | 312 |
| 217 | 3300005843 | Ga0068860_100089174 | Ga0068860_1000891742 | 312 |
| 218 | 3300006042 | Ga0075368_10036251 | Ga0075368_100362512 | 312 |
| 219 | 3300006237 | Ga0097621_100004475 | Ga0097621_10000447514 | 312 |
| 220 | 3300006881 | Ga0068865_100012354 | Ga0068865_1000123544 | 312 |
| 221 | 3300006931 | Ga0097620_100061943 | Ga0097620_1000619432 | 312 |
| 222 | 3300009177 | Ga0105248_10005804 | Ga0105248_1000580415 | 312 |
| 223 | 3300013308 | Ga0157375_10130491 | Ga0157375_101304912 | 312 |
| 224 | 3300017792 | Ga0163161_10013100 | Ga0163161_100131005 | 312 |
| 225 | 3300017792 | Ga0163161_10023850 | Ga0163161_100238504 | 312 |
| 226 | 3300025893 | Ga0207682_10095697 | Ga0207682_100956972 | 312 |
| 227 | 3300025899 | Ga0207642_10035995 | Ga0207642_100359952 | 312 |
| 228 | 3300025907 | Ga0207645_10017792 | Ga0207645_100177922 | 312 |
| 229 | 3300025912 | Ga0207707_10002994 | Ga0207707_100029942 | 312 |
| 230 | 3300025923 | Ga0207681_10000424 | Ga0207681_100004242 | 312 |
| 231 | 3300025925 | Ga0207650_10200209 | Ga0207650_102002092 | 312 |
| 232 | 3300025931 | Ga0207644_10000264 | Ga0207644_1000026415 | 312 |
| 233 | 3300025931 | Ga0207644_10267767 | Ga0207644_102677671 | 312 |
| 234 | 3300025933 | Ga0207706_10028272 | Ga0207706_100282723 | 312 |
| 235 | 3300025933 | Ga0207706_10041510 | Ga0207706_100415102 | 312 |
| 236 | 3300025935 | Ga0207709_10021219 | Ga0207709_100212192 | 312 |
| 237 | 3300025937 | Ga0207669_10096535 | Ga0207669_100965352 | 312 |
| 238 | 3300025938 | Ga0207704_10037630 | Ga0207704_100376302 | 312 |
| 239 | 3300025940 | Ga0207691_10055607 | Ga0207691_100556072 | 312 |
| 240 | 3300025941 | Ga0207711_10003550 | Ga0207711_1000355015 | 312 |
| 241 | 3300025942 | Ga0207689_10071441 | Ga0207689_100714412 | 312 |
| 242 | 3300025972 | Ga0207668_10046854 | Ga0207668_100468543 | 312 |
| 243 | 3300025986 | Ga0207658_10004072 | Ga0207658_100040724 | 312 |
| 244 | 3300025986 | Ga0207658_10029010 | Ga0207658_100290102 | 312 |
| 245 | 3300026035 | Ga0207703_10001816 | Ga0207703_100018162 | 312 |
| 246 | 3300026088 | Ga0207641_10028126 | Ga0207641_100281262 | 312 |
| 247 | 3300026088 | Ga0207641_10044236 | Ga0207641_100442364 | 312 |
| 248 | 3300026089 | Ga0207648_10027230 | Ga0207648_100272302 | 312 |
| 249 | 3300026095 | Ga0207676_10047568 | Ga0207676_100475682 | 312 |
| 250 | 3300026118 | Ga0207675_100080158 | Ga0207675_1000801583 | 312 |
| 251 | 3300026142 | Ga0207698_10046930 | Ga0207698_100469303 | 312 |
| 252 | 3300028381 | Ga0268264_10001082 | Ga0268264_100010822 | 312 |
| 253 | 3300006881 | Ga0068865_100050149 | Ga0068865_1000501492 | 313 |
| 254 | 3300025938 | Ga0207704_10038038 | Ga0207704_100380382 | 313 |
| 255 | 3300049649 | Ga0501198_000012 | Ga0501198_000012_89229_90272 | 313 |
| 256 | 3300049662 | Ga0501222_000010 | Ga0501222_000010_89235_90278 | 313 |
| 257 | 3300005328 | Ga0070676_10089154 | Ga0070676_100891542 | 314 |
| 258 | 3300005331 | Ga0070670_100024831 | Ga0070670_1000248317 | 314 |
| 259 | 3300005333 | Ga0070677_10031652 | Ga0070677_100316522 | 314 |
| 260 | 3300005353 | Ga0070669_100045050 | Ga0070669_1000450502 | 314 |
| 261 | 3300005364 | Ga0070673_100119932 | Ga0070673_1001199322 | 314 |
| 262 | 3300005367 | Ga0070667_100292652 | Ga0070667_1002926522 | 314 |
| 263 | 3300005543 | Ga0070672_100013536 | Ga0070672_1000135362 | 314 |
| 264 | 3300005617 | Ga0068859_100117044 | Ga0068859_1001170442 | 314 |
| 265 | 3300005719 | Ga0068861_100002250 | Ga0068861_1000022503 | 314 |
| 266 | 3300005843 | Ga0068860_100000823 | Ga0068860_10000082328 | 314 |
| 267 | 3300005844 | Ga0068862_100050504 | Ga0068862_1000505042 | 314 |
| 268 | 3300006881 | Ga0068865_100007445 | Ga0068865_1000074455 | 314 |
| 269 | 3300006931 | Ga0097620_100117044 | Ga0097620_1001170442 | 314 |
| 270 | 3300011119 | Ga0105246_10259916 | Ga0105246_102599162 | 314 |
| 271 | 3300013297 | Ga0157378_10001703 | Ga0157378_1000170311 | 314 |
| 272 | 3300013308 | Ga0157375_10048027 | Ga0157375_100480272 | 314 |
| 273 | 3300025907 | Ga0207645_10009608 | Ga0207645_100096083 | 314 |
| 274 | 3300025923 | Ga0207681_10109204 | Ga0207681_101092041 | 314 |
| 275 | 3300025925 | Ga0207650_10010685 | Ga0207650_100106852 | 314 |
| 276 | 3300025926 | Ga0207659_10031709 | Ga0207659_100317092 | 314 |
| 277 | 3300025933 | Ga0207706_10048763 | Ga0207706_100487632 | 314 |
| 278 | 3300025938 | Ga0207704_10003695 | Ga0207704_100036955 | 314 |
| 279 | 3300025940 | Ga0207691_10056181 | Ga0207691_100561812 | 314 |
| 280 | 3300025940 | Ga0207691_10092669 | Ga0207691_100926692 | 314 |
| 281 | 3300025960 | Ga0207651_10035009 | Ga0207651_100350092 | 314 |
| 282 | 3300025960 | Ga0207651_10098284 | Ga0207651_100982842 | 314 |
| 283 | 3300025972 | Ga0207668_10065442 | Ga0207668_100654422 | 314 |
| 284 | 3300026089 | Ga0207648_10000179 | Ga0207648_1000017946 | 314 |
| 285 | 3300026118 | Ga0207675_100002243 | Ga0207675_10000224318 | 314 |
| 286 | 3300026142 | Ga0207698_10273476 | Ga0207698_102734762 | 314 |
| 287 | 3300028380 | Ga0268265_10023957 | Ga0268265_100239572 | 314 |
| 288 | 3300028381 | Ga0268264_10000613 | Ga0268264_1000061323 | 314 |
| 289 | 3300050493 | nmdc:mga0k408_142255_c1 | nmdc:mga0k408_142255_c1_264_1295 | 314 |
| 290 | 3300005329 | Ga0070683_100093359 | Ga0070683_1000933592 | 315 |
| 291 | 3300005548 | Ga0070665_100090124 | Ga0070665_1000901242 | 315 |
| 292 | 3300005563 | Ga0068855_100247241 | Ga0068855_1002472412 | 315 |
| 293 | 3300025913 | Ga0207695_10311458 | Ga0207695_103114582 | 315 |
| 294 | 3300025949 | Ga0207667_10199060 | Ga0207667_101990602 | 315 |
| 295 | 3300028379 | Ga0268266_10009191 | Ga0268266_100091916 | 315 |
| 296 | 3300031649 | Ga0307514_10005041 | Ga0307514_100050412 | 315 |
| 297 | 3300037418 | Ga0395900_0039620 | Ga0395900_0039620_143_1138 | 315 |
| 298 | 3300038443 | Ga0395901_0010183 | Ga0395901_0010183_3021_4016 | 315 |
| 299 | 3300046471 | Ga0495650_0011466 | Ga0495650_0011466_3466_4623 | 315 |
| 300 | 3300048911 | Ga0496108_0067003 | Ga0496108_0067003_1388_2461 | 315 |
| 301 | 3300048912 | Ga0496109_0387928 | Ga0496109_0387928_135_1199 | 315 |
| 302 | 3300049569 | Ga0501032_0000651 | Ga0501032_0000651_17090_18091 | 315 |
| 303 | 3300049571 | Ga0501034_0012898 | Ga0501034_0012898_381_1382 | 315 |
| 304 | 3300049574 | Ga0501038_0000021 | Ga0501038_0000021_57167_58168 | 315 |
| 305 | 3300049575 | Ga0501039_0000026 | Ga0501039_0000026_57151_58152 | 315 |
| 306 | 3300049579 | Ga0501043_0003753 | Ga0501043_0003753_4421_5422 | 315 |
| 307 | 3300049580 | Ga0501046_0230894 | Ga0501046_0230894_348_1349 | 315 |
| 308 | 3300049822 | Ga0501035_0001105 | Ga0501035_0001105_4308_5309 | 315 |
| 309 | 3300053119 | Ga0500595_005191 | Ga0500595_005191_3234_4214 | 315 |
| 310 | 3300005844 | Ga0068862_100175150 | Ga0068862_1001751502 | 316 |
| 311 | 3300021361 | Ga0213872_10039667 | Ga0213872_100396672 | 316 |
| 312 | 3300021361 | Ga0213872_10050960 | Ga0213872_100509602 | 316 |
| 313 | 3300025913 | Ga0207695_10221476 | Ga0207695_102214762 | 316 |
| 314 | 3300031911 | Ga0307412_10155129 | Ga0307412_101551292 | 316 |
| 315 | 3300032002 | Ga0307416_100112413 | Ga0307416_1001124132 | 316 |
| 316 | 3300037312 | Ga0395899_0129381 | Ga0395899_0129381_374_1360 | 316 |
| 317 | 3300039438 | Ga0436360_0603279 | Ga0436360_0603279_8671_9669 | 316 |
| 318 | 3300039447 | Ga0436361_0402753 | Ga0436361_0402753_3362_4360 | 316 |
| 319 | 3300039447 | Ga0436361_1069868 | Ga0436361_1069868_223_1221 | 316 |
| 320 | 3300039447 | Ga0436361_1199473 | Ga0436361_1199473_1277_2281 | 316 |
| 321 | 3300049588 | Ga0501072_0194403 | Ga0501072_0194403_279_1277 | 316 |
| 322 | 3300006195 | Ga0075366_10001610 | Ga0075366_100016106 | 317 |
| 323 | 3300006353 | Ga0075370_10009019 | Ga0075370_100090194 | 317 |
| 324 | 3300014968 | Ga0157379_10235467 | Ga0157379_102354672 | 317 |
| 325 | 3300025914 | Ga0207671_10149745 | Ga0207671_101497452 | 317 |
| 326 | 3300025924 | Ga0207694_10003938 | Ga0207694_100039386 | 317 |
| 327 | 3300026118 | Ga0207675_100176154 | Ga0207675_1001761542 | 317 |
| 328 | 3300036401 | Ga0373937_0074519 | Ga0373937_0074519_454_1491 | 317 |
| 329 | 3300037466 | Ga0395898_0248639 | Ga0395898_0248639_633_1676 | 317 |
| 330 | 3300050493 | nmdc:mga0k408_14208_c1 | nmdc:mga0k408_14208_c1_1834_2838 | 317 |
| 331 | 3300053108 | Ga0500562_000199 | Ga0500562_000199_191_1210 | 317 |
| 332 | 3300014968 | Ga0157379_10145427 | Ga0157379_101454272 | 318 |
| 333 | 3300031548 | Ga0307408_100000109 | Ga0307408_10000010934 | 318 |
| 334 | 3300053139 | Ga0500568_0001428 | Ga0500568_0001428_1388_2398 | 318 |
| 335 | 3300005331 | Ga0070670_100122898 | Ga0070670_1001228982 | 319 |
| 336 | 3300005354 | Ga0070675_100062018 | Ga0070675_1000620182 | 319 |
| 337 | 3300005367 | Ga0070667_100008184 | Ga0070667_1000081843 | 319 |
| 338 | 3300005543 | Ga0070672_100008932 | Ga0070672_1000089323 | 319 |
| 339 | 3300005563 | Ga0068855_100008847 | Ga0068855_10000884714 | 319 |
| 340 | 3300006237 | Ga0097621_100044671 | Ga0097621_1000446712 | 319 |
| 341 | 3300013306 | Ga0163162_10002252 | Ga0163162_1000225220 | 319 |
| 342 | 3300013308 | Ga0157375_10015508 | Ga0157375_100155085 | 319 |
| 343 | 3300025925 | Ga0207650_10039118 | Ga0207650_100391182 | 319 |
| 344 | 3300025925 | Ga0207650_10062620 | Ga0207650_100626202 | 319 |
| 345 | 3300025949 | Ga0207667_10007788 | Ga0207667_100077883 | 319 |
| 346 | 3300026095 | Ga0207676_10002741 | Ga0207676_100027417 | 319 |
| 347 | 3300026121 | Ga0207683_10025374 | Ga0207683_100253743 | 319 |
| 348 | 3300035695 | Ga0373927_0106110 | Ga0373927_0106110_463_1464 | 319 |
| 349 | 3300037068 | Ga0373925_0080885 | Ga0373925_0080885_478_1479 | 319 |
| 350 | 3300037312 | Ga0395899_0029032 | Ga0395899_0029032_1639_2649 | 319 |
| 351 | 3300037418 | Ga0395900_0318423 | Ga0395900_0318423_135_1145 | 319 |
| 352 | 3300037466 | Ga0395898_0076400 | Ga0395898_0076400_794_1804 | 319 |
| 353 | 3300049592 | Ga0501076_0195730 | Ga0501076_0195730_534_1634 | 319 |
| 354 | 3300050494 | nmdc:mga06z11_40191_c1 | nmdc:mga06z11_40191_c1_1258_2310 | 319 |
| 355 | 3300050496 | nmdc:mga07m45_50364_c1 | nmdc:mga07m45_50364_c1_1257_2309 | 319 |
| 356 | iso_pu_bacteria | 2523231067 | 2523469167 | 319 |
| 357 | iso_pu_bacteria | 2738543031 | 2739347344 | 319 |
| 358 | 3300013104 | Ga0157370_10093444 | Ga0157370_100934442 | 320 |
| 359 | 3300050489 | nmdc:mga03683_33244_c1 | nmdc:mga03683_33244_c1_224_1237 | 320 |
| 360 | 3300009148 | Ga0105243_10025417 | Ga0105243_100254173 | 321 |
| 361 | 3300009176 | Ga0105242_10014535 | Ga0105242_100145352 | 321 |
| 362 | 3300025242 | Ga0209258_101087 | Ga0209258_10108713 | 321 |
| 363 | 3300025934 | Ga0207686_10008165 | Ga0207686_100081652 | 321 |
| 364 | 3300025937 | Ga0207669_10047443 | Ga0207669_100474432 | 321 |
| 365 | 3300031852 | Ga0307410_10066471 | Ga0307410_100664713 | 321 |
| 366 | 3300035695 | Ga0373927_0016224 | Ga0373927_0016224_232_1230 | 321 |
| 367 | 3300037068 | Ga0373925_0002526 | Ga0373925_0002526_2996_3994 | 321 |
| 368 | 3300005328 | Ga0070676_10011649 | Ga0070676_100116496 | 322 |
| 369 | 3300005333 | Ga0070677_10002828 | Ga0070677_100028282 | 322 |
| 370 | 3300005334 | Ga0068869_100030141 | Ga0068869_1000301412 | 322 |
| 371 | 3300005338 | Ga0068868_100003181 | Ga0068868_10000318110 | 322 |
| 372 | 3300005353 | Ga0070669_100002645 | Ga0070669_1000026453 | 322 |
| 373 | 3300005354 | Ga0070675_100005641 | Ga0070675_1000056419 | 322 |
| 374 | 3300005355 | Ga0070671_100009715 | Ga0070671_1000097155 | 322 |
| 375 | 3300005364 | Ga0070673_100040882 | Ga0070673_1000408822 | 322 |
| 376 | 3300005366 | Ga0070659_100028796 | Ga0070659_1000287964 | 322 |
| 377 | 3300005456 | Ga0070678_100013205 | Ga0070678_1000132051 | 322 |
| 378 | 3300005459 | Ga0068867_100001379 | Ga0068867_10000137910 | 322 |
| 379 | 3300005539 | Ga0068853_100021221 | Ga0068853_1000212212 | 322 |
| 380 | 3300005543 | Ga0070672_100000327 | Ga0070672_10000032724 | 322 |
| 381 | 3300005548 | Ga0070665_100118105 | Ga0070665_1001181053 | 322 |
| 382 | 3300005618 | Ga0068864_100030622 | Ga0068864_1000306222 | 322 |
| 383 | 3300006237 | Ga0097621_100052288 | Ga0097621_1000522882 | 322 |
| 384 | 3300006881 | Ga0068865_100054640 | Ga0068865_1000546402 | 322 |
| 385 | 3300009098 | Ga0105245_10394429 | Ga0105245_103944291 | 322 |
| 386 | 3300013306 | Ga0163162_10255314 | Ga0163162_102553142 | 322 |
| 387 | 3300014326 | Ga0157380_10158858 | Ga0157380_101588582 | 322 |
| 388 | 3300017792 | Ga0163161_10052922 | Ga0163161_100529222 | 322 |
| 389 | 3300025893 | Ga0207682_10005442 | Ga0207682_100054424 | 322 |
| 390 | 3300025908 | Ga0207643_10061809 | Ga0207643_100618092 | 322 |
| 391 | 3300025923 | Ga0207681_10004628 | Ga0207681_100046283 | 322 |
| 392 | 3300025925 | Ga0207650_10000149 | Ga0207650_1000014969 | 322 |
| 393 | 3300025926 | Ga0207659_10000394 | Ga0207659_100003949 | 322 |
| 394 | 3300025931 | Ga0207644_10017259 | Ga0207644_100172593 | 322 |
| 395 | 3300025937 | Ga0207669_10000874 | Ga0207669_1000087412 | 322 |
| 396 | 3300025938 | Ga0207704_10049925 | Ga0207704_100499252 | 322 |
| 397 | 3300025940 | Ga0207691_10001736 | Ga0207691_1000173618 | 322 |
| 398 | 3300025960 | Ga0207651_10003954 | Ga0207651_100039543 | 322 |
| 399 | 3300025981 | Ga0207640_10087385 | Ga0207640_100873852 | 322 |
| 400 | 3300026088 | Ga0207641_10123935 | Ga0207641_101239352 | 322 |
| 401 | 3300026089 | Ga0207648_10029524 | Ga0207648_100295242 | 322 |
| 402 | 3300026095 | Ga0207676_10085730 | Ga0207676_100857302 | 322 |
| 403 | 3300026116 | Ga0207674_10341074 | Ga0207674_103410742 | 322 |
| 404 | 3300026121 | Ga0207683_10102902 | Ga0207683_101029022 | 322 |
| 405 | 3300026121 | Ga0207683_10160625 | Ga0207683_101606252 | 322 |
| 406 | 3300026121 | Ga0207683_10260444 | Ga0207683_102604442 | 322 |
| 407 | 3300046543 | Ga0495645_0142984 | Ga0495645_0142984_324_1379 | 322 |
| 408 | 3300048907 | Ga0496104_0134910 | Ga0496104_0134910_535_1551 | 322 |
| 409 | iso_pu_bacteria | 2643221654 | 2644301375 | 322 |
| 410 | 3300006195 | Ga0075366_10002629 | Ga0075366_100026297 | 323 |
| 411 | 3300021361 | Ga0213872_10000113 | Ga0213872_1000011310 | 323 |
| 412 | 3300021361 | Ga0213872_10018226 | Ga0213872_100182261 | 323 |
| 413 | 3300039447 | Ga0436361_0287659 | Ga0436361_0287659_15524_16525 | 323 |
| 414 | 3300039447 | Ga0436361_1204227 | Ga0436361_1204227_66_1067 | 323 |
| 415 | 3300045051 | Ga0451576_0023117 | Ga0451576_0023117_1522_2508 | 323 |
| 416 | 3300050493 | nmdc:mga0k408_153858_c1 | nmdc:mga0k408_153858_c1_103_1185 | 323 |
| 417 | 3300005445 | Ga0070708_100106722 | Ga0070708_1001067222 | 324 |
| 418 | 3300025256 | Ga0209759_1001263 | Ga0209759_10012634 | 324 |
| 419 | 3300006177 | Ga0075362_10091899 | Ga0075362_100918992 | 325 |
| 420 | 3300031507 | Ga0307509_10012132 | Ga0307509_100121323 | 325 |
| 421 | 3300039450 | Ga0436363_1431319 | Ga0436363_1431319_975_2075 | 325 |
| 422 | 3300003775 | Ga0055524_1000013 | Ga0055524_1000013246 | 326 |
| 423 | 3300005367 | Ga0070667_100136299 | Ga0070667_1001362992 | 326 |
| 424 | 3300006946 | Ga0079104_1000070 | Ga0079104_100007050 | 326 |
| 425 | 3300009147 | Ga0114129_10062014 | Ga0114129_100620147 | 326 |
| 426 | 3300025298 | Ga0209050_1009044 | Ga0209050_10090445 | 326 |
| 427 | 3300025299 | Ga0209256_1000061 | Ga0209256_1000061248 | 326 |
| 428 | 3300025986 | Ga0207658_10281639 | Ga0207658_102816392 | 326 |
| 429 | 3300027111 | Ga0209281_1000103 | Ga0209281_100010350 | 326 |
| 430 | 3300028786 | Ga0307517_10003685 | Ga0307517_100036855 | 326 |
| 431 | 3300031507 | Ga0307509_10206176 | Ga0307509_102061762 | 326 |
| 432 | 3300031730 | Ga0307516_10034968 | Ga0307516_100349683 | 326 |
| 433 | 3300033179 | Ga0307507_10169072 | Ga0307507_101690722 | 326 |
| 434 | 3300042012 | Ga0439455_0010959 | Ga0439455_0010959_578_1591 | 326 |
| 435 | 3300050507 | nmdc:mga05p37_88196_c1 | nmdc:mga05p37_88196_c1_321_1343 | 326 |
| 436 | iso_pu_bacteria | 2585428062 | 2587754197 | 326 |
| 437 | 3300005843 | Ga0068860_100057773 | Ga0068860_1000577732 | 327 |
| 438 | 3300006195 | Ga0075366_10001536 | Ga0075366_100015367 | 327 |
| 439 | 3300025914 | Ga0207671_10116263 | Ga0207671_101162632 | 327 |
| 440 | 3300026121 | Ga0207683_10090500 | Ga0207683_100905002 | 327 |
| 441 | 3300028381 | Ga0268264_10091805 | Ga0268264_100918051 | 327 |
| 442 | 3300037471 | Ga0395905_0066715 | Ga0395905_0066715_1432_2454 | 327 |
| 443 | 3300050493 | nmdc:mga0k408_1156_c1 | nmdc:mga0k408_1156_c1_6598_7632 | 327 |
| 444 | 3300005844 | Ga0068862_100014372 | Ga0068862_1000143726 | 328 |
| 445 | 3300009148 | Ga0105243_10113366 | Ga0105243_101133662 | 328 |
| 446 | 3300025935 | Ga0207709_10137274 | Ga0207709_101372742 | 328 |
| 447 | 3300026078 | Ga0207702_10135709 | Ga0207702_101357092 | 328 |
| 448 | 3300044712 | Ga0453684_0180547 | Ga0453684_0180547_89_1114 | 328 |
| 449 | 3300045051 | Ga0451576_0012835 | Ga0451576_0012835_7832_8842 | 328 |
| 450 | 3300050496 | nmdc:mga07m45_140193_c1 | nmdc:mga07m45_140193_c1_223_1248 | 328 |
| 451 | 3300050496 | nmdc:mga07m45_38077_c1 | nmdc:mga07m45_38077_c1_832_1863 | 328 |
| 452 | iso_pu_bacteria | 2643221644 | 2644247026 | 328 |
| 453 | 3300042876 | Ga0451577_0004221 | Ga0451577_0004221_2251_3285 | 329 |
| 454 | 3300044712 | Ga0453684_0005216 | Ga0453684_0005216_10318_11343 | 329 |
| 455 | 3300005295 | Ga0065707_10110598 | Ga0065707_101105983 | 330 |
| 456 | 3300005548 | Ga0070665_100175373 | Ga0070665_1001753732 | 330 |
| 457 | 3300009093 | Ga0105240_10030834 | Ga0105240_100308345 | 330 |
| 458 | 3300009545 | Ga0105237_10007447 | Ga0105237_100074475 | 330 |
| 459 | 3300009551 | Ga0105238_10070959 | Ga0105238_100709593 | 330 |
| 460 | 3300010375 | Ga0105239_10010780 | Ga0105239_100107804 | 330 |
| 461 | 3300025913 | Ga0207695_10009980 | Ga0207695_1000998016 | 330 |
| 462 | 3300025914 | Ga0207671_10008972 | Ga0207671_1000897211 | 330 |
| 463 | 3300025924 | Ga0207694_10041705 | Ga0207694_100417052 | 330 |
| 464 | 3300025925 | Ga0207650_10069218 | Ga0207650_100692182 | 330 |
| 465 | 3300026041 | Ga0207639_10013580 | Ga0207639_100135802 | 330 |
| 466 | 3300028794 | Ga0307515_10000609 | Ga0307515_1000060920 | 330 |
| 467 | 3300028794 | Ga0307515_10003934 | Ga0307515_1000393418 | 330 |
| 468 | 3300030522 | Ga0307512_10113364 | Ga0307512_101133642 | 330 |
| 469 | 3300031456 | Ga0307513_10041969 | Ga0307513_100419692 | 330 |
| 470 | 3300031456 | Ga0307513_10136038 | Ga0307513_101360382 | 330 |
| 471 | 3300031507 | Ga0307509_10110656 | Ga0307509_101106562 | 330 |
| 472 | 3300031616 | Ga0307508_10000404 | Ga0307508_1000040433 | 330 |
| 473 | 3300031911 | Ga0307412_10174563 | Ga0307412_101745632 | 330 |
| 474 | 3300035119 | Ga0373956_0097612 | Ga0373956_0097612_110_1219 | 330 |
| 475 | 3300035692 | Ga0373935_0156141 | Ga0373935_0156141_176_1285 | 330 |
| 476 | 3300037068 | Ga0373925_0169703 | Ga0373925_0169703_437_1546 | 330 |
| 477 | 3300046459 | Ga0495629_0104459 | Ga0495629_0104459_617_1759 | 330 |
| 478 | 3300048917 | Ga0496114_0272278 | Ga0496114_0272278_341_1381 | 330 |
| 479 | 3300053148 | Ga0500590_001769 | Ga0500590_001769_4436_5449 | 330 |
| 480 | 3300003322 | rootL2_10034863 | rootL2_100348632 | 331 |
| 481 | 3300005328 | Ga0070676_10044423 | Ga0070676_100444232 | 331 |
| 482 | 3300005354 | Ga0070675_100148377 | Ga0070675_1001483772 | 331 |
| 483 | 3300005563 | Ga0068855_100002063 | Ga0068855_10000206320 | 331 |
| 484 | 3300005844 | Ga0068862_100016973 | Ga0068862_1000169735 | 331 |
| 485 | 3300025303 | Ga0209051_1013888 | Ga0209051_10138884 | 331 |
| 486 | 3300031730 | Ga0307516_10009071 | Ga0307516_1000907116 | 331 |
| 487 | 3300037471 | Ga0395905_0002614 | Ga0395905_0002614_4937_5980 | 331 |
| 488 | 3300048905 | Ga0496102_0014383 | Ga0496102_0014383_441_1502 | 331 |
| 489 | 3300050496 | nmdc:mga07m45_147389_c1 | nmdc:mga07m45_147389_c1_117_1133 | 331 |
| 490 | iso_pu_bacteria | 2643221585 | 2643936494 | 331 |
| 491 | iso_pu_bacteria | 2643221656 | 2644317850 | 331 |
| 492 | 3300003316 | rootH1_10006656 | rootH1_100066565 | 332 |
| 493 | 3300003322 | rootL2_10000250 | rootL2_100002505 | 332 |
| 494 | 3300005328 | Ga0070676_10063389 | Ga0070676_100633892 | 332 |
| 495 | 3300005330 | Ga0070690_100041032 | Ga0070690_1000410322 | 332 |
| 496 | 3300005331 | Ga0070670_100108547 | Ga0070670_1001085472 | 332 |
| 497 | 3300005334 | Ga0068869_100037947 | Ga0068869_1000379472 | 332 |
| 498 | 3300005335 | Ga0070666_10116227 | Ga0070666_101162272 | 332 |
| 499 | 3300005338 | Ga0068868_100000966 | Ga0068868_10000096619 | 332 |
| 500 | 3300005338 | Ga0068868_100023991 | Ga0068868_1000239912 | 332 |
| 501 | 3300005343 | Ga0070687_100053057 | Ga0070687_1000530572 | 332 |
| 502 | 3300005344 | Ga0070661_100007516 | Ga0070661_1000075164 | 332 |
| 503 | 3300005344 | Ga0070661_100140699 | Ga0070661_1001406992 | 332 |
| 504 | 3300005353 | Ga0070669_100126813 | Ga0070669_1001268132 | 332 |
| 505 | 3300005354 | Ga0070675_100087022 | Ga0070675_1000870222 | 332 |
| 506 | 3300005354 | Ga0070675_100424737 | Ga0070675_1004247371 | 332 |
| 507 | 3300005355 | Ga0070671_100003392 | Ga0070671_10000339210 | 332 |
| 508 | 3300005356 | Ga0070674_100004218 | Ga0070674_1000042184 | 332 |
| 509 | 3300005356 | Ga0070674_100036594 | Ga0070674_1000365943 | 332 |
| 510 | 3300005364 | Ga0070673_100013730 | Ga0070673_1000137303 | 332 |
| 511 | 3300005364 | Ga0070673_100030938 | Ga0070673_1000309384 | 332 |
| 512 | 3300005367 | Ga0070667_100187177 | Ga0070667_1001871772 | 332 |
| 513 | 3300005456 | Ga0070678_100005704 | Ga0070678_1000057045 | 332 |
| 514 | 3300005459 | Ga0068867_100026510 | Ga0068867_1000265102 | 332 |
| 515 | 3300005459 | Ga0068867_100033912 | Ga0068867_1000339122 | 332 |
| 516 | 3300005539 | Ga0068853_100071486 | Ga0068853_1000714862 | 332 |
| 517 | 3300005539 | Ga0068853_100080473 | Ga0068853_1000804733 | 332 |
| 518 | 3300005543 | Ga0070672_100061511 | Ga0070672_1000615113 | 332 |
| 519 | 3300005563 | Ga0068855_100037807 | Ga0068855_1000378073 | 332 |
| 520 | 3300005564 | Ga0070664_100059347 | Ga0070664_1000593472 | 332 |
| 521 | 3300005564 | Ga0070664_100144594 | Ga0070664_1001445942 | 332 |
| 522 | 3300005564 | Ga0070664_100288019 | Ga0070664_1002880192 | 332 |
| 523 | 3300005578 | Ga0068854_100009863 | Ga0068854_1000098636 | 332 |
| 524 | 3300005578 | Ga0068854_100062788 | Ga0068854_1000627882 | 332 |
| 525 | 3300005614 | Ga0068856_100007776 | Ga0068856_10000777611 | 332 |
| 526 | 3300005615 | Ga0070702_100058361 | Ga0070702_1000583612 | 332 |
| 527 | 3300005616 | Ga0068852_100012439 | Ga0068852_1000124393 | 332 |
| 528 | 3300005616 | Ga0068852_100106018 | Ga0068852_1001060182 | 332 |
| 529 | 3300005617 | Ga0068859_100084220 | Ga0068859_1000842202 | 332 |
| 530 | 3300005618 | Ga0068864_100002065 | Ga0068864_1000020657 | 332 |
| 531 | 3300005834 | Ga0068851_10020954 | Ga0068851_100209543 | 332 |
| 532 | 3300005834 | Ga0068851_10033595 | Ga0068851_100335952 | 332 |
| 533 | 3300005841 | Ga0068863_100040147 | Ga0068863_1000401474 | 332 |
| 534 | 3300005842 | Ga0068858_100008614 | Ga0068858_1000086143 | 332 |
| 535 | 3300005842 | Ga0068858_100016336 | Ga0068858_1000163363 | 332 |
| 536 | 3300005842 | Ga0068858_100027116 | Ga0068858_1000271161 | 332 |
| 537 | 3300005843 | Ga0068860_100040723 | Ga0068860_1000407232 | 332 |
| 538 | 3300005843 | Ga0068860_100087594 | Ga0068860_1000875943 | 332 |
| 539 | 3300006038 | Ga0075365_10025870 | Ga0075365_100258702 | 332 |
| 540 | 3300006178 | Ga0075367_10034681 | Ga0075367_100346813 | 332 |
| 541 | 3300006195 | Ga0075366_10008876 | Ga0075366_100088762 | 332 |
| 542 | 3300006195 | Ga0075366_10012726 | Ga0075366_100127263 | 332 |
| 543 | 3300006195 | Ga0075366_10044465 | Ga0075366_100444653 | 332 |
| 544 | 3300006237 | Ga0097621_100025499 | Ga0097621_1000254992 | 332 |
| 545 | 3300006237 | Ga0097621_100050121 | Ga0097621_1000501213 | 332 |
| 546 | 3300006353 | Ga0075370_10001367 | Ga0075370_100013673 | 332 |
| 547 | 3300006353 | Ga0075370_10038105 | Ga0075370_100381052 | 332 |
| 548 | 3300006358 | Ga0068871_100004794 | Ga0068871_1000047947 | 332 |
| 549 | 3300006358 | Ga0068871_100126845 | Ga0068871_1001268452 | 332 |
| 550 | 3300006881 | Ga0068865_100033691 | Ga0068865_1000336912 | 332 |
| 551 | 3300006931 | Ga0097620_100084217 | Ga0097620_1000842172 | 332 |
| 552 | 3300009176 | Ga0105242_10209939 | Ga0105242_102099392 | 332 |
| 553 | 3300009177 | Ga0105248_10182510 | Ga0105248_101825102 | 332 |
| 554 | 3300009177 | Ga0105248_10293031 | Ga0105248_102930312 | 332 |
| 555 | 3300009545 | Ga0105237_10303567 | Ga0105237_103035672 | 332 |
| 556 | 3300009551 | Ga0105238_10005477 | Ga0105238_100054776 | 332 |
| 557 | 3300013104 | Ga0157370_10189636 | Ga0157370_101896361 | 332 |
| 558 | 3300013296 | Ga0157374_10003108 | Ga0157374_1000310811 | 332 |
| 559 | 3300013296 | Ga0157374_10063603 | Ga0157374_100636032 | 332 |
| 560 | 3300013306 | Ga0163162_10132660 | Ga0163162_101326602 | 332 |
| 561 | 3300013307 | Ga0157372_10031276 | Ga0157372_100312762 | 332 |
| 562 | 3300013307 | Ga0157372_10096556 | Ga0157372_100965562 | 332 |
| 563 | 3300013308 | Ga0157375_10008892 | Ga0157375_100088921 | 332 |
| 564 | 3300013308 | Ga0157375_10010275 | Ga0157375_100102753 | 332 |
| 565 | 3300013308 | Ga0157375_10068709 | Ga0157375_100687092 | 332 |
| 566 | 3300014325 | Ga0163163_10009458 | Ga0163163_1000945813 | 332 |
| 567 | 3300014326 | Ga0157380_10125730 | Ga0157380_101257302 | 332 |
| 568 | 3300014745 | Ga0157377_10001539 | Ga0157377_100015397 | 332 |
| 569 | 3300014968 | Ga0157379_10018511 | Ga0157379_100185112 | 332 |
| 570 | 3300014968 | Ga0157379_10045148 | Ga0157379_100451482 | 332 |
| 571 | 3300017792 | Ga0163161_10020889 | Ga0163161_100208893 | 332 |
| 572 | 3300025321 | Ga0207656_10011679 | Ga0207656_100116793 | 332 |
| 573 | 3300025893 | Ga0207682_10041078 | Ga0207682_100410782 | 332 |
| 574 | 3300025901 | Ga0207688_10027409 | Ga0207688_100274092 | 332 |
| 575 | 3300025903 | Ga0207680_10068247 | Ga0207680_100682472 | 332 |
| 576 | 3300025907 | Ga0207645_10008229 | Ga0207645_100082292 | 332 |
| 577 | 3300025907 | Ga0207645_10032025 | Ga0207645_100320253 | 332 |
| 578 | 3300025907 | Ga0207645_10074137 | Ga0207645_100741372 | 332 |
| 579 | 3300025909 | Ga0207705_10089825 | Ga0207705_100898252 | 332 |
| 580 | 3300025920 | Ga0207649_10012683 | Ga0207649_100126832 | 332 |
| 581 | 3300025920 | Ga0207649_10016552 | Ga0207649_100165525 | 332 |
| 582 | 3300025923 | Ga0207681_10047590 | Ga0207681_100475902 | 332 |
| 583 | 3300025926 | Ga0207659_10002170 | Ga0207659_100021703 | 332 |
| 584 | 3300025926 | Ga0207659_10328888 | Ga0207659_103288882 | 332 |
| 585 | 3300025931 | Ga0207644_10002319 | Ga0207644_1000231910 | 332 |
| 586 | 3300025933 | Ga0207706_10007947 | Ga0207706_100079478 | 332 |
| 587 | 3300025938 | Ga0207704_10037018 | Ga0207704_100370182 | 332 |
| 588 | 3300025938 | Ga0207704_10061926 | Ga0207704_100619262 | 332 |
| 589 | 3300025940 | Ga0207691_10042781 | Ga0207691_100427813 | 332 |
| 590 | 3300025941 | Ga0207711_10036357 | Ga0207711_100363572 | 332 |
| 591 | 3300025941 | Ga0207711_10246570 | Ga0207711_102465702 | 332 |
| 592 | 3300025942 | Ga0207689_10012167 | Ga0207689_100121673 | 332 |
| 593 | 3300025942 | Ga0207689_10067809 | Ga0207689_100678092 | 332 |
| 594 | 3300025949 | Ga0207667_10059045 | Ga0207667_100590452 | 332 |
| 595 | 3300025960 | Ga0207651_10001608 | Ga0207651_100016088 | 332 |
| 596 | 3300025960 | Ga0207651_10019939 | Ga0207651_100199393 | 332 |
| 597 | 3300025972 | Ga0207668_10287968 | Ga0207668_102879682 | 332 |
| 598 | 3300026023 | Ga0207677_10001522 | Ga0207677_1000152212 | 332 |
| 599 | 3300026023 | Ga0207677_10004585 | Ga0207677_100045854 | 332 |
| 600 | 3300026035 | Ga0207703_10257075 | Ga0207703_102570752 | 332 |
| 601 | 3300026067 | Ga0207678_10020289 | Ga0207678_100202892 | 332 |
| 602 | 3300026078 | Ga0207702_10004429 | Ga0207702_1000442914 | 332 |
| 603 | 3300026078 | Ga0207702_10036893 | Ga0207702_100368932 | 332 |
| 604 | 3300026088 | Ga0207641_10003329 | Ga0207641_1000332918 | 332 |
| 605 | 3300026089 | Ga0207648_10024008 | Ga0207648_100240082 | 332 |
| 606 | 3300026089 | Ga0207648_10051674 | Ga0207648_100516742 | 332 |
| 607 | 3300026095 | Ga0207676_10003295 | Ga0207676_100032952 | 332 |
| 608 | 3300026095 | Ga0207676_10062009 | Ga0207676_100620093 | 332 |
| 609 | 3300026116 | Ga0207674_10078656 | Ga0207674_100786562 | 332 |
| 610 | 3300026121 | Ga0207683_10007622 | Ga0207683_100076228 | 332 |
| 611 | 3300026142 | Ga0207698_10004036 | Ga0207698_100040362 | 332 |
| 612 | 3300026142 | Ga0207698_10094985 | Ga0207698_100949852 | 332 |
| 613 | 3300027866 | Ga0209813_10052711 | Ga0209813_100527112 | 332 |
| 614 | 3300028381 | Ga0268264_10044615 | Ga0268264_100446152 | 332 |
| 615 | 3300028794 | Ga0307515_10018282 | Ga0307515_100182828 | 332 |
| 616 | 3300028794 | Ga0307515_10068536 | Ga0307515_100685362 | 332 |
| 617 | 3300028794 | Ga0307515_10084430 | Ga0307515_100844302 | 332 |
| 618 | 3300028794 | Ga0307515_10220473 | Ga0307515_102204732 | 332 |
| 619 | 3300030522 | Ga0307512_10024260 | Ga0307512_100242607 | 332 |
| 620 | 3300031456 | Ga0307513_10160179 | Ga0307513_101601792 | 332 |
| 621 | 3300031507 | Ga0307509_10000991 | Ga0307509_1000099114 | 332 |
| 622 | 3300031507 | Ga0307509_10166310 | Ga0307509_101663102 | 332 |
| 623 | 3300031548 | Ga0307408_100060925 | Ga0307408_1000609252 | 332 |
| 624 | 3300031616 | Ga0307508_10002244 | Ga0307508_1000224413 | 332 |
| 625 | 3300031616 | Ga0307508_10011564 | Ga0307508_1001156412 | 332 |
| 626 | 3300031731 | Ga0307405_10026024 | Ga0307405_100260242 | 332 |
| 627 | 3300031824 | Ga0307413_10161764 | Ga0307413_101617642 | 332 |
| 628 | 3300031852 | Ga0307410_10008211 | Ga0307410_100082112 | 332 |
| 629 | 3300033180 | Ga0307510_10003212 | Ga0307510_1000321220 | 332 |
| 630 | 3300035691 | Ga0373931_0009522 | Ga0373931_0009522_2148_3173 | 332 |
| 631 | 3300037471 | Ga0395905_0402319 | Ga0395905_0402319_171_1208 | 332 |
| 632 | 3300042461 | Ga0439460_0006753 | Ga0439460_0006753_409_1470 | 332 |
| 633 | 3300044656 | Ga0466969_0008057 | Ga0466969_0008057_3887_4927 | 332 |
| 634 | 3300044683 | Ga0466965_0025409 | Ga0466965_0025409_1611_2651 | 332 |
| 635 | 3300044684 | Ga0466966_0007854 | Ga0466966_0007854_1614_2654 | 332 |
| 636 | 3300044693 | Ga0466961_0027475 | Ga0466961_0027475_2000_3040 | 332 |
| 637 | 3300044706 | Ga0466964_0001613 | Ga0466964_0001613_5195_6235 | 332 |
| 638 | 3300044719 | Ga0466971_0013051 | Ga0466971_0013051_1746_2786 | 332 |
| 639 | 3300045976 | Ga0466967_0133234 | Ga0466967_0133234_1239_2279 | 332 |
| 640 | 3300046454 | Ga0495592_0000083 | Ga0495592_0000083_50141_51175 | 332 |
| 641 | 3300046471 | Ga0495650_0060119 | Ga0495650_0060119_130_1188 | 332 |
| 642 | 3300046472 | Ga0495580_0224655 | Ga0495580_0224655_29_1132 | 332 |
| 643 | 3300046507 | Ga0495606_0058276 | Ga0495606_0058276_200_1243 | 332 |
| 644 | 3300046512 | Ga0495610_0074955 | Ga0495610_0074955_181_1218 | 332 |
| 645 | 3300046519 | Ga0495632_0002758 | Ga0495632_0002758_2243_3280 | 332 |
| 646 | 3300046660 | Ga0495625_0018316 | Ga0495625_0018316_152_1192 | 332 |
| 647 | 3300046683 | Ga0495658_0196473 | Ga0495658_0196473_46_1098 | 332 |
| 648 | 3300046694 | Ga0495649_0003342 | Ga0495649_0003342_9131_10168 | 332 |
| 649 | 3300047472 | Ga0495686_0003513 | Ga0495686_0003513_5887_6909 | 332 |
| 650 | 3300048091 | Ga0495626_0040110 | Ga0495626_0040110_79_1116 | 332 |
| 651 | 3300048903 | Ga0496100_0057927 | Ga0496100_0057927_606_1700 | 332 |
| 652 | 3300048907 | Ga0496104_0058299 | Ga0496104_0058299_1900_2961 | 332 |
| 653 | 3300048909 | Ga0496106_0033112 | Ga0496106_0033112_1501_2595 | 332 |
| 654 | 3300048909 | Ga0496106_0038095 | Ga0496106_0038095_1543_2586 | 332 |
| 655 | 3300048910 | Ga0496107_0017284 | Ga0496107_0017284_2746_3840 | 332 |
| 656 | 3300048911 | Ga0496108_0011606 | Ga0496108_0011606_1169_2263 | 332 |
| 657 | 3300048911 | Ga0496108_0166495 | Ga0496108_0166495_511_1566 | 332 |
| 658 | 3300048912 | Ga0496109_0010074 | Ga0496109_0010074_2643_3737 | 332 |
| 659 | 3300048913 | Ga0496110_0034981 | Ga0496110_0034981_1852_2946 | 332 |
| 660 | 3300049580 | Ga0501046_0000075 | Ga0501046_0000075_76989_78041 | 332 |
| 661 | 3300049581 | Ga0501047_0000081 | Ga0501047_0000081_76989_78041 | 332 |
| 662 | 3300049582 | Ga0501048_0002636 | Ga0501048_0002636_9621_10673 | 332 |
| 663 | 3300049824 | Ga0501045_0059695 | Ga0501045_0059695_876_1928 | 332 |
| 664 | 3300050490 | nmdc:mga03n38_2428_c1 | nmdc:mga03n38_2428_c1_3239_4309 | 332 |
| 665 | 3300050492 | nmdc:mga0yw44_3749_c1 | nmdc:mga0yw44_3749_c1_3523_4593 | 332 |
| 666 | 3300050493 | nmdc:mga0k408_20310_c1 | nmdc:mga0k408_20310_c1_1991_3028 | 332 |
| 667 | 3300050493 | nmdc:mga0k408_287_c1 | nmdc:mga0k408_287_c1_21908_22978 | 332 |
| 668 | 3300050493 | nmdc:mga0k408_3129_c1 | nmdc:mga0k408_3129_c1_4236_5273 | 332 |
| 669 | 3300050493 | nmdc:mga0k408_4278_c1 | nmdc:mga0k408_4278_c1_1910_2956 | 332 |
| 670 | 3300050494 | nmdc:mga06z11_23826_c1 | nmdc:mga06z11_23826_c1_1752_2822 | 332 |
| 671 | 3300050496 | nmdc:mga07m45_12296_c1 | nmdc:mga07m45_12296_c1_2816_3862 | 332 |
| 672 | 3300050496 | nmdc:mga07m45_15059_c1 | nmdc:mga07m45_15059_c1_1836_2873 | 332 |
| 673 | 3300050496 | nmdc:mga07m45_81176_c1 | nmdc:mga07m45_81176_c1_566_1636 | 332 |
| 674 | 3300050516 | nmdc:mga0sz30_1941_c1 | nmdc:mga0sz30_1941_c1_4403_5473 | 332 |
| 675 | 3300053086 | Ga0500578_0096754 | Ga0500578_0096754_82_1125 | 332 |
| 676 | 3300053136 | Ga0500559_0000019 | Ga0500559_0000019_102513_103544 | 332 |
| 677 | 3300053139 | Ga0500568_0002988 | Ga0500568_0002988_6647_7684 | 332 |
| 678 | 3300053154 | Ga0500619_000171 | Ga0500619_000171_4331_5398 | 332 |
| 679 | 3300053730 | Ga0500645_001960 | Ga0500645_001960_3460_4503 | 332 |
| 680 | 3300053739 | Ga0500587_000346 | Ga0500587_000346_880_1911 | 332 |
| 681 | 3300061719 | Ga0466962_0107277 | Ga0466962_0107277_216_1256 | 332 |
| 682 | 3300003215 | JGI25153J46596_10002128 | JGI25153J46596_100021284 | 333 |
| 683 | 3300005334 | Ga0068869_100302818 | Ga0068869_1003028181 | 333 |
| 684 | 3300005455 | Ga0070663_100040907 | Ga0070663_1000409073 | 333 |
| 685 | 3300005457 | Ga0070662_100173804 | Ga0070662_1001738042 | 333 |
| 686 | 3300005539 | Ga0068853_100044587 | Ga0068853_1000445872 | 333 |
| 687 | 3300005577 | Ga0068857_100095305 | Ga0068857_1000953052 | 333 |
| 688 | 3300005578 | Ga0068854_100056055 | Ga0068854_1000560552 | 333 |
| 689 | 3300006051 | Ga0075364_10011121 | Ga0075364_100111216 | 333 |
| 690 | 3300006177 | Ga0075362_10016795 | Ga0075362_100167954 | 333 |
| 691 | 3300006353 | Ga0075370_10042740 | Ga0075370_100427402 | 333 |
| 692 | 3300009093 | Ga0105240_10035695 | Ga0105240_100356955 | 333 |
| 693 | 3300009098 | Ga0105245_10084750 | Ga0105245_100847502 | 333 |
| 694 | 3300009148 | Ga0105243_10283022 | Ga0105243_102830222 | 333 |
| 695 | 3300009545 | Ga0105237_10033124 | Ga0105237_100331245 | 333 |
| 696 | 3300010375 | Ga0105239_10034479 | Ga0105239_100344793 | 333 |
| 697 | 3300025297 | Ga0209758_1000281 | Ga0209758_100028112 | 333 |
| 698 | 3300025933 | Ga0207706_10101629 | Ga0207706_101016292 | 333 |
| 699 | 3300026041 | Ga0207639_10108451 | Ga0207639_101084513 | 333 |
| 700 | 3300026116 | Ga0207674_10018099 | Ga0207674_1001809910 | 333 |
| 701 | 3300050493 | nmdc:mga0k408_10242_c1 | nmdc:mga0k408_10242_c1_3491_4537 | 333 |
| 702 | 3300050494 | nmdc:mga06z11_10413_c1 | nmdc:mga06z11_10413_c1_262_1308 | 333 |
| 703 | 3300050496 | nmdc:mga07m45_49137_c1 | nmdc:mga07m45_49137_c1_1017_2063 | 333 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ps6-assembly1.cif.gz_A | crystal structure of e.coli pdxa | 0.904 | 2 | 332 |
| 6e85-assembly1.cif.gz_B | 1.25 angstrom resolution crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from klebsiella pneumoniae. | 0.9029 | 4 | 332 |
| 6e85-assembly1.cif.gz_A | 1.25 angstrom resolution crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from klebsiella pneumoniae. | 0.899 | 3 | 332 |
| 6e85-assembly1.cif.gz_B | 1.25 angstrom resolution crystal structure of 4-hydroxythreonine-4-phosphate dehydrogenase from klebsiella pneumoniae. | 0.895 | 4 | 332 |
| 2hi1-assembly1.cif.gz_A | the structure of a putative 4-hydroxythreonine-4-phosphate dehydrogenase from salmonella typhimurium. | 0.8946 | 3 | 333 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hi1B00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8859 | 6 | 333 | 3.40.718.10 |
| 1r8kA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8813 | 3 | 332 | 3.40.718.10 |
| 2hi1B00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8779 | 6 | 333 | 3.40.718.10 |
| 1r8kA00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8683 | 3 | 332 | 3.40.718.10 |
| 4jqpB00 | Alpha Beta;3-Layer(aba) Sandwich;Isopropylmalate Dehydrogenase;Isopropylmalate Dehydrogenase | 0.8488 | 2 | 332 | 3.40.718.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q3V819-F1-model_v4 | Pyridoxal phosphate biosynthetic protein variant | 0.991 | 175 | 285 |
GO:0016491
GO:0046872 GO:0051287 |
| AF-A0A357AGG2-F1-model_v4 | 4-hydroxythreonine-4-phosphate dehydrogenase PdxA | 0.9803 | 161 | 256 |
GO:0016491
GO:0046872 GO:0051287 |
| AF-X1UB13-F1-model_v4 | 4-hydroxythreonine-4-phosphate dehydrogenase | 0.9763 | 163 | 283 |
GO:0016491
GO:0046872 GO:0051287 |
| AF-A0A3D6BY09-F1-model_v4 | 4-hydroxythreonine-4-phosphate dehydrogenase | 0.975 | 201 | 305 |
GO:0016491
GO:0046872 GO:0051287 |
| AF-A0A2X3GYC7-F1-model_v4 | 4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262) | 0.9661 | 161 | 278 |
GO:0046872
GO:0050570 GO:0051287 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar