F476268
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 703 | 418 | 599 | 396 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10103796|Ga0105240_101037962 |
| Length | 420 |
| Sequence | MLRKRNAFVLASCRRALQNDQTMDISELDRLTRWLMEGARSAPTPTTFLKEMCERLVAAGLPLYRVGAFVQTLHPDVFGRSFIWRAGAEEVVVNTANFDLPDSPQFKNSPLAILYASGHEVRYRLDDPESKRFPFFDDMRGEGVTDYIALPLLFTDGSIHASSWSTRAEGGFTDEHLAALRSVIPPFSRLGEIHAMRRTAAALLDTYVGNRAGERILAGQIRRGHAEGMQVAIWLSDLRGFTALSDRLVPETVVDILNQYFDCQVPVIREHGGEILKFMGDGLLAVFPIAKDGGNLSEVCGRVLRASRKARANVDAMHYPSGNAIERFRFGIALHIGGILFGNIGGMSRLDFTCIGPAVNLAARLEKIAGRQRRTVVASAAFAGACVYDWVDLGEFPIAGFSQAQRVFGLREEVVADVAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 5 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 6 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 7 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 8 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 9 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 10 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 11 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 12 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 13 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 14 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 15 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 16 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 17 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 18 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 19 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 20 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 21 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 22 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 23 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 24 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 25 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 26 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 27 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 28 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 29 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 30 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 31 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 32 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 33 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 34 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 35 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 36 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 37 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 38 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 39 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 40 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 41 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 42 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 43 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 44 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 45 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 46 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 47 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 48 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 49 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 50 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 51 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 52 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 53 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 54 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 55 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 56 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 57 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 58 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 59 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 60 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 61 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 62 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 63 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 64 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 65 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 66 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 67 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 68 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 69 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 70 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 71 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 72 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 73 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 74 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 75 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 76 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 78 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 80 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 82 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 86 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 101 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 103 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 112 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 113 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 114 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 115 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 117 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 118 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 119 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 140 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 141 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 142 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 143 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 144 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 145 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 189 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 200 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 201 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 202 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 206 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 207 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 209 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 215 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 216 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 229 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 230 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 247 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 321 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 322 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 323 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 357 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 367 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 368 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 369 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 370 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 371 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 372 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 373 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 374 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 375 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 376 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 377 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 378 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 379 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 380 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 381 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 385 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 386 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 387 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 389 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 390 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 391 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 392 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 393 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 397 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 398 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 399 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 400 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 401 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 402 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 403 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 404 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 405 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 406 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 407 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 408 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 409 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 410 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 411 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 412 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 413 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 414 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 415 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 416 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 417 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 418 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.2 |
| Metatranscriptomes | 0 |
| Isolates | 13.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.82 |
| Nodule | 11.24 |
| Rhizoplane | 3.41 |
| Rhizosphere | 67.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10006616 | 3300003203 | Bacteria | 5325 |
| 2 | JGI25153J46596_10000062 | 3300003215 | Bacteria | 129749 |
| 3 | JGI25404J52841_10004779 | 3300003659 | Bacteria | 2770 |
| 4 | Ga0065165_1015649 | 3300005262 | Bacteria | 2884 |
| 5 | Ga0070683_100002376 | 3300005329 | Bacteria | 14933 |
| 6 | Ga0070683_100010546 | 3300005329 | Bacteria | 7944 |
| 7 | Ga0068869_100118884 | 3300005334 | Bacteria | 2019 |
| 8 | Ga0070666_10141848 | 3300005335 | Bacteria | 1673 |
| 9 | Ga0070668_100056001 | 3300005347 | Bacteria | 3044 |
| 10 | Ga0070671_100117683 | 3300005355 | Bacteria | 2234 |
| 11 | Ga0070688_100071883 | 3300005365 | Bacteria | 2216 |
| 12 | Ga0070659_100092167 | 3300005366 | Bacteria | 2429 |
| 13 | Ga0070667_100017334 | 3300005367 | Bacteria | 5969 |
| 14 | Ga0070709_10000652 | 3300005434 | Bacteria | 19741 |
| 15 | Ga0070709_10008052 | 3300005434 | Bacteria | 5784 |
| 16 | Ga0070714_100054725 | 3300005435 | Bacteria | 3409 |
| 17 | Ga0070714_100253585 | 3300005435 | Bacteria | 1628 |
| 18 | Ga0070714_100278728 | 3300005435 | Bacteria | 1553 |
| 19 | Ga0070713_100004718 | 3300005436 | Bacteria | 9212 |
| 20 | Ga0070713_100006818 | 3300005436 | Bacteria | 7958 |
| 21 | Ga0070713_100034104 | 3300005436 | Bacteria | 4085 |
| 22 | Ga0070713_100348251 | 3300005436 | Bacteria | 1374 |
| 23 | Ga0070710_10000869 | 3300005437 | Bacteria | 14456 |
| 24 | Ga0070710_10014059 | 3300005437 | Bacteria | 4020 |
| 25 | Ga0070710_10045864 | 3300005437 | Bacteria | 2432 |
| 26 | Ga0070710_10127666 | 3300005437 | Unclassified | 1547 |
| 27 | Ga0070711_100014126 | 3300005439 | Bacteria | 5026 |
| 28 | Ga0070711_100045413 | 3300005439 | Bacteria | 2988 |
| 29 | Ga0070711_100075879 | 3300005439 | Bacteria | 2382 |
| 30 | Ga0070711_100105384 | 3300005439 | Bacteria | 2059 |
| 31 | Ga0070700_100138399 | 3300005441 | Bacteria | 1651 |
| 32 | Ga0070708_100039730 | 3300005445 | Bacteria | 4119 |
| 33 | Ga0070708_100137557 | 3300005445 | Bacteria | 2264 |
| 34 | Ga0070662_100111969 | 3300005457 | Bacteria | 2080 |
| 35 | Ga0070681_10044280 | 3300005458 | Bacteria | 4454 |
| 36 | Ga0070681_10053424 | 3300005458 | Bacteria | 4026 |
| 37 | Ga0070681_10078795 | 3300005458 | Bacteria | 3252 |
| 38 | Ga0070707_100135156 | 3300005468 | Bacteria | 2399 |
| 39 | Ga0070679_100011211 | 3300005530 | Bacteria | 8545 |
| 40 | Ga0070679_100064516 | 3300005530 | Bacteria | 3650 |
| 41 | Ga0070684_100005101 | 3300005535 | Bacteria | 10035 |
| 42 | Ga0068853_100090651 | 3300005539 | Bacteria | 2687 |
| 43 | Ga0068853_100208457 | 3300005539 | Bacteria | 1781 |
| 44 | Ga0070665_100037555 | 3300005548 | Bacteria | 4870 |
| 45 | Ga0068855_100242273 | 3300005563 | Bacteria | 2014 |
| 46 | Ga0068855_100265032 | 3300005563 | Bacteria | 1913 |
| 47 | Ga0070664_100045408 | 3300005564 | Bacteria | 3710 |
| 48 | Ga0068854_100152623 | 3300005578 | Bacteria | 1782 |
| 49 | Ga0068856_100000505 | 3300005614 | Bacteria | 43297 |
| 50 | Ga0068856_100227964 | 3300005614 | Viruses | 1879 |
| 51 | Ga0068852_100041724 | 3300005616 | Bacteria | 3879 |
| 52 | Ga0068852_100265102 | 3300005616 | Bacteria | 1651 |
| 53 | Ga0068864_100073054 | 3300005618 | Unclassified | 2990 |
| 54 | Ga0068861_100199976 | 3300005719 | Bacteria | 1677 |
| 55 | Ga0068863_100001400 | 3300005841 | Bacteria | 23922 |
| 56 | Ga0068858_100037097 | 3300005842 | Bacteria | 4518 |
| 57 | Ga0068862_100251953 | 3300005844 | Bacteria | 1609 |
| 58 | Ga0081455_10035458 | 3300005937 | Bacteria | 4457 |
| 59 | Ga0081455_10066786 | 3300005937 | Bacteria | 3001 |
| 60 | Ga0081455_10218633 | 3300005937 | Bacteria | 1414 |
| 61 | Ga0081540_1002292 | 3300005983 | Bacteria | 15720 |
| 62 | Ga0081540_1003262 | 3300005983 | Bacteria | 12891 |
| 63 | Ga0081540_1003714 | 3300005983 | Bacteria | 11962 |
| 64 | Ga0081540_1005704 | 3300005983 | Bacteria | 9238 |
| 65 | Ga0081540_1007903 | 3300005983 | Bacteria | 7511 |
| 66 | Ga0081540_1009502 | 3300005983 | Bacteria | 6699 |
| 67 | Ga0081540_1010212 | 3300005983 | Bacteria | 6377 |
| 68 | Ga0081540_1011152 | 3300005983 | Bacteria | 6032 |
| 69 | Ga0081540_1018636 | 3300005983 | Bacteria | 4250 |
| 70 | Ga0081539_10000199 | 3300005985 | Bacteria | 139305 |
| 71 | Ga0070717_10003637 | 3300006028 | Bacteria | 11057 |
| 72 | Ga0070717_10005463 | 3300006028 | Bacteria | 9282 |
| 73 | Ga0075365_10187656 | 3300006038 | Bacteria | 1446 |
| 74 | Ga0070716_100001146 | 3300006173 | Bacteria | 11682 |
| 75 | Ga0070712_100021391 | 3300006175 | Bacteria | 4249 |
| 76 | Ga0070712_100051014 | 3300006175 | Bacteria | 2881 |
| 77 | Ga0070712_100085832 | 3300006175 | Bacteria | 2292 |
| 78 | Ga0075428_100130465 | 3300006844 | Bacteria | 2734 |
| 79 | Ga0075434_100057650 | 3300006871 | Bacteria | 3860 |
| 80 | Ga0075434_100144005 | 3300006871 | Bacteria | 2403 |
| 81 | Ga0075429_100001515 | 3300006880 | Bacteria | 19135 |
| 82 | Ga0075436_100017068 | 3300006914 | Bacteria | 4968 |
| 83 | Ga0075435_100027515 | 3300007076 | Bacteria | 4449 |
| 84 | Ga0105240_10024142 | 3300009093 | Bacteria | 8024 |
| 85 | Ga0105240_10103796 | 3300009093 | Bacteria | 3453 |
| 86 | Ga0111539_10225645 | 3300009094 | Bacteria | 2182 |
| 87 | Ga0105247_10046751 | 3300009101 | Viruses | 2657 |
| 88 | Ga0114129_10017461 | 3300009147 | Bacteria | 10217 |
| 89 | Ga0114129_10084470 | 3300009147 | Bacteria | 4407 |
| 90 | Ga0114129_10319923 | 3300009147 | Bacteria | 2063 |
| 91 | Ga0105248_10020735 | 3300009177 | Bacteria | 7281 |
| 92 | Ga0105237_10083100 | 3300009545 | Bacteria | 3194 |
| 93 | Ga0105238_10025266 | 3300009551 | Bacteria | 6054 |
| 94 | Ga0105238_10039796 | 3300009551 | Bacteria | 4766 |
| 95 | Ga0105238_10158630 | 3300009551 | Bacteria | 2238 |
| 96 | Ga0105249_10185633 | 3300009553 | Bacteria | 2026 |
| 97 | Ga0105249_10196118 | 3300009553 | Bacteria | 1973 |
| 98 | Ga0105239_10022574 | 3300010375 | Bacteria | 6939 |
| 99 | Ga0105239_10062444 | 3300010375 | Bacteria | 4089 |
| 100 | Ga0105239_10130534 | 3300010375 | Bacteria | 2794 |
| 101 | Ga0105246_10072405 | 3300011119 | Bacteria | 2429 |
| 102 | Ga0157370_10123171 | 3300013104 | Bacteria | 2421 |
| 103 | Ga0157369_10027368 | 3300013105 | Bacteria | 6320 |
| 104 | Ga0157369_10114034 | 3300013105 | Bacteria | 2871 |
| 105 | Ga0157372_10141448 | 3300013307 | Bacteria | 2772 |
| 106 | Ga0163163_10008168 | 3300014325 | Bacteria | 9282 |
| 107 | Ga0157379_10042403 | 3300014968 | Unclassified | 4063 |
| 108 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 109 | Ga0214544_1032080 | 3300021320 | Bacteria | 1671 |
| 110 | Ga0214542_1000065 | 3300021321 | Bacteria | 126045 |
| 111 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 112 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 113 | Ga0213874_10004436 | 3300021377 | Bacteria | 3205 |
| 114 | Ga0213876_10009271 | 3300021384 | Bacteria | 5301 |
| 115 | Ga0213871_10000486 | 3300021441 | Bacteria | 5421 |
| 116 | Ga0209148_1001900 | 3300025254 | Bacteria | 8563 |
| 117 | Ga0209455_1001274 | 3300025272 | Bacteria | 11798 |
| 118 | Ga0209564_1022078 | 3300025295 | Bacteria | 2262 |
| 119 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 120 | Ga0209758_1000029 | 3300025297 | Bacteria | 520787 |
| 121 | Ga0209050_1004404 | 3300025298 | Bacteria | 9536 |
| 122 | Ga0209256_1002195 | 3300025299 | Bacteria | 16729 |
| 123 | Ga0209257_1000418 | 3300025304 | Bacteria | 82230 |
| 124 | Ga0207656_10016082 | 3300025321 | Bacteria | 2907 |
| 125 | Ga0207692_10001691 | 3300025898 | Bacteria | 8334 |
| 126 | Ga0207688_10044510 | 3300025901 | Bacteria | 2474 |
| 127 | Ga0207699_10000253 | 3300025906 | Bacteria | 29543 |
| 128 | Ga0207699_10041193 | 3300025906 | Bacteria | 2666 |
| 129 | Ga0207645_10077238 | 3300025907 | Bacteria | 2133 |
| 130 | Ga0207705_10099812 | 3300025909 | Bacteria | 2135 |
| 131 | Ga0207707_10001093 | 3300025912 | Bacteria | 25844 |
| 132 | Ga0207707_10194243 | 3300025912 | Bacteria | 1770 |
| 133 | Ga0207707_10197093 | 3300025912 | Bacteria | 1756 |
| 134 | Ga0207695_10000163 | 3300025913 | Bacteria | 197030 |
| 135 | Ga0207671_10008503 | 3300025914 | Bacteria | 8696 |
| 136 | Ga0207671_10144524 | 3300025914 | Bacteria | 1834 |
| 137 | Ga0207693_10007068 | 3300025915 | Bacteria | 9265 |
| 138 | Ga0207693_10020503 | 3300025915 | Bacteria | 5258 |
| 139 | Ga0207693_10056447 | 3300025915 | Bacteria | 3078 |
| 140 | Ga0207663_10000261 | 3300025916 | Bacteria | 22957 |
| 141 | Ga0207663_10000913 | 3300025916 | Bacteria | 13487 |
| 142 | Ga0207663_10047718 | 3300025916 | Bacteria | 2646 |
| 143 | Ga0207660_10036441 | 3300025917 | Bacteria | 3419 |
| 144 | Ga0207657_10002700 | 3300025919 | Bacteria | 19128 |
| 145 | Ga0207657_10130427 | 3300025919 | Bacteria | 2060 |
| 146 | Ga0207652_10033926 | 3300025921 | Bacteria | 4299 |
| 147 | Ga0207652_10304466 | 3300025921 | Bacteria | 1439 |
| 148 | Ga0207646_10056329 | 3300025922 | Bacteria | 3514 |
| 149 | Ga0207694_10009709 | 3300025924 | Bacteria | 7258 |
| 150 | Ga0207694_10114266 | 3300025924 | Bacteria | 2150 |
| 151 | Ga0207700_10014522 | 3300025928 | Bacteria | 5163 |
| 152 | Ga0207700_10048942 | 3300025928 | Bacteria | 3141 |
| 153 | Ga0207664_10050984 | 3300025929 | Bacteria | 3266 |
| 154 | Ga0207664_10211370 | 3300025929 | Bacteria | 1679 |
| 155 | Ga0207664_10221903 | 3300025929 | Bacteria | 1640 |
| 156 | Ga0207664_10374747 | 3300025929 | Bacteria | 1263 |
| 157 | Ga0207690_10145154 | 3300025932 | Bacteria | 1753 |
| 158 | Ga0207706_10267695 | 3300025933 | Bacteria | 1492 |
| 159 | Ga0207689_10026025 | 3300025942 | Bacteria | 4899 |
| 160 | Ga0207661_10021638 | 3300025944 | Bacteria | 4821 |
| 161 | Ga0207661_10031059 | 3300025944 | Bacteria | 4121 |
| 162 | Ga0207679_10034102 | 3300025945 | Unclassified | 3589 |
| 163 | Ga0207667_10176545 | 3300025949 | Bacteria | 2194 |
| 164 | Ga0207668_10036425 | 3300025972 | Bacteria | 3283 |
| 165 | Ga0207640_10020045 | 3300025981 | Bacteria | 3963 |
| 166 | Ga0207639_10054862 | 3300026041 | Bacteria | 3048 |
| 167 | Ga0207639_10144396 | 3300026041 | Bacteria | 1986 |
| 168 | Ga0207678_10066937 | 3300026067 | Bacteria | 3083 |
| 169 | Ga0207708_10040362 | 3300026075 | Bacteria | 3558 |
| 170 | Ga0207702_10000127 | 3300026078 | Bacteria | 89755 |
| 171 | Ga0207641_10007298 | 3300026088 | Bacteria | 9211 |
| 172 | Ga0207641_10059836 | 3300026088 | Bacteria | 3246 |
| 173 | Ga0207674_10044742 | 3300026116 | Bacteria | 4559 |
| 174 | Ga0207683_10026151 | 3300026121 | Bacteria | 5038 |
| 175 | Ga0207698_10043427 | 3300026142 | Bacteria | 3367 |
| 176 | Ga0209389_1000261 | 3300027296 | Bacteria | 33507 |
| 177 | Ga0209489_107409 | 3300027361 | Bacteria | 16395 |
| 178 | Ga0209700_101165 | 3300027363 | Bacteria | 53492 |
| 179 | Ga0268266_10008702 | 3300028379 | Bacteria | 8997 |
| 180 | Ga0268265_10076990 | 3300028380 | Bacteria | 2618 |
| 181 | Ga0307511_10057142 | 3300030521 | Bacteria | 3039 |
| 182 | Ga0265330_10040317 | 3300031235 | Bacteria | 2074 |
| 183 | Ga0265325_10025451 | 3300031241 | Bacteria | 3214 |
| 184 | Ga0265340_10007480 | 3300031247 | Bacteria | 5929 |
| 185 | Ga0265339_10000535 | 3300031249 | Bacteria | 29681 |
| 186 | Ga0265331_10036046 | 3300031250 | Bacteria | 2432 |
| 187 | Ga0265316_10118010 | 3300031344 | Bacteria | 2005 |
| 188 | Ga0307513_10101437 | 3300031456 | Bacteria | 2899 |
| 189 | Ga0307513_10262136 | 3300031456 | Bacteria | 1517 |
| 190 | Ga0307509_10027532 | 3300031507 | Bacteria | 6324 |
| 191 | Ga0265313_10000977 | 3300031595 | Bacteria | 28255 |
| 192 | Ga0307508_10000051 | 3300031616 | Bacteria | 134500 |
| 193 | Ga0307508_10036080 | 3300031616 | Bacteria | 4453 |
| 194 | Ga0307508_10077730 | 3300031616 | Bacteria | 2898 |
| 195 | Ga0265314_10074635 | 3300031711 | Bacteria | 2259 |
| 196 | Ga0265342_10067378 | 3300031712 | Bacteria | 2095 |
| 197 | Ga0307516_10033587 | 3300031730 | Bacteria | 5163 |
| 198 | Ga0307516_10039049 | 3300031730 | Bacteria | 4733 |
| 199 | Ga0307507_10007677 | 3300033179 | Bacteria | 15449 |
| 200 | Ga0373958_0006013 | 3300034819 | Bacteria | 1872 |
| 201 | Ga0373926_0012314 | 3300035083 | Bacteria | 2889 |
| 202 | Ga0373926_0019447 | 3300035083 | Bacteria | 2341 |
| 203 | Ga0373928_0011225 | 3300035084 | Unclassified | 1771 |
| 204 | Ga0373934_0000907 | 3300035086 | Bacteria | 10705 |
| 205 | Ga0373949_0010912 | 3300035090 | Bacteria | 1996 |
| 206 | Ga0373951_0003784 | 3300035091 | Bacteria | 3646 |
| 207 | Ga0373951_0020950 | 3300035091 | Bacteria | 1500 |
| 208 | Ga0373923_0001633 | 3300035111 | Bacteria | 6535 |
| 209 | Ga0373923_0065096 | 3300035111 | Bacteria | 1555 |
| 210 | Ga0373936_0004892 | 3300035113 | Bacteria | 5050 |
| 211 | Ga0373936_0084271 | 3300035113 | Unclassified | 1326 |
| 212 | Ga0373945_0009023 | 3300035116 | Bacteria | 3259 |
| 213 | Ga0373945_0010901 | 3300035116 | Bacteria | 2998 |
| 214 | Ga0373945_0030516 | 3300035116 | Bacteria | 1901 |
| 215 | Ga0373945_0040718 | 3300035116 | Bacteria | 1678 |
| 216 | Ga0373953_0001289 | 3300035117 | Bacteria | 7186 |
| 217 | Ga0373953_0001479 | 3300035117 | Bacteria | 6818 |
| 218 | Ga0373953_0031272 | 3300035117 | Bacteria | 2069 |
| 219 | Ga0373954_0000418 | 3300035118 | Bacteria | 15854 |
| 220 | Ga0373954_0002486 | 3300035118 | Bacteria | 7734 |
| 221 | Ga0373954_0113655 | 3300035118 | Bacteria | 1311 |
| 222 | Ga0373956_0000845 | 3300035119 | Bacteria | 12743 |
| 223 | Ga0373956_0003309 | 3300035119 | Bacteria | 6491 |
| 224 | Ga0373957_0000872 | 3300035120 | Bacteria | 7908 |
| 225 | Ga0373957_0001629 | 3300035120 | Bacteria | 6152 |
| 226 | Ga0373943_0001707 | 3300035170 | Bacteria | 9950 |
| 227 | Ga0373943_0005956 | 3300035170 | Bacteria | 5470 |
| 228 | Ga0373943_0070175 | 3300035170 | Bacteria | 1772 |
| 229 | Ga0373946_0004495 | 3300035171 | Bacteria | 4993 |
| 230 | Ga0373955_0002155 | 3300035172 | Bacteria | 8512 |
| 231 | Ga0373955_0031763 | 3300035172 | Bacteria | 2767 |
| 232 | Ga0373942_0020794 | 3300035207 | Bacteria | 1651 |
| 233 | Ga0373961_0017512 | 3300035241 | Bacteria | 1860 |
| 234 | Ga0373962_0005302 | 3300035242 | Bacteria | 3120 |
| 235 | Ga0373924_0043457 | 3300035410 | Bacteria | 1845 |
| 236 | Ga0373935_0003099 | 3300035692 | Bacteria | 9595 |
| 237 | Ga0373935_0006104 | 3300035692 | Bacteria | 7165 |
| 238 | Ga0373935_0010897 | 3300035692 | Bacteria | 5459 |
| 239 | Ga0373927_0001527 | 3300035695 | Bacteria | 17419 |
| 240 | Ga0373927_0011466 | 3300035695 | Bacteria | 5905 |
| 241 | Ga0373927_0029786 | 3300035695 | Bacteria | 3559 |
| 242 | Ga0373927_0096455 | 3300035695 | Bacteria | 1922 |
| 243 | Ga0373933_0007734 | 3300035724 | Bacteria | 5869 |
| 244 | Ga0373933_0071337 | 3300035724 | Bacteria | 2114 |
| 245 | Ga0373947_0001643 | 3300035725 | Bacteria | 13717 |
| 246 | Ga0373947_0002026 | 3300035725 | Bacteria | 12370 |
| 247 | Ga0373947_0008244 | 3300035725 | Bacteria | 6007 |
| 248 | Ga0373937_0014727 | 3300036401 | Bacteria | 6903 |
| 249 | Ga0373937_0021674 | 3300036401 | Bacteria | 5768 |
| 250 | Ga0373937_0022887 | 3300036401 | Bacteria | 5619 |
| 251 | Ga0373937_0032222 | 3300036401 | Bacteria | 4754 |
| 252 | Ga0373925_0002216 | 3300037068 | Bacteria | 15772 |
| 253 | Ga0373925_0020641 | 3300037068 | Bacteria | 4799 |
| 254 | Ga0373925_0044340 | 3300037068 | Bacteria | 3302 |
| 255 | Ga0373925_0139190 | 3300037068 | Bacteria | 1899 |
| 256 | Ga0373925_0186898 | 3300037068 | Bacteria | 1643 |
| 257 | Ga0373925_0235373 | 3300037068 | Bacteria | 1465 |
| 258 | Ga0395899_0078467 | 3300037312 | Bacteria | 2407 |
| 259 | Ga0395899_0190716 | 3300037312 | Bacteria | 1434 |
| 260 | Ga0395900_0001274 | 3300037418 | Bacteria | 30815 |
| 261 | Ga0395898_0038797 | 3300037466 | Bacteria | 4718 |
| 262 | Ga0395898_0049484 | 3300037466 | Bacteria | 4118 |
| 263 | Ga0395898_0054198 | 3300037466 | Bacteria | 3914 |
| 264 | Ga0436364_0441566 | 3300037853 | Bacteria | 2349 |
| 265 | Ga0395901_0009376 | 3300038443 | Bacteria | 9930 |
| 266 | Ga0436365_0167764 | 3300039437 | Bacteria | 15121 |
| 267 | Ga0436365_1396592 | 3300039437 | Bacteria | 2076 |
| 268 | Ga0436360_0662934 | 3300039438 | Bacteria | 3604 |
| 269 | Ga0436361_0837543 | 3300039447 | Bacteria | 2108 |
| 270 | Ga0436363_0607283 | 3300039450 | Bacteria | 3637 |
| 271 | Ga0436363_1321742 | 3300039450 | Bacteria | 4353 |
| 272 | Ga0466969_0028337 | 3300044656 | Bacteria | 2863 |
| 273 | Ga0466966_0000702 | 3300044684 | Bacteria | 21284 |
| 274 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 275 | Ga0466963_0053240 | 3300044694 | Bacteria | 2687 |
| 276 | Ga0466968_0000345 | 3300044735 | Bacteria | 14999 |
| 277 | Ga0466960_0008575 | 3300044901 | Bacteria | 4189 |
| 278 | Ga0466960_0073971 | 3300044901 | Bacteria | 1702 |
| 279 | Ga0466959_0001046 | 3300045049 | Bacteria | 16580 |
| 280 | Ga0466959_0053950 | 3300045049 | Bacteria | 2938 |
| 281 | Ga0466967_0356510 | 3300045976 | Bacteria | 1416 |
| 282 | Ga0495592_0018086 | 3300046454 | Bacteria | 5354 |
| 283 | Ga0495592_0018978 | 3300046454 | Bacteria | 5234 |
| 284 | Ga0495592_0030706 | 3300046454 | Bacteria | 4064 |
| 285 | Ga0495592_0033549 | 3300046454 | Bacteria | 3871 |
| 286 | Ga0495592_0037943 | 3300046454 | Bacteria | 3626 |
| 287 | Ga0495603_0000874 | 3300046455 | Bacteria | 17304 |
| 288 | Ga0495603_0040550 | 3300046455 | Bacteria | 2786 |
| 289 | Ga0495629_0000439 | 3300046459 | Bacteria | 34692 |
| 290 | Ga0495629_0000957 | 3300046459 | Bacteria | 23286 |
| 291 | Ga0495629_0001624 | 3300046459 | Bacteria | 17672 |
| 292 | Ga0495629_0003662 | 3300046459 | Bacteria | 11620 |
| 293 | Ga0495629_0016837 | 3300046459 | Bacteria | 5247 |
| 294 | Ga0495641_0017557 | 3300046461 | Bacteria | 3725 |
| 295 | Ga0495651_0005010 | 3300046462 | Bacteria | 10118 |
| 296 | Ga0495651_0030252 | 3300046462 | Bacteria | 4222 |
| 297 | Ga0495651_0051126 | 3300046462 | Bacteria | 3187 |
| 298 | Ga0495651_0067234 | 3300046462 | Bacteria | 2734 |
| 299 | Ga0495653_0003152 | 3300046463 | Bacteria | 13226 |
| 300 | Ga0495653_0005267 | 3300046463 | Bacteria | 10524 |
| 301 | Ga0495653_0009243 | 3300046463 | Bacteria | 8065 |
| 302 | Ga0495653_0065763 | 3300046463 | Bacteria | 2728 |
| 303 | Ga0495653_0144111 | 3300046463 | Bacteria | 1672 |
| 304 | Ga0495650_0067316 | 3300046471 | Bacteria | 1415 |
| 305 | Ga0495580_0010813 | 3300046472 | Bacteria | 7086 |
| 306 | Ga0495580_0013917 | 3300046472 | Bacteria | 6124 |
| 307 | Ga0495580_0044645 | 3300046472 | Bacteria | 3151 |
| 308 | Ga0495580_0094615 | 3300046472 | Bacteria | 2078 |
| 309 | Ga0495582_0001713 | 3300046473 | Bacteria | 12367 |
| 310 | Ga0495582_0003251 | 3300046473 | Bacteria | 9124 |
| 311 | Ga0495582_0004193 | 3300046473 | Bacteria | 8104 |
| 312 | Ga0495582_0017650 | 3300046473 | Bacteria | 3904 |
| 313 | Ga0495639_0023423 | 3300046475 | Bacteria | 2713 |
| 314 | Ga0495662_0001221 | 3300046476 | Bacteria | 12639 |
| 315 | Ga0495662_0003347 | 3300046476 | Bacteria | 8127 |
| 316 | Ga0495662_0003360 | 3300046476 | Bacteria | 8115 |
| 317 | Ga0495662_0008624 | 3300046476 | Bacteria | 5009 |
| 318 | Ga0495664_0002496 | 3300046477 | Bacteria | 9884 |
| 319 | Ga0495664_0008760 | 3300046477 | Bacteria | 5651 |
| 320 | Ga0495664_0009612 | 3300046477 | Bacteria | 5412 |
| 321 | Ga0495664_0012243 | 3300046477 | Bacteria | 4858 |
| 322 | Ga0495664_0014189 | 3300046477 | Bacteria | 4513 |
| 323 | Ga0495664_0051252 | 3300046477 | Bacteria | 2451 |
| 324 | Ga0495594_0041782 | 3300046499 | Bacteria | 2510 |
| 325 | Ga0495607_0052550 | 3300046501 | Bacteria | 2360 |
| 326 | Ga0495606_0097769 | 3300046507 | Bacteria | 1793 |
| 327 | Ga0495606_0102164 | 3300046507 | Bacteria | 1743 |
| 328 | Ga0495608_0016278 | 3300046511 | Bacteria | 5143 |
| 329 | Ga0495608_0020011 | 3300046511 | Bacteria | 4602 |
| 330 | Ga0495608_0044795 | 3300046511 | Bacteria | 2951 |
| 331 | Ga0495618_0004727 | 3300046514 | Bacteria | 8329 |
| 332 | Ga0495618_0011000 | 3300046514 | Bacteria | 5482 |
| 333 | Ga0495618_0016732 | 3300046514 | Bacteria | 4491 |
| 334 | Ga0495618_0186858 | 3300046514 | Bacteria | 1315 |
| 335 | Ga0495628_0009164 | 3300046516 | Bacteria | 8462 |
| 336 | Ga0495628_0011453 | 3300046516 | Bacteria | 7499 |
| 337 | Ga0495628_0059791 | 3300046516 | Bacteria | 2991 |
| 338 | Ga0495628_0105381 | 3300046516 | Bacteria | 2172 |
| 339 | Ga0495630_0004053 | 3300046517 | Bacteria | 10260 |
| 340 | Ga0495630_0024054 | 3300046517 | Bacteria | 4504 |
| 341 | Ga0495648_0001613 | 3300046524 | Bacteria | 21927 |
| 342 | Ga0495652_0005540 | 3300046529 | Bacteria | 11876 |
| 343 | Ga0495652_0018046 | 3300046529 | Bacteria | 6294 |
| 344 | Ga0495652_0018986 | 3300046529 | Bacteria | 6125 |
| 345 | Ga0495652_0031735 | 3300046529 | Bacteria | 4623 |
| 346 | Ga0495652_0076070 | 3300046529 | Bacteria | 2786 |
| 347 | Ga0495665_0000555 | 3300046531 | Bacteria | 18998 |
| 348 | Ga0495665_0004987 | 3300046531 | Bacteria | 7152 |
| 349 | Ga0495665_0010902 | 3300046531 | Bacteria | 4918 |
| 350 | Ga0495665_0020528 | 3300046531 | Bacteria | 3547 |
| 351 | Ga0495640_0001232 | 3300046533 | Bacteria | 20045 |
| 352 | Ga0495640_0015329 | 3300046533 | Bacteria | 5769 |
| 353 | Ga0495640_0022937 | 3300046533 | Bacteria | 4559 |
| 354 | Ga0495640_0023532 | 3300046533 | Bacteria | 4484 |
| 355 | Ga0495640_0075883 | 3300046533 | Bacteria | 2244 |
| 356 | Ga0495640_0126912 | 3300046533 | Bacteria | 1654 |
| 357 | Ga0495586_0165123 | 3300046535 | Bacteria | 1250 |
| 358 | Ga0495587_0021844 | 3300046536 | Bacteria | 3947 |
| 359 | Ga0495587_0024180 | 3300046536 | Bacteria | 3726 |
| 360 | Ga0495645_0004096 | 3300046543 | Bacteria | 9951 |
| 361 | Ga0495645_0020702 | 3300046543 | Bacteria | 4749 |
| 362 | Ga0495645_0032362 | 3300046543 | Bacteria | 3814 |
| 363 | Ga0495645_0085788 | 3300046543 | Bacteria | 2253 |
| 364 | Ga0495622_0058139 | 3300046557 | Bacteria | 1791 |
| 365 | Ga0495667_0003416 | 3300046559 | Bacteria | 10642 |
| 366 | Ga0495667_0006509 | 3300046559 | Bacteria | 7929 |
| 367 | Ga0495667_0007486 | 3300046559 | Bacteria | 7405 |
| 368 | Ga0495667_0017156 | 3300046559 | Bacteria | 4890 |
| 369 | Ga0495634_0003146 | 3300046642 | Bacteria | 13385 |
| 370 | Ga0495634_0011308 | 3300046642 | Bacteria | 6499 |
| 371 | Ga0495634_0021994 | 3300046642 | Bacteria | 4497 |
| 372 | Ga0495634_0053532 | 3300046642 | Bacteria | 2703 |
| 373 | Ga0495635_0001321 | 3300046663 | Bacteria | 16507 |
| 374 | Ga0495635_0001430 | 3300046663 | Bacteria | 15944 |
| 375 | Ga0495635_0003515 | 3300046663 | Bacteria | 10840 |
| 376 | Ga0495635_0004888 | 3300046663 | Bacteria | 9327 |
| 377 | Ga0495635_0029753 | 3300046663 | Bacteria | 3798 |
| 378 | Ga0495635_0099846 | 3300046663 | Bacteria | 1984 |
| 379 | Ga0495588_0024577 | 3300046674 | Bacteria | 2994 |
| 380 | Ga0495588_0094420 | 3300046674 | Bacteria | 1568 |
| 381 | Ga0495657_0011371 | 3300046675 | Bacteria | 6658 |
| 382 | Ga0495657_0016293 | 3300046675 | Bacteria | 5418 |
| 383 | Ga0495657_0019090 | 3300046675 | Bacteria | 4951 |
| 384 | Ga0495599_0005440 | 3300046678 | Bacteria | 7612 |
| 385 | Ga0495599_0009549 | 3300046678 | Bacteria | 5932 |
| 386 | Ga0495623_0005927 | 3300046679 | Bacteria | 7963 |
| 387 | Ga0495623_0011605 | 3300046679 | Bacteria | 5705 |
| 388 | Ga0495646_0003601 | 3300046680 | Bacteria | 9670 |
| 389 | Ga0495646_0050400 | 3300046680 | Bacteria | 2524 |
| 390 | Ga0495647_0013806 | 3300046681 | Bacteria | 2805 |
| 391 | Ga0495647_0048218 | 3300046681 | Bacteria | 1646 |
| 392 | Ga0495658_0003018 | 3300046683 | Bacteria | 8431 |
| 393 | Ga0495658_0007236 | 3300046683 | Bacteria | 5483 |
| 394 | Ga0495658_0028955 | 3300046683 | Bacteria | 2993 |
| 395 | Ga0495669_0016999 | 3300046684 | Bacteria | 3120 |
| 396 | Ga0495613_0007405 | 3300046689 | Bacteria | 8180 |
| 397 | Ga0495613_0007855 | 3300046689 | Bacteria | 7934 |
| 398 | Ga0495613_0022781 | 3300046689 | Bacteria | 4667 |
| 399 | Ga0495613_0061250 | 3300046689 | Bacteria | 2756 |
| 400 | Ga0495624_0010732 | 3300046690 | Bacteria | 6311 |
| 401 | Ga0495624_0015569 | 3300046690 | Bacteria | 5132 |
| 402 | Ga0495670_0016635 | 3300046691 | Bacteria | 3617 |
| 403 | Ga0495670_0098618 | 3300046691 | Bacteria | 1503 |
| 404 | Ga0495649_0026330 | 3300046694 | Bacteria | 3235 |
| 405 | Ga0495600_0001772 | 3300046809 | Bacteria | 12077 |
| 406 | Ga0495600_0002854 | 3300046809 | Bacteria | 10059 |
| 407 | Ga0495600_0015929 | 3300046809 | Bacteria | 4763 |
| 408 | Ga0495600_0019448 | 3300046809 | Bacteria | 4337 |
| 409 | Ga0495600_0054423 | 3300046809 | Bacteria | 2614 |
| 410 | Ga0495600_0121957 | 3300046809 | Bacteria | 1695 |
| 411 | Ga0495581_0000019 | 3300047315 | Bacteria | 57810 |
| 412 | Ga0495581_0018778 | 3300047315 | Bacteria | 4013 |
| 413 | Ga0495581_0194816 | 3300047315 | Bacteria | 1185 |
| 414 | Ga0495604_0009404 | 3300047317 | Bacteria | 7729 |
| 415 | Ga0495604_0021441 | 3300047317 | Bacteria | 5158 |
| 416 | Ga0495604_0024159 | 3300047317 | Bacteria | 4851 |
| 417 | Ga0495604_0133743 | 3300047317 | Bacteria | 1779 |
| 418 | Ga0495604_0143864 | 3300047317 | Bacteria | 1701 |
| 419 | Ga0495674_0000458 | 3300047319 | Bacteria | 36828 |
| 420 | Ga0495674_0004826 | 3300047319 | Bacteria | 12966 |
| 421 | Ga0495674_0007899 | 3300047319 | Bacteria | 10158 |
| 422 | Ga0495674_0024761 | 3300047319 | Bacteria | 5510 |
| 423 | Ga0495674_0051900 | 3300047319 | Bacteria | 3612 |
| 424 | Ga0495674_0069090 | 3300047319 | Bacteria | 3055 |
| 425 | Ga0495674_0393141 | 3300047319 | Bacteria | 1120 |
| 426 | Ga0495676_0012040 | 3300047321 | Bacteria | 7801 |
| 427 | Ga0495676_0140096 | 3300047321 | Bacteria | 1734 |
| 428 | Ga0495680_0002514 | 3300047322 | Bacteria | 18756 |
| 429 | Ga0495680_0006264 | 3300047322 | Bacteria | 11086 |
| 430 | Ga0495680_0006358 | 3300047322 | Bacteria | 10996 |
| 431 | Ga0495680_0006496 | 3300047322 | Bacteria | 10851 |
| 432 | Ga0495680_0053859 | 3300047322 | Bacteria | 3127 |
| 433 | Ga0495683_0029663 | 3300047323 | Bacteria | 2795 |
| 434 | Ga0495675_0003040 | 3300047444 | Bacteria | 10086 |
| 435 | Ga0495675_0019849 | 3300047444 | Bacteria | 4270 |
| 436 | Ga0495675_0114566 | 3300047444 | Bacteria | 1681 |
| 437 | Ga0495673_0067486 | 3300047469 | Bacteria | 1514 |
| 438 | Ga0495684_0000858 | 3300047471 | Bacteria | 24643 |
| 439 | Ga0495684_0012483 | 3300047471 | Bacteria | 6547 |
| 440 | Ga0495684_0015123 | 3300047471 | Bacteria | 5943 |
| 441 | Ga0495684_0016167 | 3300047471 | Bacteria | 5746 |
| 442 | Ga0495684_0016590 | 3300047471 | Bacteria | 5673 |
| 443 | Ga0495684_0025610 | 3300047471 | Bacteria | 4532 |
| 444 | Ga0495684_0144597 | 3300047471 | Bacteria | 1782 |
| 445 | Ga0495686_0089907 | 3300047472 | Bacteria | 1865 |
| 446 | Ga0495686_0093319 | 3300047472 | Bacteria | 1825 |
| 447 | Ga0495593_0001308 | 3300047673 | Bacteria | 14618 |
| 448 | Ga0495593_0007997 | 3300047673 | Bacteria | 6157 |
| 449 | Ga0495593_0025486 | 3300047673 | Bacteria | 3273 |
| 450 | Ga0495593_0049823 | 3300047673 | Bacteria | 2221 |
| 451 | Ga0495593_0072701 | 3300047673 | Bacteria | 1784 |
| 452 | Ga0495602_0021970 | 3300048088 | Bacteria | 6257 |
| 453 | Ga0495602_0042156 | 3300048088 | Bacteria | 4161 |
| 454 | Ga0495602_0045631 | 3300048088 | Bacteria | 3964 |
| 455 | Ga0495602_0137898 | 3300048088 | Bacteria | 1935 |
| 456 | Ga0496100_0048412 | 3300048903 | Bacteria | 2743 |
| 457 | Ga0496101_0092273 | 3300048904 | Bacteria | 2254 |
| 458 | Ga0496101_0172164 | 3300048904 | Bacteria | 1664 |
| 459 | Ga0496102_0185629 | 3300048905 | Bacteria | 1960 |
| 460 | Ga0496103_0003032 | 3300048906 | Bacteria | 10350 |
| 461 | Ga0496104_0007805 | 3300048907 | Bacteria | 9484 |
| 462 | Ga0496104_0106758 | 3300048907 | Bacteria | 2683 |
| 463 | Ga0496104_0147831 | 3300048907 | Bacteria | 2256 |
| 464 | Ga0496105_0109466 | 3300048908 | Bacteria | 2281 |
| 465 | Ga0496106_0072829 | 3300048909 | Bacteria | 2628 |
| 466 | Ga0496108_0101584 | 3300048911 | Bacteria | 2453 |
| 467 | Ga0496109_0072033 | 3300048912 | Unclassified | 3173 |
| 468 | Ga0496109_0156512 | 3300048912 | Bacteria | 2134 |
| 469 | Ga0496109_0216064 | 3300048912 | Bacteria | 1803 |
| 470 | Ga0496110_0059420 | 3300048913 | Bacteria | 3370 |
| 471 | Ga0496111_0110818 | 3300048914 | Bacteria | 2021 |
| 472 | Ga0496111_0186190 | 3300048914 | Bacteria | 1543 |
| 473 | Ga0496112_0013614 | 3300048915 | Bacteria | 7517 |
| 474 | Ga0496112_0035370 | 3300048915 | Bacteria | 4865 |
| 475 | Ga0496112_0155142 | 3300048915 | Bacteria | 2256 |
| 476 | Ga0496112_0226557 | 3300048915 | Bacteria | 1824 |
| 477 | Ga0496113_0043810 | 3300048916 | Unclassified | 3313 |
| 478 | Ga0496113_0059137 | 3300048916 | Bacteria | 2886 |
| 479 | Ga0496115_0006490 | 3300048918 | Bacteria | 8574 |
| 480 | Ga0496117_0005455 | 3300048920 | Bacteria | 13342 |
| 481 | Ga0496121_0004013 | 3300048924 | Bacteria | 20280 |
| 482 | Ga0496121_0068786 | 3300048924 | Bacteria | 2862 |
| 483 | Ga0496121_0098894 | 3300048924 | Bacteria | 2256 |
| 484 | Ga0496121_0099505 | 3300048924 | Bacteria | 2247 |
| 485 | Ga0496124_0001073 | 3300048927 | Bacteria | 43225 |
| 486 | Ga0496124_0145324 | 3300048927 | Bacteria | 1867 |
| 487 | Ga0496125_0000199 | 3300048928 | Bacteria | 126676 |
| 488 | Ga0496125_0000629 | 3300048928 | Bacteria | 59181 |
| 489 | Ga0496126_0003114 | 3300048929 | Bacteria | 21387 |
| 490 | Ga0496126_0027371 | 3300048929 | Bacteria | 5446 |
| 491 | Ga0496126_0032011 | 3300048929 | Bacteria | 4960 |
| 492 | Ga0496126_0046721 | 3300048929 | Bacteria | 3967 |
| 493 | Ga0496126_0049448 | 3300048929 | Bacteria | 3838 |
| 494 | Ga0496126_0051609 | 3300048929 | Bacteria | 3743 |
| 495 | Ga0496126_0086729 | 3300048929 | Bacteria | 2759 |
| 496 | Ga0496126_0185277 | 3300048929 | Bacteria | 1765 |
| 497 | Ga0496126_0287752 | 3300048929 | Bacteria | 1360 |
| 498 | Ga0501032_0071686 | 3300049569 | Bacteria | 2309 |
| 499 | Ga0501034_0154664 | 3300049571 | Bacteria | 2268 |
| 500 | Ga0501037_0165688 | 3300049573 | Bacteria | 1574 |
| 501 | Ga0501039_0004638 | 3300049575 | Bacteria | 10391 |
| 502 | Ga0501040_0006035 | 3300049576 | Bacteria | 7842 |
| 503 | Ga0501041_0004005 | 3300049577 | Bacteria | 8503 |
| 504 | Ga0501042_0004901 | 3300049578 | Bacteria | 8567 |
| 505 | Ga0501043_0059317 | 3300049579 | Unclassified | 3003 |
| 506 | Ga0501043_0113158 | 3300049579 | Bacteria | 2131 |
| 507 | Ga0501046_0017346 | 3300049580 | Bacteria | 6011 |
| 508 | Ga0501046_0104763 | 3300049580 | Bacteria | 2167 |
| 509 | Ga0501047_0005748 | 3300049581 | Bacteria | 11674 |
| 510 | Ga0501047_0057751 | 3300049581 | Bacteria | 3752 |
| 511 | Ga0501047_0099096 | 3300049581 | Bacteria | 2793 |
| 512 | Ga0501048_0052580 | 3300049582 | Bacteria | 2899 |
| 513 | Ga0501048_0269413 | 3300049582 | Bacteria | 1210 |
| 514 | Ga0501067_0072683 | 3300049583 | Bacteria | 1905 |
| 515 | Ga0501068_0048432 | 3300049584 | Unclassified | 2566 |
| 516 | Ga0501070_0033964 | 3300049586 | Bacteria | 4267 |
| 517 | Ga0501071_0008679 | 3300049587 | Bacteria | 6723 |
| 518 | Ga0501072_0053566 | 3300049588 | Bacteria | 3177 |
| 519 | Ga0501073_0014495 | 3300049589 | Bacteria | 5728 |
| 520 | Ga0501074_0032392 | 3300049590 | Bacteria | 3787 |
| 521 | Ga0501075_0035458 | 3300049591 | Bacteria | 3720 |
| 522 | Ga0501075_0273636 | 3300049591 | Bacteria | 1287 |
| 523 | Ga0501076_0005914 | 3300049592 | Bacteria | 8829 |
| 524 | Ga0501077_0004218 | 3300049593 | Bacteria | 8686 |
| 525 | Ga0501079_0006176 | 3300049741 | Bacteria | 8986 |
| 526 | Ga0501080_0044549 | 3300049742 | Bacteria | 4130 |
| 527 | Ga0501081_0004561 | 3300049743 | Bacteria | 8897 |
| 528 | Ga0501083_0130625 | 3300049744 | Bacteria | 1646 |
| 529 | Ga0501035_0040687 | 3300049822 | Bacteria | 4199 |
| 530 | Ga0501035_0298375 | 3300049822 | Bacteria | 1358 |
| 531 | Ga0501044_0012350 | 3300049823 | Bacteria | 9244 |
| 532 | Ga0501044_0050167 | 3300049823 | Bacteria | 4307 |
| 533 | Ga0501045_0009753 | 3300049824 | Bacteria | 6716 |
| 534 | nmdc:mga03n38_125282_c1 | 3300050490 | Bacteria | 1267 |
| 535 | nmdc:mga03n38_29891_c1 | 3300050490 | Bacteria | 2285 |
| 536 | nmdc:mga00v17_36387_c1 | 3300050491 | Bacteria | 2933 |
| 537 | nmdc:mga0yw44_22966_c1 | 3300050492 | Bacteria | 3507 |
| 538 | nmdc:mga06z11_5354_c1 | 3300050494 | Bacteria | 5139 |
| 539 | nmdc:mga07m45_122990_c1 | 3300050496 | Bacteria | 1499 |
| 540 | nmdc:mga05p37_284586_c1 | 3300050507 | Bacteria | 1970 |
| 541 | nmdc:mga09592_2511_c1 | 3300050508 | Bacteria | 14842 |
| 542 | nmdc:mga08y16_61191_c1 | 3300050511 | Bacteria | 3931 |
| 543 | nmdc:mga0n895_8527_c1 | 3300050512 | Bacteria | 8881 |
| 544 | nmdc:mga0rr50_93390_c1 | 3300050513 | Bacteria | 2347 |
| 545 | Ga0495601_0053353 | 3300053077 | Bacteria | 2555 |
| 546 | Ga0495601_0127727 | 3300053077 | Unclassified | 1654 |
| 547 | Ga0495612_0004870 | 3300053078 | Bacteria | 5560 |
| 548 | Ga0495612_0007244 | 3300053078 | Bacteria | 4539 |
| 549 | Ga0495612_0058321 | 3300053078 | Bacteria | 1595 |
| 550 | Ga0495595_0001002 | 3300053084 | Bacteria | 10896 |
| 551 | Ga0495595_0001906 | 3300053084 | Bacteria | 8109 |
| 552 | Ga0495595_0010918 | 3300053084 | Bacteria | 3789 |
| 553 | Ga0495619_0000535 | 3300053085 | Bacteria | 25107 |
| 554 | Ga0495619_0001280 | 3300053085 | Bacteria | 16510 |
| 555 | Ga0495619_0002556 | 3300053085 | Bacteria | 11906 |
| 556 | Ga0495619_0046296 | 3300053085 | Bacteria | 2859 |
| 557 | Ga0495619_0164526 | 3300053085 | Bacteria | 1533 |
| 558 | Ga0500647_0064247 | 3300053091 | Bacteria | 1765 |
| 559 | Ga0500651_0037538 | 3300053093 | Bacteria | 3053 |
| 560 | Ga0500566_0000046 | 3300053094 | Bacteria | 59187 |
| 561 | Ga0500566_0004284 | 3300053094 | Bacteria | 8517 |
| 562 | Ga0500640_005282 | 3300053095 | Bacteria | 4796 |
| 563 | Ga0500641_0002242 | 3300053096 | Bacteria | 6842 |
| 564 | Ga0500641_0004452 | 3300053096 | Bacteria | 4953 |
| 565 | Ga0500572_002369 | 3300053111 | Bacteria | 4548 |
| 566 | Ga0500591_086145 | 3300053115 | Bacteria | 1383 |
| 567 | Ga0500595_000391 | 3300053119 | Bacteria | 28235 |
| 568 | Ga0500595_001395 | 3300053119 | Bacteria | 12953 |
| 569 | Ga0500607_055938 | 3300053121 | Bacteria | 2084 |
| 570 | Ga0500608_004894 | 3300053122 | Bacteria | 5244 |
| 571 | Ga0500608_081580 | 3300053122 | Bacteria | 1525 |
| 572 | Ga0500614_001648 | 3300053123 | Bacteria | 5243 |
| 573 | Ga0500614_003833 | 3300053123 | Bacteria | 3216 |
| 574 | Ga0500652_000019 | 3300053131 | Bacteria | 120149 |
| 575 | Ga0500559_0001633 | 3300053136 | Bacteria | 12428 |
| 576 | Ga0500577_0000239 | 3300053142 | Bacteria | 14570 |
| 577 | Ga0500590_057400 | 3300053148 | Bacteria | 1964 |
| 578 | Ga0500603_000071 | 3300053150 | Bacteria | 23487 |
| 579 | Ga0500603_000328 | 3300053150 | Bacteria | 12422 |
| 580 | Ga0500604_0000357 | 3300053151 | Bacteria | 12630 |
| 581 | Ga0500616_0001397 | 3300053153 | Bacteria | 23247 |
| 582 | Ga0500630_009402 | 3300053159 | Bacteria | 4797 |
| 583 | Ga0500634_0029111 | 3300053161 | Bacteria | 3010 |
| 584 | Ga0500638_002339 | 3300053162 | Bacteria | 6552 |
| 585 | Ga0500639_000009 | 3300053163 | Bacteria | 139043 |
| 586 | Ga0500636_0004982 | 3300053177 | Bacteria | 7538 |
| 587 | Ga0500636_0005231 | 3300053177 | Bacteria | 7387 |
| 588 | Ga0500637_0000262 | 3300053178 | Bacteria | 19711 |
| 589 | Ga0500637_0027684 | 3300053178 | Bacteria | 3130 |
| 590 | Ga0500576_074026 | 3300053725 | Bacteria | 1457 |
| 591 | Ga0500625_025869 | 3300053729 | Bacteria | 2777 |
| 592 | Ga0500596_002470 | 3300053735 | Bacteria | 3644 |
| 593 | Ga0500596_010113 | 3300053735 | Bacteria | 1463 |
| 594 | Ga0501084_0000249 | 3300054114 | Bacteria | 40750 |
| 595 | Ga0500661_000172 | 3300055283 | Bacteria | 11274 |
| 596 | Ga0500661_009841 | 3300055283 | Bacteria | 1744 |
| 597 | Ga0501082_0026523 | 3300060353 | Bacteria | 4994 |
| 598 | Ga0501082_0276691 | 3300060353 | Bacteria | 1461 |
| 599 | Ga0466962_0057141 | 3300061719 | Bacteria | 1863 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025929 | Ga0207664_10374747 | Ga0207664_103747472 | 338 |
| 2 | 3300046543 | Ga0495645_0085788 | Ga0495645_0085788_16_1050 | 344 |
| 3 | 3300047319 | Ga0495674_0393141 | Ga0495674_0393141_39_1109 | 350 |
| 4 | 3300048929 | Ga0496126_0046721 | Ga0496126_0046721_2817_3953 | 363 |
| 5 | 3300005439 | Ga0070711_100105384 | Ga0070711_1001053842 | 364 |
| 6 | 3300060353 | Ga0501082_0276691 | Ga0501082_0276691_264_1370 | 366 |
| 7 | iso_pu_bacteria | 8019538911 | 8019546719 | 367 |
| 8 | 3300046514 | Ga0495618_0186858 | Ga0495618_0186858_183_1289 | 368 |
| 9 | 3300046454 | Ga0495592_0030706 | Ga0495592_0030706_19_1128 | 369 |
| 10 | 3300049582 | Ga0501048_0269413 | Ga0501048_0269413_43_1152 | 369 |
| 11 | 3300046516 | Ga0495628_0105381 | Ga0495628_0105381_26_1141 | 371 |
| 12 | 3300047472 | Ga0495686_0093319 | Ga0495686_0093319_60_1175 | 371 |
| 13 | 3300053085 | Ga0495619_0164526 | Ga0495619_0164526_24_1139 | 371 |
| 14 | 3300003215 | JGI25153J46596_10000062 | JGI25153J46596_1000006225 | 378 |
| 15 | 3300009147 | Ga0114129_10017461 | Ga0114129_100174618 | 378 |
| 16 | 3300025297 | Ga0209758_1000029 | Ga0209758_1000029271 | 378 |
| 17 | 3300053151 | Ga0500604_0000357 | Ga0500604_0000357_5221_6402 | 378 |
| 18 | 3300039437 | Ga0436365_1396592 | Ga0436365_1396592_734_1900 | 379 |
| 19 | 3300046642 | Ga0495634_0021994 | Ga0495634_0021994_341_1513 | 379 |
| 20 | 3300046691 | Ga0495670_0016635 | Ga0495670_0016635_340_1509 | 379 |
| 21 | 3300047471 | Ga0495684_0025610 | Ga0495684_0025610_2525_3697 | 379 |
| 22 | 3300053093 | Ga0500651_0037538 | Ga0500651_0037538_306_1490 | 379 |
| 23 | 3300053096 | Ga0500641_0002242 | Ga0500641_0002242_1969_3150 | 379 |
| 24 | 3300031456 | Ga0307513_10101437 | Ga0307513_101014372 | 380 |
| 25 | 3300049573 | Ga0501037_0165688 | Ga0501037_0165688_217_1386 | 380 |
| 26 | 3300049581 | Ga0501047_0057751 | Ga0501047_0057751_922_2091 | 380 |
| 27 | 3300049744 | Ga0501083_0130625 | Ga0501083_0130625_419_1588 | 380 |
| 28 | iso_pu_bacteria | 2879083081 | 2879084109 | 380 |
| 29 | 3300025914 | Ga0207671_10144524 | Ga0207671_101445241 | 381 |
| 30 | 3300046535 | Ga0495586_0165123 | Ga0495586_0165123_82_1236 | 381 |
| 31 | 3300047315 | Ga0495581_0194816 | Ga0495581_0194816_11_1165 | 381 |
| 32 | 3300049579 | Ga0501043_0113158 | Ga0501043_0113158_306_1496 | 381 |
| 33 | 3300049581 | Ga0501047_0099096 | Ga0501047_0099096_870_2060 | 381 |
| 34 | 3300049586 | Ga0501070_0033964 | Ga0501070_0033964_1714_2904 | 381 |
| 35 | 3300049822 | Ga0501035_0298375 | Ga0501035_0298375_26_1216 | 381 |
| 36 | 3300049823 | Ga0501044_0050167 | Ga0501044_0050167_1188_2378 | 381 |
| 37 | 3300025298 | Ga0209050_1004404 | Ga0209050_10044043 | 382 |
| 38 | 3300025304 | Ga0209257_1000418 | Ga0209257_100041894 | 382 |
| 39 | 3300031616 | Ga0307508_10077730 | Ga0307508_100777302 | 382 |
| 40 | 3300046454 | Ga0495592_0037943 | Ga0495592_0037943_1980_3149 | 382 |
| 41 | 3300049591 | Ga0501075_0273636 | Ga0501075_0273636_16_1221 | 382 |
| 42 | 3300053119 | Ga0500595_000391 | Ga0500595_000391_1429_2628 | 382 |
| 43 | 3300053153 | Ga0500616_0001397 | Ga0500616_0001397_14712_15908 | 382 |
| 44 | 3300053177 | Ga0500636_0005231 | Ga0500636_0005231_1652_2887 | 382 |
| 45 | 3300025915 | Ga0207693_10020503 | Ga0207693_100205033 | 384 |
| 46 | 3300035113 | Ga0373936_0084271 | Ga0373936_0084271_98_1273 | 384 |
| 47 | 3300035116 | Ga0373945_0009023 | Ga0373945_0009023_911_2086 | 384 |
| 48 | 3300035118 | Ga0373954_0113655 | Ga0373954_0113655_97_1284 | 384 |
| 49 | 3300035170 | Ga0373943_0005956 | Ga0373943_0005956_680_1855 | 384 |
| 50 | 3300035692 | Ga0373935_0010897 | Ga0373935_0010897_3657_4832 | 384 |
| 51 | 3300036401 | Ga0373937_0032222 | Ga0373937_0032222_627_1802 | 384 |
| 52 | 3300044656 | Ga0466969_0028337 | Ga0466969_0028337_1173_2336 | 384 |
| 53 | 3300044684 | Ga0466966_0000702 | Ga0466966_0000702_16996_18159 | 384 |
| 54 | 3300044693 | Ga0466961_0000005 | Ga0466961_0000005_163288_164451 | 384 |
| 55 | 3300045049 | Ga0466959_0001046 | Ga0466959_0001046_1152_2315 | 384 |
| 56 | 3300046459 | Ga0495629_0001624 | Ga0495629_0001624_720_1895 | 384 |
| 57 | 3300046462 | Ga0495651_0067234 | Ga0495651_0067234_323_1498 | 384 |
| 58 | 3300046463 | Ga0495653_0005267 | Ga0495653_0005267_979_2154 | 384 |
| 59 | 3300046473 | Ga0495582_0001713 | Ga0495582_0001713_548_1723 | 384 |
| 60 | 3300046475 | Ga0495639_0023423 | Ga0495639_0023423_492_1667 | 384 |
| 61 | 3300046476 | Ga0495662_0003347 | Ga0495662_0003347_6640_7815 | 384 |
| 62 | 3300046511 | Ga0495608_0044795 | Ga0495608_0044795_1261_2436 | 384 |
| 63 | 3300046514 | Ga0495618_0011000 | Ga0495618_0011000_178_1353 | 384 |
| 64 | 3300046517 | Ga0495630_0004053 | Ga0495630_0004053_262_1437 | 384 |
| 65 | 3300046531 | Ga0495665_0004987 | Ga0495665_0004987_2295_3470 | 384 |
| 66 | 3300046533 | Ga0495640_0015329 | Ga0495640_0015329_3806_4981 | 384 |
| 67 | 3300046559 | Ga0495667_0006509 | Ga0495667_0006509_6108_7283 | 384 |
| 68 | 3300046663 | Ga0495635_0004888 | Ga0495635_0004888_1523_2698 | 384 |
| 69 | 3300046681 | Ga0495647_0048218 | Ga0495647_0048218_455_1630 | 384 |
| 70 | 3300046683 | Ga0495658_0007236 | Ga0495658_0007236_1088_2263 | 384 |
| 71 | 3300046809 | Ga0495600_0019448 | Ga0495600_0019448_2763_3938 | 384 |
| 72 | 3300047319 | Ga0495674_0069090 | Ga0495674_0069090_1645_2820 | 384 |
| 73 | 3300047321 | Ga0495676_0012040 | Ga0495676_0012040_5941_7116 | 384 |
| 74 | 3300047322 | Ga0495680_0006358 | Ga0495680_0006358_8932_10107 | 384 |
| 75 | 3300047471 | Ga0495684_0000858 | Ga0495684_0000858_14824_15999 | 384 |
| 76 | 3300048905 | Ga0496102_0185629 | Ga0496102_0185629_226_1389 | 384 |
| 77 | 3300053077 | Ga0495601_0127727 | Ga0495601_0127727_404_1579 | 384 |
| 78 | 3300053078 | Ga0495612_0004870 | Ga0495612_0004870_736_1911 | 384 |
| 79 | 3300053084 | Ga0495595_0001002 | Ga0495595_0001002_8331_9506 | 384 |
| 80 | 3300053085 | Ga0495619_0002556 | Ga0495619_0002556_4446_5621 | 384 |
| 81 | 3300053177 | Ga0500636_0004982 | Ga0500636_0004982_1058_2278 | 385 |
| 82 | 3300005445 | Ga0070708_100137557 | Ga0070708_1001375572 | 386 |
| 83 | 3300005468 | Ga0070707_100135156 | Ga0070707_1001351562 | 386 |
| 84 | 3300005842 | Ga0068858_100037097 | Ga0068858_1000370972 | 386 |
| 85 | 3300006880 | Ga0075429_100001515 | Ga0075429_10000151523 | 386 |
| 86 | 3300025922 | Ga0207646_10056329 | Ga0207646_100563292 | 386 |
| 87 | 3300031249 | Ga0265339_10000535 | Ga0265339_1000053515 | 386 |
| 88 | 3300031344 | Ga0265316_10118010 | Ga0265316_101180102 | 386 |
| 89 | 3300031595 | Ga0265313_10000977 | Ga0265313_100009777 | 386 |
| 90 | 3300035724 | Ga0373933_0071337 | Ga0373933_0071337_144_1313 | 386 |
| 91 | 3300046501 | Ga0495607_0052550 | Ga0495607_0052550_1107_2297 | 386 |
| 92 | 3300048928 | Ga0496125_0000199 | Ga0496125_0000199_121811_122980 | 386 |
| 93 | 3300049571 | Ga0501034_0154664 | Ga0501034_0154664_824_1999 | 386 |
| 94 | 3300050508 | nmdc:mga09592_2511_c1 | nmdc:mga09592_2511_c1_2073_3263 | 386 |
| 95 | 3300053131 | Ga0500652_000019 | Ga0500652_000019_29198_30418 | 386 |
| 96 | iso_pu_bacteria | 2513237098 | 2513678781 | 386 |
| 97 | iso_pu_bacteria | 2513237141 | 2513887308 | 386 |
| 98 | iso_pu_bacteria | 2903768456 | 2903773180 | 386 |
| 99 | 3300005334 | Ga0068869_100118884 | Ga0068869_1001188841 | 387 |
| 100 | 3300005365 | Ga0070688_100071883 | Ga0070688_1000718832 | 387 |
| 101 | 3300005614 | Ga0068856_100227964 | Ga0068856_1002279642 | 387 |
| 102 | 3300005841 | Ga0068863_100001400 | Ga0068863_1000014007 | 387 |
| 103 | 3300009101 | Ga0105247_10046751 | Ga0105247_100467512 | 387 |
| 104 | 3300014968 | Ga0157379_10042403 | Ga0157379_100424033 | 387 |
| 105 | 3300026088 | Ga0207641_10007298 | Ga0207641_100072982 | 387 |
| 106 | 3300048908 | Ga0496105_0109466 | Ga0496105_0109466_932_2122 | 387 |
| 107 | 3300005335 | Ga0070666_10141848 | Ga0070666_101418481 | 388 |
| 108 | 3300005355 | Ga0070671_100117683 | Ga0070671_1001176832 | 388 |
| 109 | 3300005367 | Ga0070667_100017334 | Ga0070667_1000173342 | 388 |
| 110 | 3300005437 | Ga0070710_10127666 | Ga0070710_101276661 | 388 |
| 111 | 3300005439 | Ga0070711_100075879 | Ga0070711_1000758792 | 388 |
| 112 | 3300005441 | Ga0070700_100138399 | Ga0070700_1001383992 | 388 |
| 113 | 3300005564 | Ga0070664_100045408 | Ga0070664_1000454083 | 388 |
| 114 | 3300005618 | Ga0068864_100073054 | Ga0068864_1000730542 | 388 |
| 115 | 3300005937 | Ga0081455_10218633 | Ga0081455_102186331 | 388 |
| 116 | 3300005983 | Ga0081540_1007903 | Ga0081540_10079032 | 388 |
| 117 | 3300006175 | Ga0070712_100085832 | Ga0070712_1000858322 | 388 |
| 118 | 3300006871 | Ga0075434_100144005 | Ga0075434_1001440052 | 388 |
| 119 | 3300006914 | Ga0075436_100017068 | Ga0075436_1000170684 | 388 |
| 120 | 3300007076 | Ga0075435_100027515 | Ga0075435_1000275153 | 388 |
| 121 | 3300009177 | Ga0105248_10020735 | Ga0105248_100207352 | 388 |
| 122 | 3300009553 | Ga0105249_10185633 | Ga0105249_101856332 | 388 |
| 123 | 3300009553 | Ga0105249_10196118 | Ga0105249_101961182 | 388 |
| 124 | 3300011119 | Ga0105246_10072405 | Ga0105246_100724052 | 388 |
| 125 | 3300014325 | Ga0163163_10008168 | Ga0163163_100081688 | 388 |
| 126 | 3300025907 | Ga0207645_10077238 | Ga0207645_100772382 | 388 |
| 127 | 3300025915 | Ga0207693_10007068 | Ga0207693_100070685 | 388 |
| 128 | 3300025919 | Ga0207657_10130427 | Ga0207657_101304272 | 388 |
| 129 | 3300025942 | Ga0207689_10026025 | Ga0207689_100260252 | 388 |
| 130 | 3300025945 | Ga0207679_10034102 | Ga0207679_100341022 | 388 |
| 131 | 3300026121 | Ga0207683_10026151 | Ga0207683_100261514 | 388 |
| 132 | 3300028379 | Ga0268266_10008702 | Ga0268266_100087023 | 388 |
| 133 | 3300034819 | Ga0373958_0006013 | Ga0373958_0006013_78_1277 | 388 |
| 134 | 3300035084 | Ga0373928_0011225 | Ga0373928_0011225_515_1714 | 388 |
| 135 | 3300035090 | Ga0373949_0010912 | Ga0373949_0010912_781_1977 | 388 |
| 136 | 3300035091 | Ga0373951_0003784 | Ga0373951_0003784_342_1541 | 388 |
| 137 | 3300035091 | Ga0373951_0020950 | Ga0373951_0020950_135_1331 | 388 |
| 138 | 3300035170 | Ga0373943_0070175 | Ga0373943_0070175_303_1502 | 388 |
| 139 | 3300035207 | Ga0373942_0020794 | Ga0373942_0020794_284_1483 | 388 |
| 140 | 3300035241 | Ga0373961_0017512 | Ga0373961_0017512_235_1434 | 388 |
| 141 | 3300035242 | Ga0373962_0005302 | Ga0373962_0005302_1277_2476 | 388 |
| 142 | 3300035692 | Ga0373935_0006104 | Ga0373935_0006104_1062_2261 | 388 |
| 143 | 3300035725 | Ga0373947_0001643 | Ga0373947_0001643_12098_13303 | 388 |
| 144 | 3300035725 | Ga0373947_0002026 | Ga0373947_0002026_2195_3394 | 388 |
| 145 | 3300037068 | Ga0373925_0020641 | Ga0373925_0020641_378_1577 | 388 |
| 146 | 3300039447 | Ga0436361_0837543 | Ga0436361_0837543_528_1778 | 388 |
| 147 | 3300039450 | Ga0436363_1321742 | Ga0436363_1321742_1919_3169 | 388 |
| 148 | 3300046459 | Ga0495629_0003662 | Ga0495629_0003662_7474_8673 | 388 |
| 149 | 3300046461 | Ga0495641_0017557 | Ga0495641_0017557_1366_2562 | 388 |
| 150 | 3300046463 | Ga0495653_0009243 | Ga0495653_0009243_5318_6523 | 388 |
| 151 | 3300046472 | Ga0495580_0044645 | Ga0495580_0044645_1395_2591 | 388 |
| 152 | 3300046473 | Ga0495582_0004193 | Ga0495582_0004193_3492_4691 | 388 |
| 153 | 3300046476 | Ga0495662_0001221 | Ga0495662_0001221_6370_7575 | 388 |
| 154 | 3300046477 | Ga0495664_0002496 | Ga0495664_0002496_4701_5906 | 388 |
| 155 | 3300046499 | Ga0495594_0041782 | Ga0495594_0041782_1083_2282 | 388 |
| 156 | 3300046514 | Ga0495618_0016732 | Ga0495618_0016732_1228_2433 | 388 |
| 157 | 3300046529 | Ga0495652_0018986 | Ga0495652_0018986_2984_4189 | 388 |
| 158 | 3300046531 | Ga0495665_0020528 | Ga0495665_0020528_513_1718 | 388 |
| 159 | 3300046642 | Ga0495634_0003146 | Ga0495634_0003146_5429_6634 | 388 |
| 160 | 3300046674 | Ga0495588_0094420 | Ga0495588_0094420_59_1258 | 388 |
| 161 | 3300046683 | Ga0495658_0003018 | Ga0495658_0003018_2608_3807 | 388 |
| 162 | 3300046689 | Ga0495613_0007405 | Ga0495613_0007405_2223_3422 | 388 |
| 163 | 3300046690 | Ga0495624_0010732 | Ga0495624_0010732_382_1587 | 388 |
| 164 | 3300046809 | Ga0495600_0121957 | Ga0495600_0121957_329_1528 | 388 |
| 165 | 3300047315 | Ga0495581_0018778 | Ga0495581_0018778_2056_3261 | 388 |
| 166 | 3300047319 | Ga0495674_0051900 | Ga0495674_0051900_608_1813 | 388 |
| 167 | 3300047321 | Ga0495676_0140096 | Ga0495676_0140096_285_1484 | 388 |
| 168 | 3300047322 | Ga0495680_0053859 | Ga0495680_0053859_293_1492 | 388 |
| 169 | 3300047471 | Ga0495684_0015123 | Ga0495684_0015123_3511_4716 | 388 |
| 170 | 3300048903 | Ga0496100_0048412 | Ga0496100_0048412_239_1438 | 388 |
| 171 | 3300048904 | Ga0496101_0092273 | Ga0496101_0092273_654_1853 | 388 |
| 172 | 3300048904 | Ga0496101_0172164 | Ga0496101_0172164_253_1452 | 388 |
| 173 | 3300048906 | Ga0496103_0003032 | Ga0496103_0003032_2146_3345 | 388 |
| 174 | 3300048907 | Ga0496104_0007805 | Ga0496104_0007805_3791_4990 | 388 |
| 175 | 3300048907 | Ga0496104_0106758 | Ga0496104_0106758_847_2046 | 388 |
| 176 | 3300048907 | Ga0496104_0147831 | Ga0496104_0147831_42_1241 | 388 |
| 177 | 3300048911 | Ga0496108_0101584 | Ga0496108_0101584_239_1438 | 388 |
| 178 | 3300048912 | Ga0496109_0072033 | Ga0496109_0072033_1297_2490 | 388 |
| 179 | 3300048912 | Ga0496109_0156512 | Ga0496109_0156512_239_1438 | 388 |
| 180 | 3300048914 | Ga0496111_0186190 | Ga0496111_0186190_169_1368 | 388 |
| 181 | 3300048915 | Ga0496112_0013614 | Ga0496112_0013614_5303_6502 | 388 |
| 182 | 3300048915 | Ga0496112_0035370 | Ga0496112_0035370_3392_4585 | 388 |
| 183 | 3300048915 | Ga0496112_0155142 | Ga0496112_0155142_1016_2215 | 388 |
| 184 | 3300048916 | Ga0496113_0043810 | Ga0496113_0043810_1087_2280 | 388 |
| 185 | 3300048916 | Ga0496113_0059137 | Ga0496113_0059137_1048_2247 | 388 |
| 186 | 3300048918 | Ga0496115_0006490 | Ga0496115_0006490_1733_2932 | 388 |
| 187 | 3300053085 | Ga0495619_0000535 | Ga0495619_0000535_6334_7533 | 388 |
| 188 | 3300053142 | Ga0500577_0000239 | Ga0500577_0000239_4963_6138 | 388 |
| 189 | iso_pu_bacteria | 2874604998 | 2874611803 | 388 |
| 190 | iso_pu_bacteria | 2885366525 | 2885370273 | 388 |
| 191 | iso_pu_bacteria | 2885383462 | 2885390091 | 388 |
| 192 | iso_pu_bacteria | 8056681323 | 8056687835 | 388 |
| 193 | 3300047472 | Ga0495686_0089907 | Ga0495686_0089907_90_1271 | 389 |
| 194 | 3300048928 | Ga0496125_0000629 | Ga0496125_0000629_3485_4663 | 389 |
| 195 | 3300048929 | Ga0496126_0049448 | Ga0496126_0049448_406_1584 | 389 |
| 196 | 3300049569 | Ga0501032_0071686 | Ga0501032_0071686_32_1216 | 389 |
| 197 | 3300049575 | Ga0501039_0004638 | Ga0501039_0004638_4676_5902 | 389 |
| 198 | 3300049576 | Ga0501040_0006035 | Ga0501040_0006035_5396_6622 | 389 |
| 199 | 3300049577 | Ga0501041_0004005 | Ga0501041_0004005_4798_6024 | 389 |
| 200 | 3300049578 | Ga0501042_0004901 | Ga0501042_0004901_4819_6045 | 389 |
| 201 | 3300049579 | Ga0501043_0059317 | Ga0501043_0059317_1647_2873 | 389 |
| 202 | 3300049580 | Ga0501046_0017346 | Ga0501046_0017346_1821_3047 | 389 |
| 203 | 3300049582 | Ga0501048_0052580 | Ga0501048_0052580_932_2158 | 389 |
| 204 | 3300049584 | Ga0501068_0048432 | Ga0501068_0048432_1318_2544 | 389 |
| 205 | 3300049587 | Ga0501071_0008679 | Ga0501071_0008679_3542_4768 | 389 |
| 206 | 3300049588 | Ga0501072_0053566 | Ga0501072_0053566_263_1489 | 389 |
| 207 | 3300049590 | Ga0501074_0032392 | Ga0501074_0032392_723_1949 | 389 |
| 208 | 3300049591 | Ga0501075_0035458 | Ga0501075_0035458_16_1242 | 389 |
| 209 | 3300049592 | Ga0501076_0005914 | Ga0501076_0005914_5201_6427 | 389 |
| 210 | 3300049593 | Ga0501077_0004218 | Ga0501077_0004218_2496_3722 | 389 |
| 211 | 3300049741 | Ga0501079_0006176 | Ga0501079_0006176_2627_3853 | 389 |
| 212 | 3300049743 | Ga0501081_0004561 | Ga0501081_0004561_2523_3749 | 389 |
| 213 | 3300049822 | Ga0501035_0040687 | Ga0501035_0040687_1686_2912 | 389 |
| 214 | 3300049824 | Ga0501045_0009753 | Ga0501045_0009753_548_1774 | 389 |
| 215 | 3300054114 | Ga0501084_0000249 | Ga0501084_0000249_32549_33775 | 389 |
| 216 | 3300060353 | Ga0501082_0026523 | Ga0501082_0026523_1248_2474 | 389 |
| 217 | iso_pu_bacteria | 2508501009 | 2508541433 | 389 |
| 218 | iso_pu_bacteria | 2513237092 | 2513621528 | 389 |
| 219 | iso_pu_bacteria | 2513237102 | 2513703967 | 389 |
| 220 | iso_pu_bacteria | 2513237104 | 2513719206 | 389 |
| 221 | iso_pu_bacteria | 2515154112 | 2515629775 | 389 |
| 222 | iso_pu_bacteria | 2524023205 | 2524441203 | 389 |
| 223 | iso_pu_bacteria | 2524023210 | 2524464971 | 389 |
| 224 | iso_pu_bacteria | 2744054633 | 2745078664 | 389 |
| 225 | iso_pu_bacteria | 2824617872 | 2824621290 | 389 |
| 226 | iso_pu_bacteria | 2824626560 | 2824630429 | 389 |
| 227 | iso_pu_bacteria | 2824635225 | 2824638228 | 389 |
| 228 | iso_pu_bacteria | 2824644064 | 2824647147 | 389 |
| 229 | iso_pu_bacteria | 2824679649 | 2824686215 | 389 |
| 230 | iso_pu_bacteria | 2824714736 | 2824720497 | 389 |
| 231 | iso_pu_bacteria | 2824723954 | 2824730791 | 389 |
| 232 | iso_pu_bacteria | 2824732956 | 2824738204 | 389 |
| 233 | iso_pu_bacteria | 2844315083 | 2844320284 | 389 |
| 234 | iso_pu_bacteria | 2847930680 | 2847937613 | 389 |
| 235 | iso_pu_bacteria | 2849076700 | 2849078125 | 389 |
| 236 | iso_pu_bacteria | 2874590934 | 2874592860 | 389 |
| 237 | iso_pu_bacteria | 2874620515 | 2874623776 | 389 |
| 238 | iso_pu_bacteria | 2874645413 | 2874650708 | 389 |
| 239 | iso_pu_bacteria | 2876761206 | 2876768473 | 389 |
| 240 | iso_pu_bacteria | 2876771140 | 2876776288 | 389 |
| 241 | iso_pu_bacteria | 2876818435 | 2876822248 | 389 |
| 242 | iso_pu_bacteria | 2879074833 | 2879080377 | 389 |
| 243 | iso_pu_bacteria | 2879127579 | 2879133465 | 389 |
| 244 | iso_pu_bacteria | 2879142872 | 2879145788 | 389 |
| 245 | iso_pu_bacteria | 2881665667 | 2881667168 | 389 |
| 246 | iso_pu_bacteria | 2903727486 | 2903731564 | 389 |
| 247 | iso_pu_bacteria | 2904666416 | 2904674005 | 389 |
| 248 | iso_pu_bacteria | 2906602504 | 2906608327 | 389 |
| 249 | iso_pu_bacteria | 2906643746 | 2906645182 | 389 |
| 250 | iso_pu_bacteria | 2932794094 | 2932799761 | 389 |
| 251 | iso_pu_bacteria | 2932801729 | 2932808652 | 389 |
| 252 | iso_pu_bacteria | 2935608549 | 2935610244 | 389 |
| 253 | iso_pu_bacteria | 2935648319 | 2935651217 | 389 |
| 254 | iso_pu_bacteria | 2935656913 | 2935659397 | 389 |
| 255 | iso_pu_bacteria | 2935769743 | 2935771219 | 389 |
| 256 | iso_pu_bacteria | 2935777560 | 2935781016 | 389 |
| 257 | iso_pu_bacteria | 2935785616 | 2935786080 | 389 |
| 258 | iso_pu_bacteria | 2935793552 | 2935797737 | 389 |
| 259 | iso_pu_bacteria | 2935819856 | 2935823405 | 389 |
| 260 | iso_pu_bacteria | 2935847175 | 2935848889 | 389 |
| 261 | iso_pu_bacteria | 2935883170 | 2935885576 | 389 |
| 262 | iso_pu_bacteria | 2935908558 | 2935912981 | 389 |
| 263 | iso_pu_bacteria | 2935916978 | 2935924446 | 389 |
| 264 | iso_pu_bacteria | 2935926038 | 2935930126 | 389 |
| 265 | iso_pu_bacteria | 2935934488 | 2935939027 | 389 |
| 266 | iso_pu_bacteria | 2935942939 | 2935945974 | 389 |
| 267 | iso_pu_bacteria | 2935951376 | 2935955311 | 389 |
| 268 | iso_pu_bacteria | 2935959822 | 2935963009 | 389 |
| 269 | iso_pu_bacteria | 2935967501 | 2935972318 | 389 |
| 270 | iso_pu_bacteria | 2935975950 | 2935976243 | 389 |
| 271 | iso_pu_bacteria | 2936011229 | 2936013812 | 389 |
| 272 | iso_pu_bacteria | 2936019824 | 2936022664 | 389 |
| 273 | iso_pu_bacteria | 2936028420 | 2936033283 | 389 |
| 274 | iso_pu_bacteria | 2936046547 | 2936048918 | 389 |
| 275 | iso_pu_bacteria | 2936055302 | 2936060504 | 389 |
| 276 | iso_pu_bacteria | 3005483717 | 3005488557 | 389 |
| 277 | iso_pu_bacteria | 3005587118 | 3005588377 | 389 |
| 278 | iso_pu_bacteria | 3005594810 | 3005600662 | 389 |
| 279 | iso_pu_bacteria | 3005710791 | 3005716101 | 389 |
| 280 | iso_pu_bacteria | 3005718088 | 3005723438 | 389 |
| 281 | iso_pu_bacteria | 8006926726 | 8006927779 | 389 |
| 282 | iso_pu_bacteria | 8016522445 | 8016528378 | 389 |
| 283 | iso_pu_bacteria | 8016539877 | 8016546754 | 389 |
| 284 | iso_pu_bacteria | 8016548790 | 8016555362 | 389 |
| 285 | iso_pu_bacteria | 8016557553 | 8016563723 | 389 |
| 286 | iso_pu_bacteria | 8016575299 | 8016576071 | 389 |
| 287 | iso_pu_bacteria | 8016595262 | 8016601453 | 389 |
| 288 | iso_pu_bacteria | 8016613128 | 8016616226 | 389 |
| 289 | iso_pu_bacteria | 8016622563 | 8016625016 | 389 |
| 290 | iso_pu_bacteria | 8016630954 | 8016638852 | 389 |
| 291 | iso_pu_bacteria | 8019530166 | 8019533317 | 389 |
| 292 | iso_pu_bacteria | 8019547302 | 8019552052 | 389 |
| 293 | iso_pu_bacteria | 8019619141 | 8019620119 | 389 |
| 294 | iso_pu_bacteria | 8019629233 | 8019632985 | 389 |
| 295 | iso_pu_bacteria | 8019638758 | 8019646937 | 389 |
| 296 | iso_pu_bacteria | 8019659431 | 8019660852 | 389 |
| 297 | iso_pu_bacteria | 8019668869 | 8019670402 | 389 |
| 298 | iso_pu_bacteria | 8019678201 | 8019685828 | 389 |
| 299 | iso_pu_bacteria | 8019687851 | 8019692002 | 389 |
| 300 | iso_pu_bacteria | 8056967851 | 8056974772 | 389 |
| 301 | 3300005366 | Ga0070659_100092167 | Ga0070659_1000921672 | 390 |
| 302 | 3300005616 | Ga0068852_100041724 | Ga0068852_1000417244 | 390 |
| 303 | 3300005983 | Ga0081540_1002292 | Ga0081540_10022929 | 390 |
| 304 | 3300006028 | Ga0070717_10003637 | Ga0070717_100036372 | 390 |
| 305 | 3300021441 | Ga0213871_10000486 | Ga0213871_100004863 | 390 |
| 306 | 3300025932 | Ga0207690_10145154 | Ga0207690_101451542 | 390 |
| 307 | 3300035113 | Ga0373936_0004892 | Ga0373936_0004892_3506_4726 | 390 |
| 308 | 3300039438 | Ga0436360_0662934 | Ga0436360_0662934_1223_2404 | 390 |
| 309 | 3300046533 | Ga0495640_0126912 | Ga0495640_0126912_77_1276 | 390 |
| 310 | 3300046663 | Ga0495635_0099846 | Ga0495635_0099846_158_1357 | 390 |
| 311 | 3300048913 | Ga0496110_0059420 | Ga0496110_0059420_401_1606 | 390 |
| 312 | 3300048924 | Ga0496121_0068786 | Ga0496121_0068786_362_1543 | 390 |
| 313 | 3300049583 | Ga0501067_0072683 | Ga0501067_0072683_350_1555 | 390 |
| 314 | 3300053091 | Ga0500647_0064247 | Ga0500647_0064247_51_1286 | 390 |
| 315 | 3300053094 | Ga0500566_0000046 | Ga0500566_0000046_42119_43354 | 390 |
| 316 | 3300053094 | Ga0500566_0000046 | Ga0500566_0000046_43555_44775 | 390 |
| 317 | 3300053095 | Ga0500640_005282 | Ga0500640_005282_3417_4637 | 390 |
| 318 | 3300053111 | Ga0500572_002369 | Ga0500572_002369_1047_2282 | 390 |
| 319 | 3300053111 | Ga0500572_002369 | Ga0500572_002369_2483_3703 | 390 |
| 320 | 3300053115 | Ga0500591_086145 | Ga0500591_086145_131_1366 | 390 |
| 321 | 3300053122 | Ga0500608_004894 | Ga0500608_004894_298_1518 | 390 |
| 322 | 3300053123 | Ga0500614_001648 | Ga0500614_001648_145_1380 | 390 |
| 323 | 3300053123 | Ga0500614_003833 | Ga0500614_003833_1813_3033 | 390 |
| 324 | 3300053136 | Ga0500559_0001633 | Ga0500559_0001633_5152_6372 | 390 |
| 325 | 3300053136 | Ga0500559_0001633 | Ga0500559_0001633_6573_7808 | 390 |
| 326 | 3300053148 | Ga0500590_057400 | Ga0500590_057400_21_1256 | 390 |
| 327 | 3300053150 | Ga0500603_000071 | Ga0500603_000071_5242_6462 | 390 |
| 328 | 3300053150 | Ga0500603_000071 | Ga0500603_000071_6663_7898 | 390 |
| 329 | 3300053159 | Ga0500630_009402 | Ga0500630_009402_1681_2901 | 390 |
| 330 | 3300053159 | Ga0500630_009402 | Ga0500630_009402_245_1480 | 390 |
| 331 | 3300053162 | Ga0500638_002339 | Ga0500638_002339_2024_3259 | 390 |
| 332 | 3300053162 | Ga0500638_002339 | Ga0500638_002339_3460_4680 | 390 |
| 333 | 3300053163 | Ga0500639_000009 | Ga0500639_000009_134364_135599 | 390 |
| 334 | 3300053163 | Ga0500639_000009 | Ga0500639_000009_135800_137020 | 390 |
| 335 | 3300053178 | Ga0500637_0027684 | Ga0500637_0027684_1209_2402 | 390 |
| 336 | 3300053725 | Ga0500576_074026 | Ga0500576_074026_65_1285 | 390 |
| 337 | 3300053735 | Ga0500596_002470 | Ga0500596_002470_160_1380 | 390 |
| 338 | 3300053735 | Ga0500596_010113 | Ga0500596_010113_159_1394 | 390 |
| 339 | iso_pu_bacteria | 2508501042 | 2508693237 | 390 |
| 340 | iso_pu_bacteria | 2617270741 | 2617373029 | 390 |
| 341 | iso_pu_bacteria | 2881364244 | 2881370247 | 390 |
| 342 | iso_pu_bacteria | 2935984226 | 2935986258 | 390 |
| 343 | 3300005347 | Ga0070668_100056001 | Ga0070668_1000560012 | 391 |
| 344 | 3300005434 | Ga0070709_10008052 | Ga0070709_100080522 | 391 |
| 345 | 3300005435 | Ga0070714_100054725 | Ga0070714_1000547251 | 391 |
| 346 | 3300005436 | Ga0070713_100006818 | Ga0070713_1000068182 | 391 |
| 347 | 3300005437 | Ga0070710_10014059 | Ga0070710_100140594 | 391 |
| 348 | 3300005439 | Ga0070711_100045413 | Ga0070711_1000454133 | 391 |
| 349 | 3300005445 | Ga0070708_100039730 | Ga0070708_1000397302 | 391 |
| 350 | 3300005563 | Ga0068855_100242273 | Ga0068855_1002422732 | 391 |
| 351 | 3300005578 | Ga0068854_100152623 | Ga0068854_1001526232 | 391 |
| 352 | 3300005719 | Ga0068861_100199976 | Ga0068861_1001999762 | 391 |
| 353 | 3300005844 | Ga0068862_100251953 | Ga0068862_1002519532 | 391 |
| 354 | 3300005983 | Ga0081540_1003262 | Ga0081540_100326213 | 391 |
| 355 | 3300006028 | Ga0070717_10005463 | Ga0070717_100054635 | 391 |
| 356 | 3300006038 | Ga0075365_10187656 | Ga0075365_101876562 | 391 |
| 357 | 3300006175 | Ga0070712_100051014 | Ga0070712_1000510142 | 391 |
| 358 | 3300006844 | Ga0075428_100130465 | Ga0075428_1001304652 | 391 |
| 359 | 3300009093 | Ga0105240_10024142 | Ga0105240_100241427 | 391 |
| 360 | 3300009094 | Ga0111539_10225645 | Ga0111539_102256452 | 391 |
| 361 | 3300009147 | Ga0114129_10084470 | Ga0114129_100844701 | 391 |
| 362 | 3300009545 | Ga0105237_10083100 | Ga0105237_100831002 | 391 |
| 363 | 3300009551 | Ga0105238_10025266 | Ga0105238_100252662 | 391 |
| 364 | 3300010375 | Ga0105239_10022574 | Ga0105239_100225748 | 391 |
| 365 | 3300013104 | Ga0157370_10123171 | Ga0157370_101231713 | 391 |
| 366 | 3300025295 | Ga0209564_1022078 | Ga0209564_10220781 | 391 |
| 367 | 3300025321 | Ga0207656_10016082 | Ga0207656_100160823 | 391 |
| 368 | 3300025901 | Ga0207688_10044510 | Ga0207688_100445102 | 391 |
| 369 | 3300025909 | Ga0207705_10099812 | Ga0207705_100998122 | 391 |
| 370 | 3300025915 | Ga0207693_10056447 | Ga0207693_100564474 | 391 |
| 371 | 3300025919 | Ga0207657_10002700 | Ga0207657_100027003 | 391 |
| 372 | 3300025924 | Ga0207694_10009709 | Ga0207694_100097092 | 391 |
| 373 | 3300025928 | Ga0207700_10014522 | Ga0207700_100145222 | 391 |
| 374 | 3300025949 | Ga0207667_10176545 | Ga0207667_101765452 | 391 |
| 375 | 3300025972 | Ga0207668_10036425 | Ga0207668_100364252 | 391 |
| 376 | 3300025981 | Ga0207640_10020045 | Ga0207640_100200453 | 391 |
| 377 | 3300026041 | Ga0207639_10144396 | Ga0207639_101443962 | 391 |
| 378 | 3300026075 | Ga0207708_10040362 | Ga0207708_100403622 | 391 |
| 379 | 3300026088 | Ga0207641_10059836 | Ga0207641_100598362 | 391 |
| 380 | 3300026116 | Ga0207674_10044742 | Ga0207674_100447424 | 391 |
| 381 | 3300028380 | Ga0268265_10076990 | Ga0268265_100769902 | 391 |
| 382 | 3300030521 | Ga0307511_10057142 | Ga0307511_100571422 | 391 |
| 383 | 3300031235 | Ga0265330_10040317 | Ga0265330_100403172 | 391 |
| 384 | 3300031241 | Ga0265325_10025451 | Ga0265325_100254512 | 391 |
| 385 | 3300031247 | Ga0265340_10007480 | Ga0265340_100074805 | 391 |
| 386 | 3300031507 | Ga0307509_10027532 | Ga0307509_100275323 | 391 |
| 387 | 3300031616 | Ga0307508_10000051 | Ga0307508_1000005149 | 391 |
| 388 | 3300031616 | Ga0307508_10036080 | Ga0307508_100360803 | 391 |
| 389 | 3300031712 | Ga0265342_10067378 | Ga0265342_100673782 | 391 |
| 390 | 3300031730 | Ga0307516_10033587 | Ga0307516_100335876 | 391 |
| 391 | 3300031730 | Ga0307516_10039049 | Ga0307516_100390496 | 391 |
| 392 | 3300033179 | Ga0307507_10007677 | Ga0307507_1000767710 | 391 |
| 393 | 3300035083 | Ga0373926_0012314 | Ga0373926_0012314_228_1448 | 391 |
| 394 | 3300035086 | Ga0373934_0000907 | Ga0373934_0000907_2008_3192 | 391 |
| 395 | 3300035111 | Ga0373923_0001633 | Ga0373923_0001633_2494_3678 | 391 |
| 396 | 3300035116 | Ga0373945_0010901 | Ga0373945_0010901_514_1734 | 391 |
| 397 | 3300035116 | Ga0373945_0030516 | Ga0373945_0030516_61_1245 | 391 |
| 398 | 3300035117 | Ga0373953_0001289 | Ga0373953_0001289_1895_3079 | 391 |
| 399 | 3300035117 | Ga0373953_0001479 | Ga0373953_0001479_3600_4784 | 391 |
| 400 | 3300035118 | Ga0373954_0000418 | Ga0373954_0000418_3918_5102 | 391 |
| 401 | 3300035118 | Ga0373954_0002486 | Ga0373954_0002486_3860_5044 | 391 |
| 402 | 3300035119 | Ga0373956_0000845 | Ga0373956_0000845_9530_10714 | 391 |
| 403 | 3300035119 | Ga0373956_0003309 | Ga0373956_0003309_3424_4608 | 391 |
| 404 | 3300035120 | Ga0373957_0000872 | Ga0373957_0000872_473_1657 | 391 |
| 405 | 3300035120 | Ga0373957_0001629 | Ga0373957_0001629_853_2037 | 391 |
| 406 | 3300035171 | Ga0373946_0004495 | Ga0373946_0004495_1890_3110 | 391 |
| 407 | 3300035172 | Ga0373955_0002155 | Ga0373955_0002155_2886_4070 | 391 |
| 408 | 3300035172 | Ga0373955_0031763 | Ga0373955_0031763_1330_2514 | 391 |
| 409 | 3300035410 | Ga0373924_0043457 | Ga0373924_0043457_164_1348 | 391 |
| 410 | 3300035692 | Ga0373935_0003099 | Ga0373935_0003099_7886_9106 | 391 |
| 411 | 3300035695 | Ga0373927_0001527 | Ga0373927_0001527_4458_5678 | 391 |
| 412 | 3300035695 | Ga0373927_0011466 | Ga0373927_0011466_3282_4466 | 391 |
| 413 | 3300035695 | Ga0373927_0096455 | Ga0373927_0096455_463_1650 | 391 |
| 414 | 3300035724 | Ga0373933_0007734 | Ga0373933_0007734_2044_3228 | 391 |
| 415 | 3300035725 | Ga0373947_0008244 | Ga0373947_0008244_3481_4665 | 391 |
| 416 | 3300036401 | Ga0373937_0014727 | Ga0373937_0014727_2883_4067 | 391 |
| 417 | 3300036401 | Ga0373937_0021674 | Ga0373937_0021674_1782_2966 | 391 |
| 418 | 3300036401 | Ga0373937_0022887 | Ga0373937_0022887_2560_3744 | 391 |
| 419 | 3300037068 | Ga0373925_0002216 | Ga0373925_0002216_4300_5520 | 391 |
| 420 | 3300037068 | Ga0373925_0186898 | Ga0373925_0186898_420_1604 | 391 |
| 421 | 3300037068 | Ga0373925_0235373 | Ga0373925_0235373_66_1250 | 391 |
| 422 | 3300046454 | Ga0495592_0018086 | Ga0495592_0018086_1334_2518 | 391 |
| 423 | 3300046454 | Ga0495592_0018978 | Ga0495592_0018978_730_1914 | 391 |
| 424 | 3300046455 | Ga0495603_0000874 | Ga0495603_0000874_14193_15377 | 391 |
| 425 | 3300046455 | Ga0495603_0040550 | Ga0495603_0040550_194_1378 | 391 |
| 426 | 3300046459 | Ga0495629_0000439 | Ga0495629_0000439_16015_17199 | 391 |
| 427 | 3300046459 | Ga0495629_0000957 | Ga0495629_0000957_11976_13160 | 391 |
| 428 | 3300046459 | Ga0495629_0016837 | Ga0495629_0016837_1878_3062 | 391 |
| 429 | 3300046462 | Ga0495651_0005010 | Ga0495651_0005010_5316_6500 | 391 |
| 430 | 3300046462 | Ga0495651_0030252 | Ga0495651_0030252_1568_2752 | 391 |
| 431 | 3300046463 | Ga0495653_0003152 | Ga0495653_0003152_10148_11332 | 391 |
| 432 | 3300046463 | Ga0495653_0065763 | Ga0495653_0065763_1374_2558 | 391 |
| 433 | 3300046472 | Ga0495580_0010813 | Ga0495580_0010813_3953_5137 | 391 |
| 434 | 3300046472 | Ga0495580_0013917 | Ga0495580_0013917_3954_5174 | 391 |
| 435 | 3300046473 | Ga0495582_0003251 | Ga0495582_0003251_6323_7507 | 391 |
| 436 | 3300046476 | Ga0495662_0008624 | Ga0495662_0008624_1252_2436 | 391 |
| 437 | 3300046477 | Ga0495664_0008760 | Ga0495664_0008760_3929_5113 | 391 |
| 438 | 3300046477 | Ga0495664_0012243 | Ga0495664_0012243_247_1431 | 391 |
| 439 | 3300046511 | Ga0495608_0016278 | Ga0495608_0016278_724_1908 | 391 |
| 440 | 3300046511 | Ga0495608_0020011 | Ga0495608_0020011_1970_3154 | 391 |
| 441 | 3300046514 | Ga0495618_0004727 | Ga0495618_0004727_3060_4244 | 391 |
| 442 | 3300046516 | Ga0495628_0009164 | Ga0495628_0009164_5785_6969 | 391 |
| 443 | 3300046516 | Ga0495628_0011453 | Ga0495628_0011453_707_1891 | 391 |
| 444 | 3300046517 | Ga0495630_0024054 | Ga0495630_0024054_1019_2203 | 391 |
| 445 | 3300046524 | Ga0495648_0001613 | Ga0495648_0001613_16769_17953 | 391 |
| 446 | 3300046529 | Ga0495652_0005540 | Ga0495652_0005540_7784_8968 | 391 |
| 447 | 3300046529 | Ga0495652_0031735 | Ga0495652_0031735_2463_3647 | 391 |
| 448 | 3300046531 | Ga0495665_0000555 | Ga0495665_0000555_17251_18435 | 391 |
| 449 | 3300046533 | Ga0495640_0001232 | Ga0495640_0001232_9354_10538 | 391 |
| 450 | 3300046533 | Ga0495640_0023532 | Ga0495640_0023532_1015_2199 | 391 |
| 451 | 3300046536 | Ga0495587_0021844 | Ga0495587_0021844_459_1643 | 391 |
| 452 | 3300046536 | Ga0495587_0024180 | Ga0495587_0024180_1525_2709 | 391 |
| 453 | 3300046543 | Ga0495645_0032362 | Ga0495645_0032362_2043_3227 | 391 |
| 454 | 3300046559 | Ga0495667_0003416 | Ga0495667_0003416_1018_2202 | 391 |
| 455 | 3300046559 | Ga0495667_0017156 | Ga0495667_0017156_805_1989 | 391 |
| 456 | 3300046642 | Ga0495634_0053532 | Ga0495634_0053532_63_1247 | 391 |
| 457 | 3300046663 | Ga0495635_0001430 | Ga0495635_0001430_11646_12830 | 391 |
| 458 | 3300046663 | Ga0495635_0003515 | Ga0495635_0003515_6543_7727 | 391 |
| 459 | 3300046663 | Ga0495635_0029753 | Ga0495635_0029753_1413_2597 | 391 |
| 460 | 3300046674 | Ga0495588_0024577 | Ga0495588_0024577_1633_2817 | 391 |
| 461 | 3300046675 | Ga0495657_0016293 | Ga0495657_0016293_558_1742 | 391 |
| 462 | 3300046675 | Ga0495657_0019090 | Ga0495657_0019090_724_1908 | 391 |
| 463 | 3300046678 | Ga0495599_0005440 | Ga0495599_0005440_1329_2513 | 391 |
| 464 | 3300046678 | Ga0495599_0009549 | Ga0495599_0009549_1257_2441 | 391 |
| 465 | 3300046679 | Ga0495623_0011605 | Ga0495623_0011605_1462_2646 | 391 |
| 466 | 3300046680 | Ga0495646_0003601 | Ga0495646_0003601_1762_2946 | 391 |
| 467 | 3300046680 | Ga0495646_0050400 | Ga0495646_0050400_693_1877 | 391 |
| 468 | 3300046681 | Ga0495647_0013806 | Ga0495647_0013806_1015_2199 | 391 |
| 469 | 3300046689 | Ga0495613_0007855 | Ga0495613_0007855_3665_4885 | 391 |
| 470 | 3300046689 | Ga0495613_0022781 | Ga0495613_0022781_95_1279 | 391 |
| 471 | 3300046689 | Ga0495613_0061250 | Ga0495613_0061250_1537_2721 | 391 |
| 472 | 3300046690 | Ga0495624_0015569 | Ga0495624_0015569_1925_3109 | 391 |
| 473 | 3300046691 | Ga0495670_0098618 | Ga0495670_0098618_231_1415 | 391 |
| 474 | 3300046809 | Ga0495600_0001772 | Ga0495600_0001772_10433_11617 | 391 |
| 475 | 3300046809 | Ga0495600_0002854 | Ga0495600_0002854_3434_4618 | 391 |
| 476 | 3300047315 | Ga0495581_0000019 | Ga0495581_0000019_9462_10646 | 391 |
| 477 | 3300047317 | Ga0495604_0021441 | Ga0495604_0021441_1115_2299 | 391 |
| 478 | 3300047317 | Ga0495604_0024159 | Ga0495604_0024159_1458_2642 | 391 |
| 479 | 3300047319 | Ga0495674_0000458 | Ga0495674_0000458_17825_19009 | 391 |
| 480 | 3300047319 | Ga0495674_0024761 | Ga0495674_0024761_3508_4692 | 391 |
| 481 | 3300047322 | Ga0495680_0006264 | Ga0495680_0006264_6997_8181 | 391 |
| 482 | 3300047322 | Ga0495680_0006496 | Ga0495680_0006496_1523_2707 | 391 |
| 483 | 3300047444 | Ga0495675_0003040 | Ga0495675_0003040_5597_6781 | 391 |
| 484 | 3300047444 | Ga0495675_0019849 | Ga0495675_0019849_1885_3069 | 391 |
| 485 | 3300047469 | Ga0495673_0067486 | Ga0495673_0067486_242_1426 | 391 |
| 486 | 3300047471 | Ga0495684_0016167 | Ga0495684_0016167_1257_2441 | 391 |
| 487 | 3300047471 | Ga0495684_0016590 | Ga0495684_0016590_2431_3615 | 391 |
| 488 | 3300047471 | Ga0495684_0144597 | Ga0495684_0144597_368_1552 | 391 |
| 489 | 3300047673 | Ga0495593_0001308 | Ga0495593_0001308_7648_8832 | 391 |
| 490 | 3300047673 | Ga0495593_0007997 | Ga0495593_0007997_1540_2724 | 391 |
| 491 | 3300047673 | Ga0495593_0072701 | Ga0495593_0072701_414_1634 | 391 |
| 492 | 3300048088 | Ga0495602_0042156 | Ga0495602_0042156_2035_3219 | 391 |
| 493 | 3300048088 | Ga0495602_0045631 | Ga0495602_0045631_737_1921 | 391 |
| 494 | 3300048909 | Ga0496106_0072829 | Ga0496106_0072829_1017_2201 | 391 |
| 495 | 3300048912 | Ga0496109_0216064 | Ga0496109_0216064_326_1510 | 391 |
| 496 | 3300048914 | Ga0496111_0110818 | Ga0496111_0110818_417_1601 | 391 |
| 497 | 3300048915 | Ga0496112_0226557 | Ga0496112_0226557_359_1543 | 391 |
| 498 | 3300048920 | Ga0496117_0005455 | Ga0496117_0005455_7319_8563 | 391 |
| 499 | 3300048924 | Ga0496121_0004013 | Ga0496121_0004013_4909_6153 | 391 |
| 500 | 3300048927 | Ga0496124_0001073 | Ga0496124_0001073_36809_38053 | 391 |
| 501 | 3300048929 | Ga0496126_0027371 | Ga0496126_0027371_2317_3561 | 391 |
| 502 | 3300048929 | Ga0496126_0086729 | Ga0496126_0086729_692_1879 | 391 |
| 503 | 3300048929 | Ga0496126_0185277 | Ga0496126_0185277_268_1452 | 391 |
| 504 | 3300048929 | Ga0496126_0287752 | Ga0496126_0287752_119_1306 | 391 |
| 505 | 3300050490 | nmdc:mga03n38_125282_c1 | nmdc:mga03n38_125282_c1_37_1242 | 391 |
| 506 | 3300050491 | nmdc:mga00v17_36387_c1 | nmdc:mga00v17_36387_c1_1079_2263 | 391 |
| 507 | 3300050496 | nmdc:mga07m45_122990_c1 | nmdc:mga07m45_122990_c1_258_1442 | 391 |
| 508 | 3300050507 | nmdc:mga05p37_284586_c1 | nmdc:mga05p37_284586_c1_421_1626 | 391 |
| 509 | 3300050511 | nmdc:mga08y16_61191_c1 | nmdc:mga08y16_61191_c1_721_1905 | 391 |
| 510 | 3300053078 | Ga0495612_0058321 | Ga0495612_0058321_381_1565 | 391 |
| 511 | 3300053084 | Ga0495595_0001906 | Ga0495595_0001906_2609_3793 | 391 |
| 512 | 3300053084 | Ga0495595_0010918 | Ga0495595_0010918_2435_3619 | 391 |
| 513 | 3300053085 | Ga0495619_0001280 | Ga0495619_0001280_3901_5085 | 391 |
| 514 | 3300053085 | Ga0495619_0046296 | Ga0495619_0046296_1410_2594 | 391 |
| 515 | 3300053096 | Ga0500641_0004452 | Ga0500641_0004452_1491_2675 | 391 |
| 516 | 3300053122 | Ga0500608_081580 | Ga0500608_081580_302_1492 | 391 |
| 517 | 3300053150 | Ga0500603_000328 | Ga0500603_000328_10160_11344 | 391 |
| 518 | 3300053161 | Ga0500634_0029111 | Ga0500634_0029111_1305_2492 | 391 |
| 519 | 3300005614 | Ga0068856_100000505 | Ga0068856_10000050516 | 392 |
| 520 | 3300009551 | Ga0105238_10158630 | Ga0105238_101586302 | 392 |
| 521 | 3300025924 | Ga0207694_10114266 | Ga0207694_101142662 | 392 |
| 522 | 3300026078 | Ga0207702_10000127 | Ga0207702_1000012768 | 392 |
| 523 | 3300031456 | Ga0307513_10262136 | Ga0307513_102621362 | 392 |
| 524 | 3300046471 | Ga0495650_0067316 | Ga0495650_0067316_53_1243 | 392 |
| 525 | 3300046809 | Ga0495600_0054423 | Ga0495600_0054423_703_1923 | 392 |
| 526 | 3300048929 | Ga0496126_0003114 | Ga0496126_0003114_17098_18285 | 392 |
| 527 | 3300050490 | nmdc:mga03n38_29891_c1 | nmdc:mga03n38_29891_c1_232_1425 | 392 |
| 528 | 3300050494 | nmdc:mga06z11_5354_c1 | nmdc:mga06z11_5354_c1_42_1238 | 392 |
| 529 | 3300050513 | nmdc:mga0rr50_93390_c1 | nmdc:mga0rr50_93390_c1_217_1404 | 392 |
| 530 | 3300053094 | Ga0500566_0004284 | Ga0500566_0004284_6724_7917 | 392 |
| 531 | 3300053119 | Ga0500595_001395 | Ga0500595_001395_9506_10699 | 392 |
| 532 | 3300053121 | Ga0500607_055938 | Ga0500607_055938_554_1747 | 392 |
| 533 | 3300053178 | Ga0500637_0000262 | Ga0500637_0000262_11157_12350 | 392 |
| 534 | 3300055283 | Ga0500661_000172 | Ga0500661_000172_4895_6088 | 392 |
| 535 | 3300005262 | Ga0065165_1015649 | Ga0065165_10156493 | 393 |
| 536 | 3300005329 | Ga0070683_100010546 | Ga0070683_1000105463 | 393 |
| 537 | 3300005457 | Ga0070662_100111969 | Ga0070662_1001119692 | 393 |
| 538 | 3300005458 | Ga0070681_10044280 | Ga0070681_100442802 | 393 |
| 539 | 3300005530 | Ga0070679_100064516 | Ga0070679_1000645163 | 393 |
| 540 | 3300005535 | Ga0070684_100005101 | Ga0070684_1000051012 | 393 |
| 541 | 3300005539 | Ga0068853_100090651 | Ga0068853_1000906512 | 393 |
| 542 | 3300005548 | Ga0070665_100037555 | Ga0070665_1000375553 | 393 |
| 543 | 3300005983 | Ga0081540_1005704 | Ga0081540_10057042 | 393 |
| 544 | 3300006871 | Ga0075434_100057650 | Ga0075434_1000576504 | 393 |
| 545 | 3300009551 | Ga0105238_10039796 | Ga0105238_100397963 | 393 |
| 546 | 3300010375 | Ga0105239_10062444 | Ga0105239_100624443 | 393 |
| 547 | 3300010375 | Ga0105239_10130534 | Ga0105239_101305344 | 393 |
| 548 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001449 | 393 |
| 549 | 3300021320 | Ga0214544_1032080 | Ga0214544_10320802 | 393 |
| 550 | 3300021321 | Ga0214542_1000065 | Ga0214542_100006568 | 393 |
| 551 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003315 | 393 |
| 552 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002452 | 393 |
| 553 | 3300025254 | Ga0209148_1001900 | Ga0209148_10019003 | 393 |
| 554 | 3300025272 | Ga0209455_1001274 | Ga0209455_100127411 | 393 |
| 555 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011659 | 393 |
| 556 | 3300025299 | Ga0209256_1002195 | Ga0209256_10021952 | 393 |
| 557 | 3300025913 | Ga0207695_10000163 | Ga0207695_1000016375 | 393 |
| 558 | 3300025914 | Ga0207671_10008503 | Ga0207671_1000850311 | 393 |
| 559 | 3300025917 | Ga0207660_10036441 | Ga0207660_100364412 | 393 |
| 560 | 3300025933 | Ga0207706_10267695 | Ga0207706_102676951 | 393 |
| 561 | 3300025944 | Ga0207661_10031059 | Ga0207661_100310592 | 393 |
| 562 | 3300026041 | Ga0207639_10054862 | Ga0207639_100548622 | 393 |
| 563 | 3300026142 | Ga0207698_10043427 | Ga0207698_100434272 | 393 |
| 564 | 3300027296 | Ga0209389_1000261 | Ga0209389_100026128 | 393 |
| 565 | 3300027361 | Ga0209489_107409 | Ga0209489_10740910 | 393 |
| 566 | 3300027363 | Ga0209700_101165 | Ga0209700_10116547 | 393 |
| 567 | 3300037312 | Ga0395899_0190716 | Ga0395899_0190716_221_1414 | 393 |
| 568 | 3300037418 | Ga0395900_0001274 | Ga0395900_0001274_793_1986 | 393 |
| 569 | 3300037466 | Ga0395898_0054198 | Ga0395898_0054198_967_2160 | 393 |
| 570 | 3300038443 | Ga0395901_0009376 | Ga0395901_0009376_7393_8586 | 393 |
| 571 | 3300044694 | Ga0466963_0053240 | Ga0466963_0053240_17_1207 | 393 |
| 572 | 3300044735 | Ga0466968_0000345 | Ga0466968_0000345_4464_5654 | 393 |
| 573 | 3300044901 | Ga0466960_0008575 | Ga0466960_0008575_1968_3158 | 393 |
| 574 | 3300044901 | Ga0466960_0073971 | Ga0466960_0073971_13_1206 | 393 |
| 575 | 3300045976 | Ga0466967_0356510 | Ga0466967_0356510_195_1385 | 393 |
| 576 | 3300046454 | Ga0495592_0033549 | Ga0495592_0033549_1555_2745 | 393 |
| 577 | 3300046462 | Ga0495651_0051126 | Ga0495651_0051126_1620_2810 | 393 |
| 578 | 3300046463 | Ga0495653_0144111 | Ga0495653_0144111_30_1220 | 393 |
| 579 | 3300046477 | Ga0495664_0051252 | Ga0495664_0051252_46_1236 | 393 |
| 580 | 3300046507 | Ga0495606_0102164 | Ga0495606_0102164_116_1306 | 393 |
| 581 | 3300046529 | Ga0495652_0018046 | Ga0495652_0018046_640_1830 | 393 |
| 582 | 3300046533 | Ga0495640_0022937 | Ga0495640_0022937_2447_3637 | 393 |
| 583 | 3300046533 | Ga0495640_0075883 | Ga0495640_0075883_215_1405 | 393 |
| 584 | 3300046543 | Ga0495645_0020702 | Ga0495645_0020702_3035_4225 | 393 |
| 585 | 3300046557 | Ga0495622_0058139 | Ga0495622_0058139_148_1338 | 393 |
| 586 | 3300046559 | Ga0495667_0007486 | Ga0495667_0007486_1544_2734 | 393 |
| 587 | 3300046663 | Ga0495635_0001321 | Ga0495635_0001321_2214_3404 | 393 |
| 588 | 3300046675 | Ga0495657_0011371 | Ga0495657_0011371_883_2073 | 393 |
| 589 | 3300046679 | Ga0495623_0005927 | Ga0495623_0005927_1364_2554 | 393 |
| 590 | 3300046694 | Ga0495649_0026330 | Ga0495649_0026330_830_2020 | 393 |
| 591 | 3300046809 | Ga0495600_0015929 | Ga0495600_0015929_1140_2330 | 393 |
| 592 | 3300047317 | Ga0495604_0009404 | Ga0495604_0009404_6329_7519 | 393 |
| 593 | 3300047317 | Ga0495604_0133743 | Ga0495604_0133743_113_1303 | 393 |
| 594 | 3300047319 | Ga0495674_0004826 | Ga0495674_0004826_8526_9716 | 393 |
| 595 | 3300047322 | Ga0495680_0002514 | Ga0495680_0002514_5422_6612 | 393 |
| 596 | 3300047323 | Ga0495683_0029663 | Ga0495683_0029663_626_1816 | 393 |
| 597 | 3300047444 | Ga0495675_0114566 | Ga0495675_0114566_401_1591 | 393 |
| 598 | 3300047673 | Ga0495593_0049823 | Ga0495593_0049823_425_1615 | 393 |
| 599 | 3300048088 | Ga0495602_0021970 | Ga0495602_0021970_2547_3737 | 393 |
| 600 | 3300048088 | Ga0495602_0137898 | Ga0495602_0137898_469_1659 | 393 |
| 601 | 3300048927 | Ga0496124_0145324 | Ga0496124_0145324_368_1558 | 393 |
| 602 | 3300048929 | Ga0496126_0051609 | Ga0496126_0051609_310_1509 | 393 |
| 603 | 3300050512 | nmdc:mga0n895_8527_c1 | nmdc:mga0n895_8527_c1_7524_8714 | 393 |
| 604 | 3300053729 | Ga0500625_025869 | Ga0500625_025869_180_1370 | 393 |
| 605 | 3300055283 | Ga0500661_009841 | Ga0500661_009841_362_1552 | 393 |
| 606 | 3300003203 | JGI25406J46586_10006616 | JGI25406J46586_100066162 | 394 |
| 607 | 3300003659 | JGI25404J52841_10004779 | JGI25404J52841_100047793 | 394 |
| 608 | 3300005329 | Ga0070683_100002376 | Ga0070683_1000023762 | 394 |
| 609 | 3300005434 | Ga0070709_10000652 | Ga0070709_100006522 | 394 |
| 610 | 3300005435 | Ga0070714_100253585 | Ga0070714_1002535852 | 394 |
| 611 | 3300005435 | Ga0070714_100278728 | Ga0070714_1002787281 | 394 |
| 612 | 3300005436 | Ga0070713_100004718 | Ga0070713_1000047182 | 394 |
| 613 | 3300005436 | Ga0070713_100034104 | Ga0070713_1000341042 | 394 |
| 614 | 3300005436 | Ga0070713_100348251 | Ga0070713_1003482511 | 394 |
| 615 | 3300005437 | Ga0070710_10000869 | Ga0070710_100008698 | 394 |
| 616 | 3300005437 | Ga0070710_10045864 | Ga0070710_100458642 | 394 |
| 617 | 3300005439 | Ga0070711_100014126 | Ga0070711_1000141262 | 394 |
| 618 | 3300005458 | Ga0070681_10053424 | Ga0070681_100534245 | 394 |
| 619 | 3300005458 | Ga0070681_10078795 | Ga0070681_100787952 | 394 |
| 620 | 3300005530 | Ga0070679_100011211 | Ga0070679_1000112117 | 394 |
| 621 | 3300005539 | Ga0068853_100208457 | Ga0068853_1002084571 | 394 |
| 622 | 3300005563 | Ga0068855_100265032 | Ga0068855_1002650322 | 394 |
| 623 | 3300005616 | Ga0068852_100265102 | Ga0068852_1002651022 | 394 |
| 624 | 3300005937 | Ga0081455_10035458 | Ga0081455_100354582 | 394 |
| 625 | 3300005937 | Ga0081455_10066786 | Ga0081455_100667862 | 394 |
| 626 | 3300005983 | Ga0081540_1003714 | Ga0081540_10037144 | 394 |
| 627 | 3300005983 | Ga0081540_1009502 | Ga0081540_10095024 | 394 |
| 628 | 3300005983 | Ga0081540_1010212 | Ga0081540_10102124 | 394 |
| 629 | 3300005983 | Ga0081540_1011152 | Ga0081540_10111523 | 394 |
| 630 | 3300005983 | Ga0081540_1018636 | Ga0081540_10186364 | 394 |
| 631 | 3300005985 | Ga0081539_10000199 | Ga0081539_1000019983 | 394 |
| 632 | 3300006173 | Ga0070716_100001146 | Ga0070716_1000011469 | 394 |
| 633 | 3300006175 | Ga0070712_100021391 | Ga0070712_1000213911 | 394 |
| 634 | 3300009093 | Ga0105240_10103796 | Ga0105240_101037962 | 394 |
| 635 | 3300009147 | Ga0114129_10319923 | Ga0114129_103199232 | 394 |
| 636 | 3300013105 | Ga0157369_10027368 | Ga0157369_100273684 | 394 |
| 637 | 3300013105 | Ga0157369_10114034 | Ga0157369_101140341 | 394 |
| 638 | 3300013307 | Ga0157372_10141448 | Ga0157372_101414483 | 394 |
| 639 | 3300021377 | Ga0213874_10004436 | Ga0213874_100044362 | 394 |
| 640 | 3300021384 | Ga0213876_10009271 | Ga0213876_100092713 | 394 |
| 641 | 3300025898 | Ga0207692_10001691 | Ga0207692_100016918 | 394 |
| 642 | 3300025906 | Ga0207699_10000253 | Ga0207699_100002534 | 394 |
| 643 | 3300025906 | Ga0207699_10041193 | Ga0207699_100411932 | 394 |
| 644 | 3300025912 | Ga0207707_10001093 | Ga0207707_1000109319 | 394 |
| 645 | 3300025912 | Ga0207707_10194243 | Ga0207707_101942432 | 394 |
| 646 | 3300025912 | Ga0207707_10197093 | Ga0207707_101970932 | 394 |
| 647 | 3300025916 | Ga0207663_10000261 | Ga0207663_1000026113 | 394 |
| 648 | 3300025916 | Ga0207663_10000913 | Ga0207663_100009137 | 394 |
| 649 | 3300025916 | Ga0207663_10047718 | Ga0207663_100477182 | 394 |
| 650 | 3300025921 | Ga0207652_10033926 | Ga0207652_100339264 | 394 |
| 651 | 3300025921 | Ga0207652_10304466 | Ga0207652_103044662 | 394 |
| 652 | 3300025928 | Ga0207700_10048942 | Ga0207700_100489424 | 394 |
| 653 | 3300025929 | Ga0207664_10050984 | Ga0207664_100509843 | 394 |
| 654 | 3300025929 | Ga0207664_10211370 | Ga0207664_102113702 | 394 |
| 655 | 3300025929 | Ga0207664_10221903 | Ga0207664_102219032 | 394 |
| 656 | 3300025944 | Ga0207661_10021638 | Ga0207661_100216385 | 394 |
| 657 | 3300026067 | Ga0207678_10066937 | Ga0207678_100669372 | 394 |
| 658 | 3300031250 | Ga0265331_10036046 | Ga0265331_100360463 | 394 |
| 659 | 3300031711 | Ga0265314_10074635 | Ga0265314_100746352 | 394 |
| 660 | 3300035083 | Ga0373926_0019447 | Ga0373926_0019447_332_1525 | 394 |
| 661 | 3300035111 | Ga0373923_0065096 | Ga0373923_0065096_329_1522 | 394 |
| 662 | 3300035116 | Ga0373945_0040718 | Ga0373945_0040718_329_1522 | 394 |
| 663 | 3300035117 | Ga0373953_0031272 | Ga0373953_0031272_210_1403 | 394 |
| 664 | 3300035170 | Ga0373943_0001707 | Ga0373943_0001707_4152_5345 | 394 |
| 665 | 3300035695 | Ga0373927_0029786 | Ga0373927_0029786_2263_3456 | 394 |
| 666 | 3300037068 | Ga0373925_0044340 | Ga0373925_0044340_1461_2654 | 394 |
| 667 | 3300037068 | Ga0373925_0139190 | Ga0373925_0139190_232_1416 | 394 |
| 668 | 3300037312 | Ga0395899_0078467 | Ga0395899_0078467_861_2123 | 394 |
| 669 | 3300037466 | Ga0395898_0038797 | Ga0395898_0038797_2000_3196 | 394 |
| 670 | 3300037466 | Ga0395898_0049484 | Ga0395898_0049484_1768_3030 | 394 |
| 671 | 3300037853 | Ga0436364_0441566 | Ga0436364_0441566_424_1620 | 394 |
| 672 | 3300039437 | Ga0436365_0167764 | Ga0436365_0167764_6999_8198 | 394 |
| 673 | 3300039450 | Ga0436363_0607283 | Ga0436363_0607283_893_2119 | 394 |
| 674 | 3300045049 | Ga0466959_0053950 | Ga0466959_0053950_64_1287 | 394 |
| 675 | 3300046472 | Ga0495580_0094615 | Ga0495580_0094615_146_1339 | 394 |
| 676 | 3300046473 | Ga0495582_0017650 | Ga0495582_0017650_172_1365 | 394 |
| 677 | 3300046476 | Ga0495662_0003360 | Ga0495662_0003360_4232_5425 | 394 |
| 678 | 3300046477 | Ga0495664_0009612 | Ga0495664_0009612_696_1889 | 394 |
| 679 | 3300046477 | Ga0495664_0014189 | Ga0495664_0014189_3261_4457 | 394 |
| 680 | 3300046507 | Ga0495606_0097769 | Ga0495606_0097769_580_1764 | 394 |
| 681 | 3300046516 | Ga0495628_0059791 | Ga0495628_0059791_39_1232 | 394 |
| 682 | 3300046529 | Ga0495652_0076070 | Ga0495652_0076070_1059_2252 | 394 |
| 683 | 3300046531 | Ga0495665_0010902 | Ga0495665_0010902_2042_3235 | 394 |
| 684 | 3300046543 | Ga0495645_0004096 | Ga0495645_0004096_723_1919 | 394 |
| 685 | 3300046642 | Ga0495634_0011308 | Ga0495634_0011308_4565_5758 | 394 |
| 686 | 3300046683 | Ga0495658_0028955 | Ga0495658_0028955_1060_2253 | 394 |
| 687 | 3300046684 | Ga0495669_0016999 | Ga0495669_0016999_702_1886 | 394 |
| 688 | 3300047317 | Ga0495604_0143864 | Ga0495604_0143864_317_1510 | 394 |
| 689 | 3300047319 | Ga0495674_0007899 | Ga0495674_0007899_2103_3296 | 394 |
| 690 | 3300047471 | Ga0495684_0012483 | Ga0495684_0012483_3336_4529 | 394 |
| 691 | 3300047673 | Ga0495593_0025486 | Ga0495593_0025486_895_2088 | 394 |
| 692 | 3300048924 | Ga0496121_0098894 | Ga0496121_0098894_61_1260 | 394 |
| 693 | 3300048924 | Ga0496121_0099505 | Ga0496121_0099505_923_2116 | 394 |
| 694 | 3300048929 | Ga0496126_0032011 | Ga0496126_0032011_1276_2475 | 394 |
| 695 | 3300049580 | Ga0501046_0104763 | Ga0501046_0104763_161_1417 | 394 |
| 696 | 3300049581 | Ga0501047_0005748 | Ga0501047_0005748_1747_3003 | 394 |
| 697 | 3300049589 | Ga0501073_0014495 | Ga0501073_0014495_1478_2734 | 394 |
| 698 | 3300049742 | Ga0501080_0044549 | Ga0501080_0044549_1955_3211 | 394 |
| 699 | 3300049823 | Ga0501044_0012350 | Ga0501044_0012350_3036_4292 | 394 |
| 700 | 3300050492 | nmdc:mga0yw44_22966_c1 | nmdc:mga0yw44_22966_c1_1616_2839 | 394 |
| 701 | 3300053077 | Ga0495601_0053353 | Ga0495601_0053353_452_1645 | 394 |
| 702 | 3300053078 | Ga0495612_0007244 | Ga0495612_0007244_2173_3366 | 394 |
| 703 | 3300061719 | Ga0466962_0057141 | Ga0466962_0057141_65_1288 | 394 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5mbg-assembly1.cif.gz_A-2 | structure of a bacterial light-regulated adenylyl cyclase | 0.8847 | 201 | 385 |
| 1ybu-assembly2.cif.gz_C | mycobacterium tuberculosis adenylyl cyclase rv1900c chd, in complex with a substrate analog. | 0.8703 | 201 | 387 |
| 1ybt-assembly1.cif.gz_B | mycobacterium tuberculosis adenylyl cyclase, rv1900c chd | 0.8666 | 201 | 388 |
| 1wc1-assembly2.cif.gz_B | soluble adenylyl cyclase cyac from s. platensis in complex with rp- atpalphas | 0.8636 | 199 | 384 |
| 1ybu-assembly2.cif.gz_C | mycobacterium tuberculosis adenylyl cyclase rv1900c chd, in complex with a substrate analog. | 0.8603 | 201 | 387 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55F68_1579_1775_3.30.70.1230 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain | 0.9009 | 204 | 384 | 3.30.70.1230 |
| 1ybuC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain | 0.8703 | 201 | 387 | 3.30.70.1230 |
| 1ybuC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain | 0.8603 | 201 | 387 | 3.30.70.1230 |
| af_A0A144A236_312_553_3.30.70.1230 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain | 0.8547 | 201 | 391 | 3.30.70.1230 |
| af_P9WQ33_348_539_3.30.70.1230 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain | 0.8533 | 196 | 388 | 3.30.70.1230 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I7P4R9-F1-model_v4 | Adenylate/guanylate cyclase domain-containing protein | 0.9366 | 1 | 384 |
GO:0004016
GO:0006171 GO:0035556 |
| AF-A0A849E7T4-F1-model_v4 | Adenylate/guanylate cyclase domain-containing protein | 0.9339 | 166 | 382 |
GO:0004016
GO:0006171 GO:0035556 |
| AF-A0A3M0XRQ6-F1-model_v4 | Adenylate/guanylate cyclase domain-containing protein | 0.9313 | 5 | 394 |
GO:0000166
GO:0004016 GO:0006171 GO:0035556 |
| AF-A0A211YWQ5-F1-model_v4 | Guanylate cyclase domain-containing protein | 0.9301 | 3 | 384 |
GO:0004016
GO:0006171 GO:0035556 |
| AF-A0A6I7P4R9-F1-model_v4 | Adenylate/guanylate cyclase domain-containing protein | 0.9296 | 1 | 384 |
GO:0004016
GO:0006171 GO:0035556 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar