F476268

General Info

Members Datasets Scaffolds Average Seq Length
703 418 599 396

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10103796|Ga0105240_101037962
Length 420
Sequence MLRKRNAFVLASCRRALQNDQTMDISELDRLTRWLMEGARSAPTPTTFLKEMCERLVAAGLPLYRVGAFVQTLHPDVFGRSFIWRAGAEEVVVNTANFDLPDSPQFKNSPLAILYASGHEVRYRLDDPESKRFPFFDDMRGEGVTDYIALPLLFTDGSIHASSWSTRAEGGFTDEHLAALRSVIPPFSRLGEIHAMRRTAAALLDTYVGNRAGERILAGQIRRGHAEGMQVAIWLSDLRGFTALSDRLVPETVVDILNQYFDCQVPVIREHGGEILKFMGDGLLAVFPIAKDGGNLSEVCGRVLRASRKARANVDAMHYPSGNAIERFRFGIALHIGGILFGNIGGMSRLDFTCIGPAVNLAARLEKIAGRQRRTVVASAAFAGACVYDWVDLGEFPIAGFSQAQRVFGLREEVVADVAD

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
12 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
13 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
14 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
15 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
16 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
17 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
18 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
19 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
20 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
21 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
22 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
23 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
24 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
25 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
26 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
27 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
28 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
29 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
30 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
31 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
32 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
33 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
34 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
35 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
36 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
37 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
38 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
39 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
40 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
41 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
42 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
43 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
44 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
45 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
46 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
47 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
48 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
49 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
50 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
51 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
52 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
53 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
54 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
55 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
56 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
57 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
58 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
59 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
60 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
61 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
62 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
63 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
64 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
65 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
66 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
67 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
68 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
69 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
70 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
71 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
72 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
73 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
74 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
75 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
76 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
78 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
81 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
82 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
86 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
87 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
88 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
89 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
90 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
91 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
92 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
93 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
94 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
97 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
102 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
103 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
112 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
113 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
114 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
118 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
119 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
127 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
133 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
140 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
141 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
142 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
143 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
188 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
189 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
200 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
207 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
212 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
229 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
230 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
254 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
281 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
282 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
297 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
298 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
299 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
300 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
321 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
322 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
323 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
336 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
337 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
338 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
339 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
356 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
357 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
358 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
364 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
365 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
366 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
367 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
368 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
369 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
370 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
371 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
372 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
373 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
374 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
375 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
376 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
377 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
378 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
379 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
380 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
381 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
385 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
386 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
387 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
388 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
389 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
390 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
391 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
392 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
393 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
394 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
398 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
399 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
400 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
401 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
402 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
403 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
404 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
405 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
406 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
407 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
408 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
409 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
410 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
411 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
412 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
413 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
414 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
415 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
416 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
417 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
418 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.2
Metatranscriptomes 0
Isolates 13.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.82
Nodule 11.24
Rhizoplane 3.41
Rhizosphere 67.85
Stem 0
Stem Tuber 0
Unclassified 8.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10006616 3300003203 Bacteria 5325
2 JGI25153J46596_10000062 3300003215 Bacteria 129749
3 JGI25404J52841_10004779 3300003659 Bacteria 2770
4 Ga0065165_1015649 3300005262 Bacteria 2884
5 Ga0070683_100002376 3300005329 Bacteria 14933
6 Ga0070683_100010546 3300005329 Bacteria 7944
7 Ga0068869_100118884 3300005334 Bacteria 2019
8 Ga0070666_10141848 3300005335 Bacteria 1673
9 Ga0070668_100056001 3300005347 Bacteria 3044
10 Ga0070671_100117683 3300005355 Bacteria 2234
11 Ga0070688_100071883 3300005365 Bacteria 2216
12 Ga0070659_100092167 3300005366 Bacteria 2429
13 Ga0070667_100017334 3300005367 Bacteria 5969
14 Ga0070709_10000652 3300005434 Bacteria 19741
15 Ga0070709_10008052 3300005434 Bacteria 5784
16 Ga0070714_100054725 3300005435 Bacteria 3409
17 Ga0070714_100253585 3300005435 Bacteria 1628
18 Ga0070714_100278728 3300005435 Bacteria 1553
19 Ga0070713_100004718 3300005436 Bacteria 9212
20 Ga0070713_100006818 3300005436 Bacteria 7958
21 Ga0070713_100034104 3300005436 Bacteria 4085
22 Ga0070713_100348251 3300005436 Bacteria 1374
23 Ga0070710_10000869 3300005437 Bacteria 14456
24 Ga0070710_10014059 3300005437 Bacteria 4020
25 Ga0070710_10045864 3300005437 Bacteria 2432
26 Ga0070710_10127666 3300005437 Unclassified 1547
27 Ga0070711_100014126 3300005439 Bacteria 5026
28 Ga0070711_100045413 3300005439 Bacteria 2988
29 Ga0070711_100075879 3300005439 Bacteria 2382
30 Ga0070711_100105384 3300005439 Bacteria 2059
31 Ga0070700_100138399 3300005441 Bacteria 1651
32 Ga0070708_100039730 3300005445 Bacteria 4119
33 Ga0070708_100137557 3300005445 Bacteria 2264
34 Ga0070662_100111969 3300005457 Bacteria 2080
35 Ga0070681_10044280 3300005458 Bacteria 4454
36 Ga0070681_10053424 3300005458 Bacteria 4026
37 Ga0070681_10078795 3300005458 Bacteria 3252
38 Ga0070707_100135156 3300005468 Bacteria 2399
39 Ga0070679_100011211 3300005530 Bacteria 8545
40 Ga0070679_100064516 3300005530 Bacteria 3650
41 Ga0070684_100005101 3300005535 Bacteria 10035
42 Ga0068853_100090651 3300005539 Bacteria 2687
43 Ga0068853_100208457 3300005539 Bacteria 1781
44 Ga0070665_100037555 3300005548 Bacteria 4870
45 Ga0068855_100242273 3300005563 Bacteria 2014
46 Ga0068855_100265032 3300005563 Bacteria 1913
47 Ga0070664_100045408 3300005564 Bacteria 3710
48 Ga0068854_100152623 3300005578 Bacteria 1782
49 Ga0068856_100000505 3300005614 Bacteria 43297
50 Ga0068856_100227964 3300005614 Viruses 1879
51 Ga0068852_100041724 3300005616 Bacteria 3879
52 Ga0068852_100265102 3300005616 Bacteria 1651
53 Ga0068864_100073054 3300005618 Unclassified 2990
54 Ga0068861_100199976 3300005719 Bacteria 1677
55 Ga0068863_100001400 3300005841 Bacteria 23922
56 Ga0068858_100037097 3300005842 Bacteria 4518
57 Ga0068862_100251953 3300005844 Bacteria 1609
58 Ga0081455_10035458 3300005937 Bacteria 4457
59 Ga0081455_10066786 3300005937 Bacteria 3001
60 Ga0081455_10218633 3300005937 Bacteria 1414
61 Ga0081540_1002292 3300005983 Bacteria 15720
62 Ga0081540_1003262 3300005983 Bacteria 12891
63 Ga0081540_1003714 3300005983 Bacteria 11962
64 Ga0081540_1005704 3300005983 Bacteria 9238
65 Ga0081540_1007903 3300005983 Bacteria 7511
66 Ga0081540_1009502 3300005983 Bacteria 6699
67 Ga0081540_1010212 3300005983 Bacteria 6377
68 Ga0081540_1011152 3300005983 Bacteria 6032
69 Ga0081540_1018636 3300005983 Bacteria 4250
70 Ga0081539_10000199 3300005985 Bacteria 139305
71 Ga0070717_10003637 3300006028 Bacteria 11057
72 Ga0070717_10005463 3300006028 Bacteria 9282
73 Ga0075365_10187656 3300006038 Bacteria 1446
74 Ga0070716_100001146 3300006173 Bacteria 11682
75 Ga0070712_100021391 3300006175 Bacteria 4249
76 Ga0070712_100051014 3300006175 Bacteria 2881
77 Ga0070712_100085832 3300006175 Bacteria 2292
78 Ga0075428_100130465 3300006844 Bacteria 2734
79 Ga0075434_100057650 3300006871 Bacteria 3860
80 Ga0075434_100144005 3300006871 Bacteria 2403
81 Ga0075429_100001515 3300006880 Bacteria 19135
82 Ga0075436_100017068 3300006914 Bacteria 4968
83 Ga0075435_100027515 3300007076 Bacteria 4449
84 Ga0105240_10024142 3300009093 Bacteria 8024
85 Ga0105240_10103796 3300009093 Bacteria 3453
86 Ga0111539_10225645 3300009094 Bacteria 2182
87 Ga0105247_10046751 3300009101 Viruses 2657
88 Ga0114129_10017461 3300009147 Bacteria 10217
89 Ga0114129_10084470 3300009147 Bacteria 4407
90 Ga0114129_10319923 3300009147 Bacteria 2063
91 Ga0105248_10020735 3300009177 Bacteria 7281
92 Ga0105237_10083100 3300009545 Bacteria 3194
93 Ga0105238_10025266 3300009551 Bacteria 6054
94 Ga0105238_10039796 3300009551 Bacteria 4766
95 Ga0105238_10158630 3300009551 Bacteria 2238
96 Ga0105249_10185633 3300009553 Bacteria 2026
97 Ga0105249_10196118 3300009553 Bacteria 1973
98 Ga0105239_10022574 3300010375 Bacteria 6939
99 Ga0105239_10062444 3300010375 Bacteria 4089
100 Ga0105239_10130534 3300010375 Bacteria 2794
101 Ga0105246_10072405 3300011119 Bacteria 2429
102 Ga0157370_10123171 3300013104 Bacteria 2421
103 Ga0157369_10027368 3300013105 Bacteria 6320
104 Ga0157369_10114034 3300013105 Bacteria 2871
105 Ga0157372_10141448 3300013307 Bacteria 2772
106 Ga0163163_10008168 3300014325 Bacteria 9282
107 Ga0157379_10042403 3300014968 Unclassified 4063
108 Ga0214544_1000001 3300021320 Bacteria 783667
109 Ga0214544_1032080 3300021320 Bacteria 1671
110 Ga0214542_1000065 3300021321 Bacteria 126045
111 Ga0214545_1000003 3300021324 Bacteria 720274
112 Ga0214543_1000002 3300021327 Bacteria 712733
113 Ga0213874_10004436 3300021377 Bacteria 3205
114 Ga0213876_10009271 3300021384 Bacteria 5301
115 Ga0213871_10000486 3300021441 Bacteria 5421
116 Ga0209148_1001900 3300025254 Bacteria 8563
117 Ga0209455_1001274 3300025272 Bacteria 11798
118 Ga0209564_1022078 3300025295 Bacteria 2262
119 Ga0209758_1000011 3300025297 Bacteria 1049685
120 Ga0209758_1000029 3300025297 Bacteria 520787
121 Ga0209050_1004404 3300025298 Bacteria 9536
122 Ga0209256_1002195 3300025299 Bacteria 16729
123 Ga0209257_1000418 3300025304 Bacteria 82230
124 Ga0207656_10016082 3300025321 Bacteria 2907
125 Ga0207692_10001691 3300025898 Bacteria 8334
126 Ga0207688_10044510 3300025901 Bacteria 2474
127 Ga0207699_10000253 3300025906 Bacteria 29543
128 Ga0207699_10041193 3300025906 Bacteria 2666
129 Ga0207645_10077238 3300025907 Bacteria 2133
130 Ga0207705_10099812 3300025909 Bacteria 2135
131 Ga0207707_10001093 3300025912 Bacteria 25844
132 Ga0207707_10194243 3300025912 Bacteria 1770
133 Ga0207707_10197093 3300025912 Bacteria 1756
134 Ga0207695_10000163 3300025913 Bacteria 197030
135 Ga0207671_10008503 3300025914 Bacteria 8696
136 Ga0207671_10144524 3300025914 Bacteria 1834
137 Ga0207693_10007068 3300025915 Bacteria 9265
138 Ga0207693_10020503 3300025915 Bacteria 5258
139 Ga0207693_10056447 3300025915 Bacteria 3078
140 Ga0207663_10000261 3300025916 Bacteria 22957
141 Ga0207663_10000913 3300025916 Bacteria 13487
142 Ga0207663_10047718 3300025916 Bacteria 2646
143 Ga0207660_10036441 3300025917 Bacteria 3419
144 Ga0207657_10002700 3300025919 Bacteria 19128
145 Ga0207657_10130427 3300025919 Bacteria 2060
146 Ga0207652_10033926 3300025921 Bacteria 4299
147 Ga0207652_10304466 3300025921 Bacteria 1439
148 Ga0207646_10056329 3300025922 Bacteria 3514
149 Ga0207694_10009709 3300025924 Bacteria 7258
150 Ga0207694_10114266 3300025924 Bacteria 2150
151 Ga0207700_10014522 3300025928 Bacteria 5163
152 Ga0207700_10048942 3300025928 Bacteria 3141
153 Ga0207664_10050984 3300025929 Bacteria 3266
154 Ga0207664_10211370 3300025929 Bacteria 1679
155 Ga0207664_10221903 3300025929 Bacteria 1640
156 Ga0207664_10374747 3300025929 Bacteria 1263
157 Ga0207690_10145154 3300025932 Bacteria 1753
158 Ga0207706_10267695 3300025933 Bacteria 1492
159 Ga0207689_10026025 3300025942 Bacteria 4899
160 Ga0207661_10021638 3300025944 Bacteria 4821
161 Ga0207661_10031059 3300025944 Bacteria 4121
162 Ga0207679_10034102 3300025945 Unclassified 3589
163 Ga0207667_10176545 3300025949 Bacteria 2194
164 Ga0207668_10036425 3300025972 Bacteria 3283
165 Ga0207640_10020045 3300025981 Bacteria 3963
166 Ga0207639_10054862 3300026041 Bacteria 3048
167 Ga0207639_10144396 3300026041 Bacteria 1986
168 Ga0207678_10066937 3300026067 Bacteria 3083
169 Ga0207708_10040362 3300026075 Bacteria 3558
170 Ga0207702_10000127 3300026078 Bacteria 89755
171 Ga0207641_10007298 3300026088 Bacteria 9211
172 Ga0207641_10059836 3300026088 Bacteria 3246
173 Ga0207674_10044742 3300026116 Bacteria 4559
174 Ga0207683_10026151 3300026121 Bacteria 5038
175 Ga0207698_10043427 3300026142 Bacteria 3367
176 Ga0209389_1000261 3300027296 Bacteria 33507
177 Ga0209489_107409 3300027361 Bacteria 16395
178 Ga0209700_101165 3300027363 Bacteria 53492
179 Ga0268266_10008702 3300028379 Bacteria 8997
180 Ga0268265_10076990 3300028380 Bacteria 2618
181 Ga0307511_10057142 3300030521 Bacteria 3039
182 Ga0265330_10040317 3300031235 Bacteria 2074
183 Ga0265325_10025451 3300031241 Bacteria 3214
184 Ga0265340_10007480 3300031247 Bacteria 5929
185 Ga0265339_10000535 3300031249 Bacteria 29681
186 Ga0265331_10036046 3300031250 Bacteria 2432
187 Ga0265316_10118010 3300031344 Bacteria 2005
188 Ga0307513_10101437 3300031456 Bacteria 2899
189 Ga0307513_10262136 3300031456 Bacteria 1517
190 Ga0307509_10027532 3300031507 Bacteria 6324
191 Ga0265313_10000977 3300031595 Bacteria 28255
192 Ga0307508_10000051 3300031616 Bacteria 134500
193 Ga0307508_10036080 3300031616 Bacteria 4453
194 Ga0307508_10077730 3300031616 Bacteria 2898
195 Ga0265314_10074635 3300031711 Bacteria 2259
196 Ga0265342_10067378 3300031712 Bacteria 2095
197 Ga0307516_10033587 3300031730 Bacteria 5163
198 Ga0307516_10039049 3300031730 Bacteria 4733
199 Ga0307507_10007677 3300033179 Bacteria 15449
200 Ga0373958_0006013 3300034819 Bacteria 1872
201 Ga0373926_0012314 3300035083 Bacteria 2889
202 Ga0373926_0019447 3300035083 Bacteria 2341
203 Ga0373928_0011225 3300035084 Unclassified 1771
204 Ga0373934_0000907 3300035086 Bacteria 10705
205 Ga0373949_0010912 3300035090 Bacteria 1996
206 Ga0373951_0003784 3300035091 Bacteria 3646
207 Ga0373951_0020950 3300035091 Bacteria 1500
208 Ga0373923_0001633 3300035111 Bacteria 6535
209 Ga0373923_0065096 3300035111 Bacteria 1555
210 Ga0373936_0004892 3300035113 Bacteria 5050
211 Ga0373936_0084271 3300035113 Unclassified 1326
212 Ga0373945_0009023 3300035116 Bacteria 3259
213 Ga0373945_0010901 3300035116 Bacteria 2998
214 Ga0373945_0030516 3300035116 Bacteria 1901
215 Ga0373945_0040718 3300035116 Bacteria 1678
216 Ga0373953_0001289 3300035117 Bacteria 7186
217 Ga0373953_0001479 3300035117 Bacteria 6818
218 Ga0373953_0031272 3300035117 Bacteria 2069
219 Ga0373954_0000418 3300035118 Bacteria 15854
220 Ga0373954_0002486 3300035118 Bacteria 7734
221 Ga0373954_0113655 3300035118 Bacteria 1311
222 Ga0373956_0000845 3300035119 Bacteria 12743
223 Ga0373956_0003309 3300035119 Bacteria 6491
224 Ga0373957_0000872 3300035120 Bacteria 7908
225 Ga0373957_0001629 3300035120 Bacteria 6152
226 Ga0373943_0001707 3300035170 Bacteria 9950
227 Ga0373943_0005956 3300035170 Bacteria 5470
228 Ga0373943_0070175 3300035170 Bacteria 1772
229 Ga0373946_0004495 3300035171 Bacteria 4993
230 Ga0373955_0002155 3300035172 Bacteria 8512
231 Ga0373955_0031763 3300035172 Bacteria 2767
232 Ga0373942_0020794 3300035207 Bacteria 1651
233 Ga0373961_0017512 3300035241 Bacteria 1860
234 Ga0373962_0005302 3300035242 Bacteria 3120
235 Ga0373924_0043457 3300035410 Bacteria 1845
236 Ga0373935_0003099 3300035692 Bacteria 9595
237 Ga0373935_0006104 3300035692 Bacteria 7165
238 Ga0373935_0010897 3300035692 Bacteria 5459
239 Ga0373927_0001527 3300035695 Bacteria 17419
240 Ga0373927_0011466 3300035695 Bacteria 5905
241 Ga0373927_0029786 3300035695 Bacteria 3559
242 Ga0373927_0096455 3300035695 Bacteria 1922
243 Ga0373933_0007734 3300035724 Bacteria 5869
244 Ga0373933_0071337 3300035724 Bacteria 2114
245 Ga0373947_0001643 3300035725 Bacteria 13717
246 Ga0373947_0002026 3300035725 Bacteria 12370
247 Ga0373947_0008244 3300035725 Bacteria 6007
248 Ga0373937_0014727 3300036401 Bacteria 6903
249 Ga0373937_0021674 3300036401 Bacteria 5768
250 Ga0373937_0022887 3300036401 Bacteria 5619
251 Ga0373937_0032222 3300036401 Bacteria 4754
252 Ga0373925_0002216 3300037068 Bacteria 15772
253 Ga0373925_0020641 3300037068 Bacteria 4799
254 Ga0373925_0044340 3300037068 Bacteria 3302
255 Ga0373925_0139190 3300037068 Bacteria 1899
256 Ga0373925_0186898 3300037068 Bacteria 1643
257 Ga0373925_0235373 3300037068 Bacteria 1465
258 Ga0395899_0078467 3300037312 Bacteria 2407
259 Ga0395899_0190716 3300037312 Bacteria 1434
260 Ga0395900_0001274 3300037418 Bacteria 30815
261 Ga0395898_0038797 3300037466 Bacteria 4718
262 Ga0395898_0049484 3300037466 Bacteria 4118
263 Ga0395898_0054198 3300037466 Bacteria 3914
264 Ga0436364_0441566 3300037853 Bacteria 2349
265 Ga0395901_0009376 3300038443 Bacteria 9930
266 Ga0436365_0167764 3300039437 Bacteria 15121
267 Ga0436365_1396592 3300039437 Bacteria 2076
268 Ga0436360_0662934 3300039438 Bacteria 3604
269 Ga0436361_0837543 3300039447 Bacteria 2108
270 Ga0436363_0607283 3300039450 Bacteria 3637
271 Ga0436363_1321742 3300039450 Bacteria 4353
272 Ga0466969_0028337 3300044656 Bacteria 2863
273 Ga0466966_0000702 3300044684 Bacteria 21284
274 Ga0466961_0000005 3300044693 Bacteria 173105
275 Ga0466963_0053240 3300044694 Bacteria 2687
276 Ga0466968_0000345 3300044735 Bacteria 14999
277 Ga0466960_0008575 3300044901 Bacteria 4189
278 Ga0466960_0073971 3300044901 Bacteria 1702
279 Ga0466959_0001046 3300045049 Bacteria 16580
280 Ga0466959_0053950 3300045049 Bacteria 2938
281 Ga0466967_0356510 3300045976 Bacteria 1416
282 Ga0495592_0018086 3300046454 Bacteria 5354
283 Ga0495592_0018978 3300046454 Bacteria 5234
284 Ga0495592_0030706 3300046454 Bacteria 4064
285 Ga0495592_0033549 3300046454 Bacteria 3871
286 Ga0495592_0037943 3300046454 Bacteria 3626
287 Ga0495603_0000874 3300046455 Bacteria 17304
288 Ga0495603_0040550 3300046455 Bacteria 2786
289 Ga0495629_0000439 3300046459 Bacteria 34692
290 Ga0495629_0000957 3300046459 Bacteria 23286
291 Ga0495629_0001624 3300046459 Bacteria 17672
292 Ga0495629_0003662 3300046459 Bacteria 11620
293 Ga0495629_0016837 3300046459 Bacteria 5247
294 Ga0495641_0017557 3300046461 Bacteria 3725
295 Ga0495651_0005010 3300046462 Bacteria 10118
296 Ga0495651_0030252 3300046462 Bacteria 4222
297 Ga0495651_0051126 3300046462 Bacteria 3187
298 Ga0495651_0067234 3300046462 Bacteria 2734
299 Ga0495653_0003152 3300046463 Bacteria 13226
300 Ga0495653_0005267 3300046463 Bacteria 10524
301 Ga0495653_0009243 3300046463 Bacteria 8065
302 Ga0495653_0065763 3300046463 Bacteria 2728
303 Ga0495653_0144111 3300046463 Bacteria 1672
304 Ga0495650_0067316 3300046471 Bacteria 1415
305 Ga0495580_0010813 3300046472 Bacteria 7086
306 Ga0495580_0013917 3300046472 Bacteria 6124
307 Ga0495580_0044645 3300046472 Bacteria 3151
308 Ga0495580_0094615 3300046472 Bacteria 2078
309 Ga0495582_0001713 3300046473 Bacteria 12367
310 Ga0495582_0003251 3300046473 Bacteria 9124
311 Ga0495582_0004193 3300046473 Bacteria 8104
312 Ga0495582_0017650 3300046473 Bacteria 3904
313 Ga0495639_0023423 3300046475 Bacteria 2713
314 Ga0495662_0001221 3300046476 Bacteria 12639
315 Ga0495662_0003347 3300046476 Bacteria 8127
316 Ga0495662_0003360 3300046476 Bacteria 8115
317 Ga0495662_0008624 3300046476 Bacteria 5009
318 Ga0495664_0002496 3300046477 Bacteria 9884
319 Ga0495664_0008760 3300046477 Bacteria 5651
320 Ga0495664_0009612 3300046477 Bacteria 5412
321 Ga0495664_0012243 3300046477 Bacteria 4858
322 Ga0495664_0014189 3300046477 Bacteria 4513
323 Ga0495664_0051252 3300046477 Bacteria 2451
324 Ga0495594_0041782 3300046499 Bacteria 2510
325 Ga0495607_0052550 3300046501 Bacteria 2360
326 Ga0495606_0097769 3300046507 Bacteria 1793
327 Ga0495606_0102164 3300046507 Bacteria 1743
328 Ga0495608_0016278 3300046511 Bacteria 5143
329 Ga0495608_0020011 3300046511 Bacteria 4602
330 Ga0495608_0044795 3300046511 Bacteria 2951
331 Ga0495618_0004727 3300046514 Bacteria 8329
332 Ga0495618_0011000 3300046514 Bacteria 5482
333 Ga0495618_0016732 3300046514 Bacteria 4491
334 Ga0495618_0186858 3300046514 Bacteria 1315
335 Ga0495628_0009164 3300046516 Bacteria 8462
336 Ga0495628_0011453 3300046516 Bacteria 7499
337 Ga0495628_0059791 3300046516 Bacteria 2991
338 Ga0495628_0105381 3300046516 Bacteria 2172
339 Ga0495630_0004053 3300046517 Bacteria 10260
340 Ga0495630_0024054 3300046517 Bacteria 4504
341 Ga0495648_0001613 3300046524 Bacteria 21927
342 Ga0495652_0005540 3300046529 Bacteria 11876
343 Ga0495652_0018046 3300046529 Bacteria 6294
344 Ga0495652_0018986 3300046529 Bacteria 6125
345 Ga0495652_0031735 3300046529 Bacteria 4623
346 Ga0495652_0076070 3300046529 Bacteria 2786
347 Ga0495665_0000555 3300046531 Bacteria 18998
348 Ga0495665_0004987 3300046531 Bacteria 7152
349 Ga0495665_0010902 3300046531 Bacteria 4918
350 Ga0495665_0020528 3300046531 Bacteria 3547
351 Ga0495640_0001232 3300046533 Bacteria 20045
352 Ga0495640_0015329 3300046533 Bacteria 5769
353 Ga0495640_0022937 3300046533 Bacteria 4559
354 Ga0495640_0023532 3300046533 Bacteria 4484
355 Ga0495640_0075883 3300046533 Bacteria 2244
356 Ga0495640_0126912 3300046533 Bacteria 1654
357 Ga0495586_0165123 3300046535 Bacteria 1250
358 Ga0495587_0021844 3300046536 Bacteria 3947
359 Ga0495587_0024180 3300046536 Bacteria 3726
360 Ga0495645_0004096 3300046543 Bacteria 9951
361 Ga0495645_0020702 3300046543 Bacteria 4749
362 Ga0495645_0032362 3300046543 Bacteria 3814
363 Ga0495645_0085788 3300046543 Bacteria 2253
364 Ga0495622_0058139 3300046557 Bacteria 1791
365 Ga0495667_0003416 3300046559 Bacteria 10642
366 Ga0495667_0006509 3300046559 Bacteria 7929
367 Ga0495667_0007486 3300046559 Bacteria 7405
368 Ga0495667_0017156 3300046559 Bacteria 4890
369 Ga0495634_0003146 3300046642 Bacteria 13385
370 Ga0495634_0011308 3300046642 Bacteria 6499
371 Ga0495634_0021994 3300046642 Bacteria 4497
372 Ga0495634_0053532 3300046642 Bacteria 2703
373 Ga0495635_0001321 3300046663 Bacteria 16507
374 Ga0495635_0001430 3300046663 Bacteria 15944
375 Ga0495635_0003515 3300046663 Bacteria 10840
376 Ga0495635_0004888 3300046663 Bacteria 9327
377 Ga0495635_0029753 3300046663 Bacteria 3798
378 Ga0495635_0099846 3300046663 Bacteria 1984
379 Ga0495588_0024577 3300046674 Bacteria 2994
380 Ga0495588_0094420 3300046674 Bacteria 1568
381 Ga0495657_0011371 3300046675 Bacteria 6658
382 Ga0495657_0016293 3300046675 Bacteria 5418
383 Ga0495657_0019090 3300046675 Bacteria 4951
384 Ga0495599_0005440 3300046678 Bacteria 7612
385 Ga0495599_0009549 3300046678 Bacteria 5932
386 Ga0495623_0005927 3300046679 Bacteria 7963
387 Ga0495623_0011605 3300046679 Bacteria 5705
388 Ga0495646_0003601 3300046680 Bacteria 9670
389 Ga0495646_0050400 3300046680 Bacteria 2524
390 Ga0495647_0013806 3300046681 Bacteria 2805
391 Ga0495647_0048218 3300046681 Bacteria 1646
392 Ga0495658_0003018 3300046683 Bacteria 8431
393 Ga0495658_0007236 3300046683 Bacteria 5483
394 Ga0495658_0028955 3300046683 Bacteria 2993
395 Ga0495669_0016999 3300046684 Bacteria 3120
396 Ga0495613_0007405 3300046689 Bacteria 8180
397 Ga0495613_0007855 3300046689 Bacteria 7934
398 Ga0495613_0022781 3300046689 Bacteria 4667
399 Ga0495613_0061250 3300046689 Bacteria 2756
400 Ga0495624_0010732 3300046690 Bacteria 6311
401 Ga0495624_0015569 3300046690 Bacteria 5132
402 Ga0495670_0016635 3300046691 Bacteria 3617
403 Ga0495670_0098618 3300046691 Bacteria 1503
404 Ga0495649_0026330 3300046694 Bacteria 3235
405 Ga0495600_0001772 3300046809 Bacteria 12077
406 Ga0495600_0002854 3300046809 Bacteria 10059
407 Ga0495600_0015929 3300046809 Bacteria 4763
408 Ga0495600_0019448 3300046809 Bacteria 4337
409 Ga0495600_0054423 3300046809 Bacteria 2614
410 Ga0495600_0121957 3300046809 Bacteria 1695
411 Ga0495581_0000019 3300047315 Bacteria 57810
412 Ga0495581_0018778 3300047315 Bacteria 4013
413 Ga0495581_0194816 3300047315 Bacteria 1185
414 Ga0495604_0009404 3300047317 Bacteria 7729
415 Ga0495604_0021441 3300047317 Bacteria 5158
416 Ga0495604_0024159 3300047317 Bacteria 4851
417 Ga0495604_0133743 3300047317 Bacteria 1779
418 Ga0495604_0143864 3300047317 Bacteria 1701
419 Ga0495674_0000458 3300047319 Bacteria 36828
420 Ga0495674_0004826 3300047319 Bacteria 12966
421 Ga0495674_0007899 3300047319 Bacteria 10158
422 Ga0495674_0024761 3300047319 Bacteria 5510
423 Ga0495674_0051900 3300047319 Bacteria 3612
424 Ga0495674_0069090 3300047319 Bacteria 3055
425 Ga0495674_0393141 3300047319 Bacteria 1120
426 Ga0495676_0012040 3300047321 Bacteria 7801
427 Ga0495676_0140096 3300047321 Bacteria 1734
428 Ga0495680_0002514 3300047322 Bacteria 18756
429 Ga0495680_0006264 3300047322 Bacteria 11086
430 Ga0495680_0006358 3300047322 Bacteria 10996
431 Ga0495680_0006496 3300047322 Bacteria 10851
432 Ga0495680_0053859 3300047322 Bacteria 3127
433 Ga0495683_0029663 3300047323 Bacteria 2795
434 Ga0495675_0003040 3300047444 Bacteria 10086
435 Ga0495675_0019849 3300047444 Bacteria 4270
436 Ga0495675_0114566 3300047444 Bacteria 1681
437 Ga0495673_0067486 3300047469 Bacteria 1514
438 Ga0495684_0000858 3300047471 Bacteria 24643
439 Ga0495684_0012483 3300047471 Bacteria 6547
440 Ga0495684_0015123 3300047471 Bacteria 5943
441 Ga0495684_0016167 3300047471 Bacteria 5746
442 Ga0495684_0016590 3300047471 Bacteria 5673
443 Ga0495684_0025610 3300047471 Bacteria 4532
444 Ga0495684_0144597 3300047471 Bacteria 1782
445 Ga0495686_0089907 3300047472 Bacteria 1865
446 Ga0495686_0093319 3300047472 Bacteria 1825
447 Ga0495593_0001308 3300047673 Bacteria 14618
448 Ga0495593_0007997 3300047673 Bacteria 6157
449 Ga0495593_0025486 3300047673 Bacteria 3273
450 Ga0495593_0049823 3300047673 Bacteria 2221
451 Ga0495593_0072701 3300047673 Bacteria 1784
452 Ga0495602_0021970 3300048088 Bacteria 6257
453 Ga0495602_0042156 3300048088 Bacteria 4161
454 Ga0495602_0045631 3300048088 Bacteria 3964
455 Ga0495602_0137898 3300048088 Bacteria 1935
456 Ga0496100_0048412 3300048903 Bacteria 2743
457 Ga0496101_0092273 3300048904 Bacteria 2254
458 Ga0496101_0172164 3300048904 Bacteria 1664
459 Ga0496102_0185629 3300048905 Bacteria 1960
460 Ga0496103_0003032 3300048906 Bacteria 10350
461 Ga0496104_0007805 3300048907 Bacteria 9484
462 Ga0496104_0106758 3300048907 Bacteria 2683
463 Ga0496104_0147831 3300048907 Bacteria 2256
464 Ga0496105_0109466 3300048908 Bacteria 2281
465 Ga0496106_0072829 3300048909 Bacteria 2628
466 Ga0496108_0101584 3300048911 Bacteria 2453
467 Ga0496109_0072033 3300048912 Unclassified 3173
468 Ga0496109_0156512 3300048912 Bacteria 2134
469 Ga0496109_0216064 3300048912 Bacteria 1803
470 Ga0496110_0059420 3300048913 Bacteria 3370
471 Ga0496111_0110818 3300048914 Bacteria 2021
472 Ga0496111_0186190 3300048914 Bacteria 1543
473 Ga0496112_0013614 3300048915 Bacteria 7517
474 Ga0496112_0035370 3300048915 Bacteria 4865
475 Ga0496112_0155142 3300048915 Bacteria 2256
476 Ga0496112_0226557 3300048915 Bacteria 1824
477 Ga0496113_0043810 3300048916 Unclassified 3313
478 Ga0496113_0059137 3300048916 Bacteria 2886
479 Ga0496115_0006490 3300048918 Bacteria 8574
480 Ga0496117_0005455 3300048920 Bacteria 13342
481 Ga0496121_0004013 3300048924 Bacteria 20280
482 Ga0496121_0068786 3300048924 Bacteria 2862
483 Ga0496121_0098894 3300048924 Bacteria 2256
484 Ga0496121_0099505 3300048924 Bacteria 2247
485 Ga0496124_0001073 3300048927 Bacteria 43225
486 Ga0496124_0145324 3300048927 Bacteria 1867
487 Ga0496125_0000199 3300048928 Bacteria 126676
488 Ga0496125_0000629 3300048928 Bacteria 59181
489 Ga0496126_0003114 3300048929 Bacteria 21387
490 Ga0496126_0027371 3300048929 Bacteria 5446
491 Ga0496126_0032011 3300048929 Bacteria 4960
492 Ga0496126_0046721 3300048929 Bacteria 3967
493 Ga0496126_0049448 3300048929 Bacteria 3838
494 Ga0496126_0051609 3300048929 Bacteria 3743
495 Ga0496126_0086729 3300048929 Bacteria 2759
496 Ga0496126_0185277 3300048929 Bacteria 1765
497 Ga0496126_0287752 3300048929 Bacteria 1360
498 Ga0501032_0071686 3300049569 Bacteria 2309
499 Ga0501034_0154664 3300049571 Bacteria 2268
500 Ga0501037_0165688 3300049573 Bacteria 1574
501 Ga0501039_0004638 3300049575 Bacteria 10391
502 Ga0501040_0006035 3300049576 Bacteria 7842
503 Ga0501041_0004005 3300049577 Bacteria 8503
504 Ga0501042_0004901 3300049578 Bacteria 8567
505 Ga0501043_0059317 3300049579 Unclassified 3003
506 Ga0501043_0113158 3300049579 Bacteria 2131
507 Ga0501046_0017346 3300049580 Bacteria 6011
508 Ga0501046_0104763 3300049580 Bacteria 2167
509 Ga0501047_0005748 3300049581 Bacteria 11674
510 Ga0501047_0057751 3300049581 Bacteria 3752
511 Ga0501047_0099096 3300049581 Bacteria 2793
512 Ga0501048_0052580 3300049582 Bacteria 2899
513 Ga0501048_0269413 3300049582 Bacteria 1210
514 Ga0501067_0072683 3300049583 Bacteria 1905
515 Ga0501068_0048432 3300049584 Unclassified 2566
516 Ga0501070_0033964 3300049586 Bacteria 4267
517 Ga0501071_0008679 3300049587 Bacteria 6723
518 Ga0501072_0053566 3300049588 Bacteria 3177
519 Ga0501073_0014495 3300049589 Bacteria 5728
520 Ga0501074_0032392 3300049590 Bacteria 3787
521 Ga0501075_0035458 3300049591 Bacteria 3720
522 Ga0501075_0273636 3300049591 Bacteria 1287
523 Ga0501076_0005914 3300049592 Bacteria 8829
524 Ga0501077_0004218 3300049593 Bacteria 8686
525 Ga0501079_0006176 3300049741 Bacteria 8986
526 Ga0501080_0044549 3300049742 Bacteria 4130
527 Ga0501081_0004561 3300049743 Bacteria 8897
528 Ga0501083_0130625 3300049744 Bacteria 1646
529 Ga0501035_0040687 3300049822 Bacteria 4199
530 Ga0501035_0298375 3300049822 Bacteria 1358
531 Ga0501044_0012350 3300049823 Bacteria 9244
532 Ga0501044_0050167 3300049823 Bacteria 4307
533 Ga0501045_0009753 3300049824 Bacteria 6716
534 nmdc:mga03n38_125282_c1 3300050490 Bacteria 1267
535 nmdc:mga03n38_29891_c1 3300050490 Bacteria 2285
536 nmdc:mga00v17_36387_c1 3300050491 Bacteria 2933
537 nmdc:mga0yw44_22966_c1 3300050492 Bacteria 3507
538 nmdc:mga06z11_5354_c1 3300050494 Bacteria 5139
539 nmdc:mga07m45_122990_c1 3300050496 Bacteria 1499
540 nmdc:mga05p37_284586_c1 3300050507 Bacteria 1970
541 nmdc:mga09592_2511_c1 3300050508 Bacteria 14842
542 nmdc:mga08y16_61191_c1 3300050511 Bacteria 3931
543 nmdc:mga0n895_8527_c1 3300050512 Bacteria 8881
544 nmdc:mga0rr50_93390_c1 3300050513 Bacteria 2347
545 Ga0495601_0053353 3300053077 Bacteria 2555
546 Ga0495601_0127727 3300053077 Unclassified 1654
547 Ga0495612_0004870 3300053078 Bacteria 5560
548 Ga0495612_0007244 3300053078 Bacteria 4539
549 Ga0495612_0058321 3300053078 Bacteria 1595
550 Ga0495595_0001002 3300053084 Bacteria 10896
551 Ga0495595_0001906 3300053084 Bacteria 8109
552 Ga0495595_0010918 3300053084 Bacteria 3789
553 Ga0495619_0000535 3300053085 Bacteria 25107
554 Ga0495619_0001280 3300053085 Bacteria 16510
555 Ga0495619_0002556 3300053085 Bacteria 11906
556 Ga0495619_0046296 3300053085 Bacteria 2859
557 Ga0495619_0164526 3300053085 Bacteria 1533
558 Ga0500647_0064247 3300053091 Bacteria 1765
559 Ga0500651_0037538 3300053093 Bacteria 3053
560 Ga0500566_0000046 3300053094 Bacteria 59187
561 Ga0500566_0004284 3300053094 Bacteria 8517
562 Ga0500640_005282 3300053095 Bacteria 4796
563 Ga0500641_0002242 3300053096 Bacteria 6842
564 Ga0500641_0004452 3300053096 Bacteria 4953
565 Ga0500572_002369 3300053111 Bacteria 4548
566 Ga0500591_086145 3300053115 Bacteria 1383
567 Ga0500595_000391 3300053119 Bacteria 28235
568 Ga0500595_001395 3300053119 Bacteria 12953
569 Ga0500607_055938 3300053121 Bacteria 2084
570 Ga0500608_004894 3300053122 Bacteria 5244
571 Ga0500608_081580 3300053122 Bacteria 1525
572 Ga0500614_001648 3300053123 Bacteria 5243
573 Ga0500614_003833 3300053123 Bacteria 3216
574 Ga0500652_000019 3300053131 Bacteria 120149
575 Ga0500559_0001633 3300053136 Bacteria 12428
576 Ga0500577_0000239 3300053142 Bacteria 14570
577 Ga0500590_057400 3300053148 Bacteria 1964
578 Ga0500603_000071 3300053150 Bacteria 23487
579 Ga0500603_000328 3300053150 Bacteria 12422
580 Ga0500604_0000357 3300053151 Bacteria 12630
581 Ga0500616_0001397 3300053153 Bacteria 23247
582 Ga0500630_009402 3300053159 Bacteria 4797
583 Ga0500634_0029111 3300053161 Bacteria 3010
584 Ga0500638_002339 3300053162 Bacteria 6552
585 Ga0500639_000009 3300053163 Bacteria 139043
586 Ga0500636_0004982 3300053177 Bacteria 7538
587 Ga0500636_0005231 3300053177 Bacteria 7387
588 Ga0500637_0000262 3300053178 Bacteria 19711
589 Ga0500637_0027684 3300053178 Bacteria 3130
590 Ga0500576_074026 3300053725 Bacteria 1457
591 Ga0500625_025869 3300053729 Bacteria 2777
592 Ga0500596_002470 3300053735 Bacteria 3644
593 Ga0500596_010113 3300053735 Bacteria 1463
594 Ga0501084_0000249 3300054114 Bacteria 40750
595 Ga0500661_000172 3300055283 Bacteria 11274
596 Ga0500661_009841 3300055283 Bacteria 1744
597 Ga0501082_0026523 3300060353 Bacteria 4994
598 Ga0501082_0276691 3300060353 Bacteria 1461
599 Ga0466962_0057141 3300061719 Bacteria 1863

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025929 Ga0207664_10374747 Ga0207664_103747472 338
2 3300046543 Ga0495645_0085788 Ga0495645_0085788_16_1050 344
3 3300047319 Ga0495674_0393141 Ga0495674_0393141_39_1109 350
4 3300048929 Ga0496126_0046721 Ga0496126_0046721_2817_3953 363
5 3300005439 Ga0070711_100105384 Ga0070711_1001053842 364
6 3300060353 Ga0501082_0276691 Ga0501082_0276691_264_1370 366
7 iso_pu_bacteria 8019538911 8019546719 367
8 3300046514 Ga0495618_0186858 Ga0495618_0186858_183_1289 368
9 3300046454 Ga0495592_0030706 Ga0495592_0030706_19_1128 369
10 3300049582 Ga0501048_0269413 Ga0501048_0269413_43_1152 369
11 3300046516 Ga0495628_0105381 Ga0495628_0105381_26_1141 371
12 3300047472 Ga0495686_0093319 Ga0495686_0093319_60_1175 371
13 3300053085 Ga0495619_0164526 Ga0495619_0164526_24_1139 371
14 3300003215 JGI25153J46596_10000062 JGI25153J46596_1000006225 378
15 3300009147 Ga0114129_10017461 Ga0114129_100174618 378
16 3300025297 Ga0209758_1000029 Ga0209758_1000029271 378
17 3300053151 Ga0500604_0000357 Ga0500604_0000357_5221_6402 378
18 3300039437 Ga0436365_1396592 Ga0436365_1396592_734_1900 379
19 3300046642 Ga0495634_0021994 Ga0495634_0021994_341_1513 379
20 3300046691 Ga0495670_0016635 Ga0495670_0016635_340_1509 379
21 3300047471 Ga0495684_0025610 Ga0495684_0025610_2525_3697 379
22 3300053093 Ga0500651_0037538 Ga0500651_0037538_306_1490 379
23 3300053096 Ga0500641_0002242 Ga0500641_0002242_1969_3150 379
24 3300031456 Ga0307513_10101437 Ga0307513_101014372 380
25 3300049573 Ga0501037_0165688 Ga0501037_0165688_217_1386 380
26 3300049581 Ga0501047_0057751 Ga0501047_0057751_922_2091 380
27 3300049744 Ga0501083_0130625 Ga0501083_0130625_419_1588 380
28 iso_pu_bacteria 2879083081 2879084109 380
29 3300025914 Ga0207671_10144524 Ga0207671_101445241 381
30 3300046535 Ga0495586_0165123 Ga0495586_0165123_82_1236 381
31 3300047315 Ga0495581_0194816 Ga0495581_0194816_11_1165 381
32 3300049579 Ga0501043_0113158 Ga0501043_0113158_306_1496 381
33 3300049581 Ga0501047_0099096 Ga0501047_0099096_870_2060 381
34 3300049586 Ga0501070_0033964 Ga0501070_0033964_1714_2904 381
35 3300049822 Ga0501035_0298375 Ga0501035_0298375_26_1216 381
36 3300049823 Ga0501044_0050167 Ga0501044_0050167_1188_2378 381
37 3300025298 Ga0209050_1004404 Ga0209050_10044043 382
38 3300025304 Ga0209257_1000418 Ga0209257_100041894 382
39 3300031616 Ga0307508_10077730 Ga0307508_100777302 382
40 3300046454 Ga0495592_0037943 Ga0495592_0037943_1980_3149 382
41 3300049591 Ga0501075_0273636 Ga0501075_0273636_16_1221 382
42 3300053119 Ga0500595_000391 Ga0500595_000391_1429_2628 382
43 3300053153 Ga0500616_0001397 Ga0500616_0001397_14712_15908 382
44 3300053177 Ga0500636_0005231 Ga0500636_0005231_1652_2887 382
45 3300025915 Ga0207693_10020503 Ga0207693_100205033 384
46 3300035113 Ga0373936_0084271 Ga0373936_0084271_98_1273 384
47 3300035116 Ga0373945_0009023 Ga0373945_0009023_911_2086 384
48 3300035118 Ga0373954_0113655 Ga0373954_0113655_97_1284 384
49 3300035170 Ga0373943_0005956 Ga0373943_0005956_680_1855 384
50 3300035692 Ga0373935_0010897 Ga0373935_0010897_3657_4832 384
51 3300036401 Ga0373937_0032222 Ga0373937_0032222_627_1802 384
52 3300044656 Ga0466969_0028337 Ga0466969_0028337_1173_2336 384
53 3300044684 Ga0466966_0000702 Ga0466966_0000702_16996_18159 384
54 3300044693 Ga0466961_0000005 Ga0466961_0000005_163288_164451 384
55 3300045049 Ga0466959_0001046 Ga0466959_0001046_1152_2315 384
56 3300046459 Ga0495629_0001624 Ga0495629_0001624_720_1895 384
57 3300046462 Ga0495651_0067234 Ga0495651_0067234_323_1498 384
58 3300046463 Ga0495653_0005267 Ga0495653_0005267_979_2154 384
59 3300046473 Ga0495582_0001713 Ga0495582_0001713_548_1723 384
60 3300046475 Ga0495639_0023423 Ga0495639_0023423_492_1667 384
61 3300046476 Ga0495662_0003347 Ga0495662_0003347_6640_7815 384
62 3300046511 Ga0495608_0044795 Ga0495608_0044795_1261_2436 384
63 3300046514 Ga0495618_0011000 Ga0495618_0011000_178_1353 384
64 3300046517 Ga0495630_0004053 Ga0495630_0004053_262_1437 384
65 3300046531 Ga0495665_0004987 Ga0495665_0004987_2295_3470 384
66 3300046533 Ga0495640_0015329 Ga0495640_0015329_3806_4981 384
67 3300046559 Ga0495667_0006509 Ga0495667_0006509_6108_7283 384
68 3300046663 Ga0495635_0004888 Ga0495635_0004888_1523_2698 384
69 3300046681 Ga0495647_0048218 Ga0495647_0048218_455_1630 384
70 3300046683 Ga0495658_0007236 Ga0495658_0007236_1088_2263 384
71 3300046809 Ga0495600_0019448 Ga0495600_0019448_2763_3938 384
72 3300047319 Ga0495674_0069090 Ga0495674_0069090_1645_2820 384
73 3300047321 Ga0495676_0012040 Ga0495676_0012040_5941_7116 384
74 3300047322 Ga0495680_0006358 Ga0495680_0006358_8932_10107 384
75 3300047471 Ga0495684_0000858 Ga0495684_0000858_14824_15999 384
76 3300048905 Ga0496102_0185629 Ga0496102_0185629_226_1389 384
77 3300053077 Ga0495601_0127727 Ga0495601_0127727_404_1579 384
78 3300053078 Ga0495612_0004870 Ga0495612_0004870_736_1911 384
79 3300053084 Ga0495595_0001002 Ga0495595_0001002_8331_9506 384
80 3300053085 Ga0495619_0002556 Ga0495619_0002556_4446_5621 384
81 3300053177 Ga0500636_0004982 Ga0500636_0004982_1058_2278 385
82 3300005445 Ga0070708_100137557 Ga0070708_1001375572 386
83 3300005468 Ga0070707_100135156 Ga0070707_1001351562 386
84 3300005842 Ga0068858_100037097 Ga0068858_1000370972 386
85 3300006880 Ga0075429_100001515 Ga0075429_10000151523 386
86 3300025922 Ga0207646_10056329 Ga0207646_100563292 386
87 3300031249 Ga0265339_10000535 Ga0265339_1000053515 386
88 3300031344 Ga0265316_10118010 Ga0265316_101180102 386
89 3300031595 Ga0265313_10000977 Ga0265313_100009777 386
90 3300035724 Ga0373933_0071337 Ga0373933_0071337_144_1313 386
91 3300046501 Ga0495607_0052550 Ga0495607_0052550_1107_2297 386
92 3300048928 Ga0496125_0000199 Ga0496125_0000199_121811_122980 386
93 3300049571 Ga0501034_0154664 Ga0501034_0154664_824_1999 386
94 3300050508 nmdc:mga09592_2511_c1 nmdc:mga09592_2511_c1_2073_3263 386
95 3300053131 Ga0500652_000019 Ga0500652_000019_29198_30418 386
96 iso_pu_bacteria 2513237098 2513678781 386
97 iso_pu_bacteria 2513237141 2513887308 386
98 iso_pu_bacteria 2903768456 2903773180 386
99 3300005334 Ga0068869_100118884 Ga0068869_1001188841 387
100 3300005365 Ga0070688_100071883 Ga0070688_1000718832 387
101 3300005614 Ga0068856_100227964 Ga0068856_1002279642 387
102 3300005841 Ga0068863_100001400 Ga0068863_1000014007 387
103 3300009101 Ga0105247_10046751 Ga0105247_100467512 387
104 3300014968 Ga0157379_10042403 Ga0157379_100424033 387
105 3300026088 Ga0207641_10007298 Ga0207641_100072982 387
106 3300048908 Ga0496105_0109466 Ga0496105_0109466_932_2122 387
107 3300005335 Ga0070666_10141848 Ga0070666_101418481 388
108 3300005355 Ga0070671_100117683 Ga0070671_1001176832 388
109 3300005367 Ga0070667_100017334 Ga0070667_1000173342 388
110 3300005437 Ga0070710_10127666 Ga0070710_101276661 388
111 3300005439 Ga0070711_100075879 Ga0070711_1000758792 388
112 3300005441 Ga0070700_100138399 Ga0070700_1001383992 388
113 3300005564 Ga0070664_100045408 Ga0070664_1000454083 388
114 3300005618 Ga0068864_100073054 Ga0068864_1000730542 388
115 3300005937 Ga0081455_10218633 Ga0081455_102186331 388
116 3300005983 Ga0081540_1007903 Ga0081540_10079032 388
117 3300006175 Ga0070712_100085832 Ga0070712_1000858322 388
118 3300006871 Ga0075434_100144005 Ga0075434_1001440052 388
119 3300006914 Ga0075436_100017068 Ga0075436_1000170684 388
120 3300007076 Ga0075435_100027515 Ga0075435_1000275153 388
121 3300009177 Ga0105248_10020735 Ga0105248_100207352 388
122 3300009553 Ga0105249_10185633 Ga0105249_101856332 388
123 3300009553 Ga0105249_10196118 Ga0105249_101961182 388
124 3300011119 Ga0105246_10072405 Ga0105246_100724052 388
125 3300014325 Ga0163163_10008168 Ga0163163_100081688 388
126 3300025907 Ga0207645_10077238 Ga0207645_100772382 388
127 3300025915 Ga0207693_10007068 Ga0207693_100070685 388
128 3300025919 Ga0207657_10130427 Ga0207657_101304272 388
129 3300025942 Ga0207689_10026025 Ga0207689_100260252 388
130 3300025945 Ga0207679_10034102 Ga0207679_100341022 388
131 3300026121 Ga0207683_10026151 Ga0207683_100261514 388
132 3300028379 Ga0268266_10008702 Ga0268266_100087023 388
133 3300034819 Ga0373958_0006013 Ga0373958_0006013_78_1277 388
134 3300035084 Ga0373928_0011225 Ga0373928_0011225_515_1714 388
135 3300035090 Ga0373949_0010912 Ga0373949_0010912_781_1977 388
136 3300035091 Ga0373951_0003784 Ga0373951_0003784_342_1541 388
137 3300035091 Ga0373951_0020950 Ga0373951_0020950_135_1331 388
138 3300035170 Ga0373943_0070175 Ga0373943_0070175_303_1502 388
139 3300035207 Ga0373942_0020794 Ga0373942_0020794_284_1483 388
140 3300035241 Ga0373961_0017512 Ga0373961_0017512_235_1434 388
141 3300035242 Ga0373962_0005302 Ga0373962_0005302_1277_2476 388
142 3300035692 Ga0373935_0006104 Ga0373935_0006104_1062_2261 388
143 3300035725 Ga0373947_0001643 Ga0373947_0001643_12098_13303 388
144 3300035725 Ga0373947_0002026 Ga0373947_0002026_2195_3394 388
145 3300037068 Ga0373925_0020641 Ga0373925_0020641_378_1577 388
146 3300039447 Ga0436361_0837543 Ga0436361_0837543_528_1778 388
147 3300039450 Ga0436363_1321742 Ga0436363_1321742_1919_3169 388
148 3300046459 Ga0495629_0003662 Ga0495629_0003662_7474_8673 388
149 3300046461 Ga0495641_0017557 Ga0495641_0017557_1366_2562 388
150 3300046463 Ga0495653_0009243 Ga0495653_0009243_5318_6523 388
151 3300046472 Ga0495580_0044645 Ga0495580_0044645_1395_2591 388
152 3300046473 Ga0495582_0004193 Ga0495582_0004193_3492_4691 388
153 3300046476 Ga0495662_0001221 Ga0495662_0001221_6370_7575 388
154 3300046477 Ga0495664_0002496 Ga0495664_0002496_4701_5906 388
155 3300046499 Ga0495594_0041782 Ga0495594_0041782_1083_2282 388
156 3300046514 Ga0495618_0016732 Ga0495618_0016732_1228_2433 388
157 3300046529 Ga0495652_0018986 Ga0495652_0018986_2984_4189 388
158 3300046531 Ga0495665_0020528 Ga0495665_0020528_513_1718 388
159 3300046642 Ga0495634_0003146 Ga0495634_0003146_5429_6634 388
160 3300046674 Ga0495588_0094420 Ga0495588_0094420_59_1258 388
161 3300046683 Ga0495658_0003018 Ga0495658_0003018_2608_3807 388
162 3300046689 Ga0495613_0007405 Ga0495613_0007405_2223_3422 388
163 3300046690 Ga0495624_0010732 Ga0495624_0010732_382_1587 388
164 3300046809 Ga0495600_0121957 Ga0495600_0121957_329_1528 388
165 3300047315 Ga0495581_0018778 Ga0495581_0018778_2056_3261 388
166 3300047319 Ga0495674_0051900 Ga0495674_0051900_608_1813 388
167 3300047321 Ga0495676_0140096 Ga0495676_0140096_285_1484 388
168 3300047322 Ga0495680_0053859 Ga0495680_0053859_293_1492 388
169 3300047471 Ga0495684_0015123 Ga0495684_0015123_3511_4716 388
170 3300048903 Ga0496100_0048412 Ga0496100_0048412_239_1438 388
171 3300048904 Ga0496101_0092273 Ga0496101_0092273_654_1853 388
172 3300048904 Ga0496101_0172164 Ga0496101_0172164_253_1452 388
173 3300048906 Ga0496103_0003032 Ga0496103_0003032_2146_3345 388
174 3300048907 Ga0496104_0007805 Ga0496104_0007805_3791_4990 388
175 3300048907 Ga0496104_0106758 Ga0496104_0106758_847_2046 388
176 3300048907 Ga0496104_0147831 Ga0496104_0147831_42_1241 388
177 3300048911 Ga0496108_0101584 Ga0496108_0101584_239_1438 388
178 3300048912 Ga0496109_0072033 Ga0496109_0072033_1297_2490 388
179 3300048912 Ga0496109_0156512 Ga0496109_0156512_239_1438 388
180 3300048914 Ga0496111_0186190 Ga0496111_0186190_169_1368 388
181 3300048915 Ga0496112_0013614 Ga0496112_0013614_5303_6502 388
182 3300048915 Ga0496112_0035370 Ga0496112_0035370_3392_4585 388
183 3300048915 Ga0496112_0155142 Ga0496112_0155142_1016_2215 388
184 3300048916 Ga0496113_0043810 Ga0496113_0043810_1087_2280 388
185 3300048916 Ga0496113_0059137 Ga0496113_0059137_1048_2247 388
186 3300048918 Ga0496115_0006490 Ga0496115_0006490_1733_2932 388
187 3300053085 Ga0495619_0000535 Ga0495619_0000535_6334_7533 388
188 3300053142 Ga0500577_0000239 Ga0500577_0000239_4963_6138 388
189 iso_pu_bacteria 2874604998 2874611803 388
190 iso_pu_bacteria 2885366525 2885370273 388
191 iso_pu_bacteria 2885383462 2885390091 388
192 iso_pu_bacteria 8056681323 8056687835 388
193 3300047472 Ga0495686_0089907 Ga0495686_0089907_90_1271 389
194 3300048928 Ga0496125_0000629 Ga0496125_0000629_3485_4663 389
195 3300048929 Ga0496126_0049448 Ga0496126_0049448_406_1584 389
196 3300049569 Ga0501032_0071686 Ga0501032_0071686_32_1216 389
197 3300049575 Ga0501039_0004638 Ga0501039_0004638_4676_5902 389
198 3300049576 Ga0501040_0006035 Ga0501040_0006035_5396_6622 389
199 3300049577 Ga0501041_0004005 Ga0501041_0004005_4798_6024 389
200 3300049578 Ga0501042_0004901 Ga0501042_0004901_4819_6045 389
201 3300049579 Ga0501043_0059317 Ga0501043_0059317_1647_2873 389
202 3300049580 Ga0501046_0017346 Ga0501046_0017346_1821_3047 389
203 3300049582 Ga0501048_0052580 Ga0501048_0052580_932_2158 389
204 3300049584 Ga0501068_0048432 Ga0501068_0048432_1318_2544 389
205 3300049587 Ga0501071_0008679 Ga0501071_0008679_3542_4768 389
206 3300049588 Ga0501072_0053566 Ga0501072_0053566_263_1489 389
207 3300049590 Ga0501074_0032392 Ga0501074_0032392_723_1949 389
208 3300049591 Ga0501075_0035458 Ga0501075_0035458_16_1242 389
209 3300049592 Ga0501076_0005914 Ga0501076_0005914_5201_6427 389
210 3300049593 Ga0501077_0004218 Ga0501077_0004218_2496_3722 389
211 3300049741 Ga0501079_0006176 Ga0501079_0006176_2627_3853 389
212 3300049743 Ga0501081_0004561 Ga0501081_0004561_2523_3749 389
213 3300049822 Ga0501035_0040687 Ga0501035_0040687_1686_2912 389
214 3300049824 Ga0501045_0009753 Ga0501045_0009753_548_1774 389
215 3300054114 Ga0501084_0000249 Ga0501084_0000249_32549_33775 389
216 3300060353 Ga0501082_0026523 Ga0501082_0026523_1248_2474 389
217 iso_pu_bacteria 2508501009 2508541433 389
218 iso_pu_bacteria 2513237092 2513621528 389
219 iso_pu_bacteria 2513237102 2513703967 389
220 iso_pu_bacteria 2513237104 2513719206 389
221 iso_pu_bacteria 2515154112 2515629775 389
222 iso_pu_bacteria 2524023205 2524441203 389
223 iso_pu_bacteria 2524023210 2524464971 389
224 iso_pu_bacteria 2744054633 2745078664 389
225 iso_pu_bacteria 2824617872 2824621290 389
226 iso_pu_bacteria 2824626560 2824630429 389
227 iso_pu_bacteria 2824635225 2824638228 389
228 iso_pu_bacteria 2824644064 2824647147 389
229 iso_pu_bacteria 2824679649 2824686215 389
230 iso_pu_bacteria 2824714736 2824720497 389
231 iso_pu_bacteria 2824723954 2824730791 389
232 iso_pu_bacteria 2824732956 2824738204 389
233 iso_pu_bacteria 2844315083 2844320284 389
234 iso_pu_bacteria 2847930680 2847937613 389
235 iso_pu_bacteria 2849076700 2849078125 389
236 iso_pu_bacteria 2874590934 2874592860 389
237 iso_pu_bacteria 2874620515 2874623776 389
238 iso_pu_bacteria 2874645413 2874650708 389
239 iso_pu_bacteria 2876761206 2876768473 389
240 iso_pu_bacteria 2876771140 2876776288 389
241 iso_pu_bacteria 2876818435 2876822248 389
242 iso_pu_bacteria 2879074833 2879080377 389
243 iso_pu_bacteria 2879127579 2879133465 389
244 iso_pu_bacteria 2879142872 2879145788 389
245 iso_pu_bacteria 2881665667 2881667168 389
246 iso_pu_bacteria 2903727486 2903731564 389
247 iso_pu_bacteria 2904666416 2904674005 389
248 iso_pu_bacteria 2906602504 2906608327 389
249 iso_pu_bacteria 2906643746 2906645182 389
250 iso_pu_bacteria 2932794094 2932799761 389
251 iso_pu_bacteria 2932801729 2932808652 389
252 iso_pu_bacteria 2935608549 2935610244 389
253 iso_pu_bacteria 2935648319 2935651217 389
254 iso_pu_bacteria 2935656913 2935659397 389
255 iso_pu_bacteria 2935769743 2935771219 389
256 iso_pu_bacteria 2935777560 2935781016 389
257 iso_pu_bacteria 2935785616 2935786080 389
258 iso_pu_bacteria 2935793552 2935797737 389
259 iso_pu_bacteria 2935819856 2935823405 389
260 iso_pu_bacteria 2935847175 2935848889 389
261 iso_pu_bacteria 2935883170 2935885576 389
262 iso_pu_bacteria 2935908558 2935912981 389
263 iso_pu_bacteria 2935916978 2935924446 389
264 iso_pu_bacteria 2935926038 2935930126 389
265 iso_pu_bacteria 2935934488 2935939027 389
266 iso_pu_bacteria 2935942939 2935945974 389
267 iso_pu_bacteria 2935951376 2935955311 389
268 iso_pu_bacteria 2935959822 2935963009 389
269 iso_pu_bacteria 2935967501 2935972318 389
270 iso_pu_bacteria 2935975950 2935976243 389
271 iso_pu_bacteria 2936011229 2936013812 389
272 iso_pu_bacteria 2936019824 2936022664 389
273 iso_pu_bacteria 2936028420 2936033283 389
274 iso_pu_bacteria 2936046547 2936048918 389
275 iso_pu_bacteria 2936055302 2936060504 389
276 iso_pu_bacteria 3005483717 3005488557 389
277 iso_pu_bacteria 3005587118 3005588377 389
278 iso_pu_bacteria 3005594810 3005600662 389
279 iso_pu_bacteria 3005710791 3005716101 389
280 iso_pu_bacteria 3005718088 3005723438 389
281 iso_pu_bacteria 8006926726 8006927779 389
282 iso_pu_bacteria 8016522445 8016528378 389
283 iso_pu_bacteria 8016539877 8016546754 389
284 iso_pu_bacteria 8016548790 8016555362 389
285 iso_pu_bacteria 8016557553 8016563723 389
286 iso_pu_bacteria 8016575299 8016576071 389
287 iso_pu_bacteria 8016595262 8016601453 389
288 iso_pu_bacteria 8016613128 8016616226 389
289 iso_pu_bacteria 8016622563 8016625016 389
290 iso_pu_bacteria 8016630954 8016638852 389
291 iso_pu_bacteria 8019530166 8019533317 389
292 iso_pu_bacteria 8019547302 8019552052 389
293 iso_pu_bacteria 8019619141 8019620119 389
294 iso_pu_bacteria 8019629233 8019632985 389
295 iso_pu_bacteria 8019638758 8019646937 389
296 iso_pu_bacteria 8019659431 8019660852 389
297 iso_pu_bacteria 8019668869 8019670402 389
298 iso_pu_bacteria 8019678201 8019685828 389
299 iso_pu_bacteria 8019687851 8019692002 389
300 iso_pu_bacteria 8056967851 8056974772 389
301 3300005366 Ga0070659_100092167 Ga0070659_1000921672 390
302 3300005616 Ga0068852_100041724 Ga0068852_1000417244 390
303 3300005983 Ga0081540_1002292 Ga0081540_10022929 390
304 3300006028 Ga0070717_10003637 Ga0070717_100036372 390
305 3300021441 Ga0213871_10000486 Ga0213871_100004863 390
306 3300025932 Ga0207690_10145154 Ga0207690_101451542 390
307 3300035113 Ga0373936_0004892 Ga0373936_0004892_3506_4726 390
308 3300039438 Ga0436360_0662934 Ga0436360_0662934_1223_2404 390
309 3300046533 Ga0495640_0126912 Ga0495640_0126912_77_1276 390
310 3300046663 Ga0495635_0099846 Ga0495635_0099846_158_1357 390
311 3300048913 Ga0496110_0059420 Ga0496110_0059420_401_1606 390
312 3300048924 Ga0496121_0068786 Ga0496121_0068786_362_1543 390
313 3300049583 Ga0501067_0072683 Ga0501067_0072683_350_1555 390
314 3300053091 Ga0500647_0064247 Ga0500647_0064247_51_1286 390
315 3300053094 Ga0500566_0000046 Ga0500566_0000046_42119_43354 390
316 3300053094 Ga0500566_0000046 Ga0500566_0000046_43555_44775 390
317 3300053095 Ga0500640_005282 Ga0500640_005282_3417_4637 390
318 3300053111 Ga0500572_002369 Ga0500572_002369_1047_2282 390
319 3300053111 Ga0500572_002369 Ga0500572_002369_2483_3703 390
320 3300053115 Ga0500591_086145 Ga0500591_086145_131_1366 390
321 3300053122 Ga0500608_004894 Ga0500608_004894_298_1518 390
322 3300053123 Ga0500614_001648 Ga0500614_001648_145_1380 390
323 3300053123 Ga0500614_003833 Ga0500614_003833_1813_3033 390
324 3300053136 Ga0500559_0001633 Ga0500559_0001633_5152_6372 390
325 3300053136 Ga0500559_0001633 Ga0500559_0001633_6573_7808 390
326 3300053148 Ga0500590_057400 Ga0500590_057400_21_1256 390
327 3300053150 Ga0500603_000071 Ga0500603_000071_5242_6462 390
328 3300053150 Ga0500603_000071 Ga0500603_000071_6663_7898 390
329 3300053159 Ga0500630_009402 Ga0500630_009402_1681_2901 390
330 3300053159 Ga0500630_009402 Ga0500630_009402_245_1480 390
331 3300053162 Ga0500638_002339 Ga0500638_002339_2024_3259 390
332 3300053162 Ga0500638_002339 Ga0500638_002339_3460_4680 390
333 3300053163 Ga0500639_000009 Ga0500639_000009_134364_135599 390
334 3300053163 Ga0500639_000009 Ga0500639_000009_135800_137020 390
335 3300053178 Ga0500637_0027684 Ga0500637_0027684_1209_2402 390
336 3300053725 Ga0500576_074026 Ga0500576_074026_65_1285 390
337 3300053735 Ga0500596_002470 Ga0500596_002470_160_1380 390
338 3300053735 Ga0500596_010113 Ga0500596_010113_159_1394 390
339 iso_pu_bacteria 2508501042 2508693237 390
340 iso_pu_bacteria 2617270741 2617373029 390
341 iso_pu_bacteria 2881364244 2881370247 390
342 iso_pu_bacteria 2935984226 2935986258 390
343 3300005347 Ga0070668_100056001 Ga0070668_1000560012 391
344 3300005434 Ga0070709_10008052 Ga0070709_100080522 391
345 3300005435 Ga0070714_100054725 Ga0070714_1000547251 391
346 3300005436 Ga0070713_100006818 Ga0070713_1000068182 391
347 3300005437 Ga0070710_10014059 Ga0070710_100140594 391
348 3300005439 Ga0070711_100045413 Ga0070711_1000454133 391
349 3300005445 Ga0070708_100039730 Ga0070708_1000397302 391
350 3300005563 Ga0068855_100242273 Ga0068855_1002422732 391
351 3300005578 Ga0068854_100152623 Ga0068854_1001526232 391
352 3300005719 Ga0068861_100199976 Ga0068861_1001999762 391
353 3300005844 Ga0068862_100251953 Ga0068862_1002519532 391
354 3300005983 Ga0081540_1003262 Ga0081540_100326213 391
355 3300006028 Ga0070717_10005463 Ga0070717_100054635 391
356 3300006038 Ga0075365_10187656 Ga0075365_101876562 391
357 3300006175 Ga0070712_100051014 Ga0070712_1000510142 391
358 3300006844 Ga0075428_100130465 Ga0075428_1001304652 391
359 3300009093 Ga0105240_10024142 Ga0105240_100241427 391
360 3300009094 Ga0111539_10225645 Ga0111539_102256452 391
361 3300009147 Ga0114129_10084470 Ga0114129_100844701 391
362 3300009545 Ga0105237_10083100 Ga0105237_100831002 391
363 3300009551 Ga0105238_10025266 Ga0105238_100252662 391
364 3300010375 Ga0105239_10022574 Ga0105239_100225748 391
365 3300013104 Ga0157370_10123171 Ga0157370_101231713 391
366 3300025295 Ga0209564_1022078 Ga0209564_10220781 391
367 3300025321 Ga0207656_10016082 Ga0207656_100160823 391
368 3300025901 Ga0207688_10044510 Ga0207688_100445102 391
369 3300025909 Ga0207705_10099812 Ga0207705_100998122 391
370 3300025915 Ga0207693_10056447 Ga0207693_100564474 391
371 3300025919 Ga0207657_10002700 Ga0207657_100027003 391
372 3300025924 Ga0207694_10009709 Ga0207694_100097092 391
373 3300025928 Ga0207700_10014522 Ga0207700_100145222 391
374 3300025949 Ga0207667_10176545 Ga0207667_101765452 391
375 3300025972 Ga0207668_10036425 Ga0207668_100364252 391
376 3300025981 Ga0207640_10020045 Ga0207640_100200453 391
377 3300026041 Ga0207639_10144396 Ga0207639_101443962 391
378 3300026075 Ga0207708_10040362 Ga0207708_100403622 391
379 3300026088 Ga0207641_10059836 Ga0207641_100598362 391
380 3300026116 Ga0207674_10044742 Ga0207674_100447424 391
381 3300028380 Ga0268265_10076990 Ga0268265_100769902 391
382 3300030521 Ga0307511_10057142 Ga0307511_100571422 391
383 3300031235 Ga0265330_10040317 Ga0265330_100403172 391
384 3300031241 Ga0265325_10025451 Ga0265325_100254512 391
385 3300031247 Ga0265340_10007480 Ga0265340_100074805 391
386 3300031507 Ga0307509_10027532 Ga0307509_100275323 391
387 3300031616 Ga0307508_10000051 Ga0307508_1000005149 391
388 3300031616 Ga0307508_10036080 Ga0307508_100360803 391
389 3300031712 Ga0265342_10067378 Ga0265342_100673782 391
390 3300031730 Ga0307516_10033587 Ga0307516_100335876 391
391 3300031730 Ga0307516_10039049 Ga0307516_100390496 391
392 3300033179 Ga0307507_10007677 Ga0307507_1000767710 391
393 3300035083 Ga0373926_0012314 Ga0373926_0012314_228_1448 391
394 3300035086 Ga0373934_0000907 Ga0373934_0000907_2008_3192 391
395 3300035111 Ga0373923_0001633 Ga0373923_0001633_2494_3678 391
396 3300035116 Ga0373945_0010901 Ga0373945_0010901_514_1734 391
397 3300035116 Ga0373945_0030516 Ga0373945_0030516_61_1245 391
398 3300035117 Ga0373953_0001289 Ga0373953_0001289_1895_3079 391
399 3300035117 Ga0373953_0001479 Ga0373953_0001479_3600_4784 391
400 3300035118 Ga0373954_0000418 Ga0373954_0000418_3918_5102 391
401 3300035118 Ga0373954_0002486 Ga0373954_0002486_3860_5044 391
402 3300035119 Ga0373956_0000845 Ga0373956_0000845_9530_10714 391
403 3300035119 Ga0373956_0003309 Ga0373956_0003309_3424_4608 391
404 3300035120 Ga0373957_0000872 Ga0373957_0000872_473_1657 391
405 3300035120 Ga0373957_0001629 Ga0373957_0001629_853_2037 391
406 3300035171 Ga0373946_0004495 Ga0373946_0004495_1890_3110 391
407 3300035172 Ga0373955_0002155 Ga0373955_0002155_2886_4070 391
408 3300035172 Ga0373955_0031763 Ga0373955_0031763_1330_2514 391
409 3300035410 Ga0373924_0043457 Ga0373924_0043457_164_1348 391
410 3300035692 Ga0373935_0003099 Ga0373935_0003099_7886_9106 391
411 3300035695 Ga0373927_0001527 Ga0373927_0001527_4458_5678 391
412 3300035695 Ga0373927_0011466 Ga0373927_0011466_3282_4466 391
413 3300035695 Ga0373927_0096455 Ga0373927_0096455_463_1650 391
414 3300035724 Ga0373933_0007734 Ga0373933_0007734_2044_3228 391
415 3300035725 Ga0373947_0008244 Ga0373947_0008244_3481_4665 391
416 3300036401 Ga0373937_0014727 Ga0373937_0014727_2883_4067 391
417 3300036401 Ga0373937_0021674 Ga0373937_0021674_1782_2966 391
418 3300036401 Ga0373937_0022887 Ga0373937_0022887_2560_3744 391
419 3300037068 Ga0373925_0002216 Ga0373925_0002216_4300_5520 391
420 3300037068 Ga0373925_0186898 Ga0373925_0186898_420_1604 391
421 3300037068 Ga0373925_0235373 Ga0373925_0235373_66_1250 391
422 3300046454 Ga0495592_0018086 Ga0495592_0018086_1334_2518 391
423 3300046454 Ga0495592_0018978 Ga0495592_0018978_730_1914 391
424 3300046455 Ga0495603_0000874 Ga0495603_0000874_14193_15377 391
425 3300046455 Ga0495603_0040550 Ga0495603_0040550_194_1378 391
426 3300046459 Ga0495629_0000439 Ga0495629_0000439_16015_17199 391
427 3300046459 Ga0495629_0000957 Ga0495629_0000957_11976_13160 391
428 3300046459 Ga0495629_0016837 Ga0495629_0016837_1878_3062 391
429 3300046462 Ga0495651_0005010 Ga0495651_0005010_5316_6500 391
430 3300046462 Ga0495651_0030252 Ga0495651_0030252_1568_2752 391
431 3300046463 Ga0495653_0003152 Ga0495653_0003152_10148_11332 391
432 3300046463 Ga0495653_0065763 Ga0495653_0065763_1374_2558 391
433 3300046472 Ga0495580_0010813 Ga0495580_0010813_3953_5137 391
434 3300046472 Ga0495580_0013917 Ga0495580_0013917_3954_5174 391
435 3300046473 Ga0495582_0003251 Ga0495582_0003251_6323_7507 391
436 3300046476 Ga0495662_0008624 Ga0495662_0008624_1252_2436 391
437 3300046477 Ga0495664_0008760 Ga0495664_0008760_3929_5113 391
438 3300046477 Ga0495664_0012243 Ga0495664_0012243_247_1431 391
439 3300046511 Ga0495608_0016278 Ga0495608_0016278_724_1908 391
440 3300046511 Ga0495608_0020011 Ga0495608_0020011_1970_3154 391
441 3300046514 Ga0495618_0004727 Ga0495618_0004727_3060_4244 391
442 3300046516 Ga0495628_0009164 Ga0495628_0009164_5785_6969 391
443 3300046516 Ga0495628_0011453 Ga0495628_0011453_707_1891 391
444 3300046517 Ga0495630_0024054 Ga0495630_0024054_1019_2203 391
445 3300046524 Ga0495648_0001613 Ga0495648_0001613_16769_17953 391
446 3300046529 Ga0495652_0005540 Ga0495652_0005540_7784_8968 391
447 3300046529 Ga0495652_0031735 Ga0495652_0031735_2463_3647 391
448 3300046531 Ga0495665_0000555 Ga0495665_0000555_17251_18435 391
449 3300046533 Ga0495640_0001232 Ga0495640_0001232_9354_10538 391
450 3300046533 Ga0495640_0023532 Ga0495640_0023532_1015_2199 391
451 3300046536 Ga0495587_0021844 Ga0495587_0021844_459_1643 391
452 3300046536 Ga0495587_0024180 Ga0495587_0024180_1525_2709 391
453 3300046543 Ga0495645_0032362 Ga0495645_0032362_2043_3227 391
454 3300046559 Ga0495667_0003416 Ga0495667_0003416_1018_2202 391
455 3300046559 Ga0495667_0017156 Ga0495667_0017156_805_1989 391
456 3300046642 Ga0495634_0053532 Ga0495634_0053532_63_1247 391
457 3300046663 Ga0495635_0001430 Ga0495635_0001430_11646_12830 391
458 3300046663 Ga0495635_0003515 Ga0495635_0003515_6543_7727 391
459 3300046663 Ga0495635_0029753 Ga0495635_0029753_1413_2597 391
460 3300046674 Ga0495588_0024577 Ga0495588_0024577_1633_2817 391
461 3300046675 Ga0495657_0016293 Ga0495657_0016293_558_1742 391
462 3300046675 Ga0495657_0019090 Ga0495657_0019090_724_1908 391
463 3300046678 Ga0495599_0005440 Ga0495599_0005440_1329_2513 391
464 3300046678 Ga0495599_0009549 Ga0495599_0009549_1257_2441 391
465 3300046679 Ga0495623_0011605 Ga0495623_0011605_1462_2646 391
466 3300046680 Ga0495646_0003601 Ga0495646_0003601_1762_2946 391
467 3300046680 Ga0495646_0050400 Ga0495646_0050400_693_1877 391
468 3300046681 Ga0495647_0013806 Ga0495647_0013806_1015_2199 391
469 3300046689 Ga0495613_0007855 Ga0495613_0007855_3665_4885 391
470 3300046689 Ga0495613_0022781 Ga0495613_0022781_95_1279 391
471 3300046689 Ga0495613_0061250 Ga0495613_0061250_1537_2721 391
472 3300046690 Ga0495624_0015569 Ga0495624_0015569_1925_3109 391
473 3300046691 Ga0495670_0098618 Ga0495670_0098618_231_1415 391
474 3300046809 Ga0495600_0001772 Ga0495600_0001772_10433_11617 391
475 3300046809 Ga0495600_0002854 Ga0495600_0002854_3434_4618 391
476 3300047315 Ga0495581_0000019 Ga0495581_0000019_9462_10646 391
477 3300047317 Ga0495604_0021441 Ga0495604_0021441_1115_2299 391
478 3300047317 Ga0495604_0024159 Ga0495604_0024159_1458_2642 391
479 3300047319 Ga0495674_0000458 Ga0495674_0000458_17825_19009 391
480 3300047319 Ga0495674_0024761 Ga0495674_0024761_3508_4692 391
481 3300047322 Ga0495680_0006264 Ga0495680_0006264_6997_8181 391
482 3300047322 Ga0495680_0006496 Ga0495680_0006496_1523_2707 391
483 3300047444 Ga0495675_0003040 Ga0495675_0003040_5597_6781 391
484 3300047444 Ga0495675_0019849 Ga0495675_0019849_1885_3069 391
485 3300047469 Ga0495673_0067486 Ga0495673_0067486_242_1426 391
486 3300047471 Ga0495684_0016167 Ga0495684_0016167_1257_2441 391
487 3300047471 Ga0495684_0016590 Ga0495684_0016590_2431_3615 391
488 3300047471 Ga0495684_0144597 Ga0495684_0144597_368_1552 391
489 3300047673 Ga0495593_0001308 Ga0495593_0001308_7648_8832 391
490 3300047673 Ga0495593_0007997 Ga0495593_0007997_1540_2724 391
491 3300047673 Ga0495593_0072701 Ga0495593_0072701_414_1634 391
492 3300048088 Ga0495602_0042156 Ga0495602_0042156_2035_3219 391
493 3300048088 Ga0495602_0045631 Ga0495602_0045631_737_1921 391
494 3300048909 Ga0496106_0072829 Ga0496106_0072829_1017_2201 391
495 3300048912 Ga0496109_0216064 Ga0496109_0216064_326_1510 391
496 3300048914 Ga0496111_0110818 Ga0496111_0110818_417_1601 391
497 3300048915 Ga0496112_0226557 Ga0496112_0226557_359_1543 391
498 3300048920 Ga0496117_0005455 Ga0496117_0005455_7319_8563 391
499 3300048924 Ga0496121_0004013 Ga0496121_0004013_4909_6153 391
500 3300048927 Ga0496124_0001073 Ga0496124_0001073_36809_38053 391
501 3300048929 Ga0496126_0027371 Ga0496126_0027371_2317_3561 391
502 3300048929 Ga0496126_0086729 Ga0496126_0086729_692_1879 391
503 3300048929 Ga0496126_0185277 Ga0496126_0185277_268_1452 391
504 3300048929 Ga0496126_0287752 Ga0496126_0287752_119_1306 391
505 3300050490 nmdc:mga03n38_125282_c1 nmdc:mga03n38_125282_c1_37_1242 391
506 3300050491 nmdc:mga00v17_36387_c1 nmdc:mga00v17_36387_c1_1079_2263 391
507 3300050496 nmdc:mga07m45_122990_c1 nmdc:mga07m45_122990_c1_258_1442 391
508 3300050507 nmdc:mga05p37_284586_c1 nmdc:mga05p37_284586_c1_421_1626 391
509 3300050511 nmdc:mga08y16_61191_c1 nmdc:mga08y16_61191_c1_721_1905 391
510 3300053078 Ga0495612_0058321 Ga0495612_0058321_381_1565 391
511 3300053084 Ga0495595_0001906 Ga0495595_0001906_2609_3793 391
512 3300053084 Ga0495595_0010918 Ga0495595_0010918_2435_3619 391
513 3300053085 Ga0495619_0001280 Ga0495619_0001280_3901_5085 391
514 3300053085 Ga0495619_0046296 Ga0495619_0046296_1410_2594 391
515 3300053096 Ga0500641_0004452 Ga0500641_0004452_1491_2675 391
516 3300053122 Ga0500608_081580 Ga0500608_081580_302_1492 391
517 3300053150 Ga0500603_000328 Ga0500603_000328_10160_11344 391
518 3300053161 Ga0500634_0029111 Ga0500634_0029111_1305_2492 391
519 3300005614 Ga0068856_100000505 Ga0068856_10000050516 392
520 3300009551 Ga0105238_10158630 Ga0105238_101586302 392
521 3300025924 Ga0207694_10114266 Ga0207694_101142662 392
522 3300026078 Ga0207702_10000127 Ga0207702_1000012768 392
523 3300031456 Ga0307513_10262136 Ga0307513_102621362 392
524 3300046471 Ga0495650_0067316 Ga0495650_0067316_53_1243 392
525 3300046809 Ga0495600_0054423 Ga0495600_0054423_703_1923 392
526 3300048929 Ga0496126_0003114 Ga0496126_0003114_17098_18285 392
527 3300050490 nmdc:mga03n38_29891_c1 nmdc:mga03n38_29891_c1_232_1425 392
528 3300050494 nmdc:mga06z11_5354_c1 nmdc:mga06z11_5354_c1_42_1238 392
529 3300050513 nmdc:mga0rr50_93390_c1 nmdc:mga0rr50_93390_c1_217_1404 392
530 3300053094 Ga0500566_0004284 Ga0500566_0004284_6724_7917 392
531 3300053119 Ga0500595_001395 Ga0500595_001395_9506_10699 392
532 3300053121 Ga0500607_055938 Ga0500607_055938_554_1747 392
533 3300053178 Ga0500637_0000262 Ga0500637_0000262_11157_12350 392
534 3300055283 Ga0500661_000172 Ga0500661_000172_4895_6088 392
535 3300005262 Ga0065165_1015649 Ga0065165_10156493 393
536 3300005329 Ga0070683_100010546 Ga0070683_1000105463 393
537 3300005457 Ga0070662_100111969 Ga0070662_1001119692 393
538 3300005458 Ga0070681_10044280 Ga0070681_100442802 393
539 3300005530 Ga0070679_100064516 Ga0070679_1000645163 393
540 3300005535 Ga0070684_100005101 Ga0070684_1000051012 393
541 3300005539 Ga0068853_100090651 Ga0068853_1000906512 393
542 3300005548 Ga0070665_100037555 Ga0070665_1000375553 393
543 3300005983 Ga0081540_1005704 Ga0081540_10057042 393
544 3300006871 Ga0075434_100057650 Ga0075434_1000576504 393
545 3300009551 Ga0105238_10039796 Ga0105238_100397963 393
546 3300010375 Ga0105239_10062444 Ga0105239_100624443 393
547 3300010375 Ga0105239_10130534 Ga0105239_101305344 393
548 3300021320 Ga0214544_1000001 Ga0214544_1000001449 393
549 3300021320 Ga0214544_1032080 Ga0214544_10320802 393
550 3300021321 Ga0214542_1000065 Ga0214542_100006568 393
551 3300021324 Ga0214545_1000003 Ga0214545_1000003315 393
552 3300021327 Ga0214543_1000002 Ga0214543_1000002452 393
553 3300025254 Ga0209148_1001900 Ga0209148_10019003 393
554 3300025272 Ga0209455_1001274 Ga0209455_100127411 393
555 3300025297 Ga0209758_1000011 Ga0209758_1000011659 393
556 3300025299 Ga0209256_1002195 Ga0209256_10021952 393
557 3300025913 Ga0207695_10000163 Ga0207695_1000016375 393
558 3300025914 Ga0207671_10008503 Ga0207671_1000850311 393
559 3300025917 Ga0207660_10036441 Ga0207660_100364412 393
560 3300025933 Ga0207706_10267695 Ga0207706_102676951 393
561 3300025944 Ga0207661_10031059 Ga0207661_100310592 393
562 3300026041 Ga0207639_10054862 Ga0207639_100548622 393
563 3300026142 Ga0207698_10043427 Ga0207698_100434272 393
564 3300027296 Ga0209389_1000261 Ga0209389_100026128 393
565 3300027361 Ga0209489_107409 Ga0209489_10740910 393
566 3300027363 Ga0209700_101165 Ga0209700_10116547 393
567 3300037312 Ga0395899_0190716 Ga0395899_0190716_221_1414 393
568 3300037418 Ga0395900_0001274 Ga0395900_0001274_793_1986 393
569 3300037466 Ga0395898_0054198 Ga0395898_0054198_967_2160 393
570 3300038443 Ga0395901_0009376 Ga0395901_0009376_7393_8586 393
571 3300044694 Ga0466963_0053240 Ga0466963_0053240_17_1207 393
572 3300044735 Ga0466968_0000345 Ga0466968_0000345_4464_5654 393
573 3300044901 Ga0466960_0008575 Ga0466960_0008575_1968_3158 393
574 3300044901 Ga0466960_0073971 Ga0466960_0073971_13_1206 393
575 3300045976 Ga0466967_0356510 Ga0466967_0356510_195_1385 393
576 3300046454 Ga0495592_0033549 Ga0495592_0033549_1555_2745 393
577 3300046462 Ga0495651_0051126 Ga0495651_0051126_1620_2810 393
578 3300046463 Ga0495653_0144111 Ga0495653_0144111_30_1220 393
579 3300046477 Ga0495664_0051252 Ga0495664_0051252_46_1236 393
580 3300046507 Ga0495606_0102164 Ga0495606_0102164_116_1306 393
581 3300046529 Ga0495652_0018046 Ga0495652_0018046_640_1830 393
582 3300046533 Ga0495640_0022937 Ga0495640_0022937_2447_3637 393
583 3300046533 Ga0495640_0075883 Ga0495640_0075883_215_1405 393
584 3300046543 Ga0495645_0020702 Ga0495645_0020702_3035_4225 393
585 3300046557 Ga0495622_0058139 Ga0495622_0058139_148_1338 393
586 3300046559 Ga0495667_0007486 Ga0495667_0007486_1544_2734 393
587 3300046663 Ga0495635_0001321 Ga0495635_0001321_2214_3404 393
588 3300046675 Ga0495657_0011371 Ga0495657_0011371_883_2073 393
589 3300046679 Ga0495623_0005927 Ga0495623_0005927_1364_2554 393
590 3300046694 Ga0495649_0026330 Ga0495649_0026330_830_2020 393
591 3300046809 Ga0495600_0015929 Ga0495600_0015929_1140_2330 393
592 3300047317 Ga0495604_0009404 Ga0495604_0009404_6329_7519 393
593 3300047317 Ga0495604_0133743 Ga0495604_0133743_113_1303 393
594 3300047319 Ga0495674_0004826 Ga0495674_0004826_8526_9716 393
595 3300047322 Ga0495680_0002514 Ga0495680_0002514_5422_6612 393
596 3300047323 Ga0495683_0029663 Ga0495683_0029663_626_1816 393
597 3300047444 Ga0495675_0114566 Ga0495675_0114566_401_1591 393
598 3300047673 Ga0495593_0049823 Ga0495593_0049823_425_1615 393
599 3300048088 Ga0495602_0021970 Ga0495602_0021970_2547_3737 393
600 3300048088 Ga0495602_0137898 Ga0495602_0137898_469_1659 393
601 3300048927 Ga0496124_0145324 Ga0496124_0145324_368_1558 393
602 3300048929 Ga0496126_0051609 Ga0496126_0051609_310_1509 393
603 3300050512 nmdc:mga0n895_8527_c1 nmdc:mga0n895_8527_c1_7524_8714 393
604 3300053729 Ga0500625_025869 Ga0500625_025869_180_1370 393
605 3300055283 Ga0500661_009841 Ga0500661_009841_362_1552 393
606 3300003203 JGI25406J46586_10006616 JGI25406J46586_100066162 394
607 3300003659 JGI25404J52841_10004779 JGI25404J52841_100047793 394
608 3300005329 Ga0070683_100002376 Ga0070683_1000023762 394
609 3300005434 Ga0070709_10000652 Ga0070709_100006522 394
610 3300005435 Ga0070714_100253585 Ga0070714_1002535852 394
611 3300005435 Ga0070714_100278728 Ga0070714_1002787281 394
612 3300005436 Ga0070713_100004718 Ga0070713_1000047182 394
613 3300005436 Ga0070713_100034104 Ga0070713_1000341042 394
614 3300005436 Ga0070713_100348251 Ga0070713_1003482511 394
615 3300005437 Ga0070710_10000869 Ga0070710_100008698 394
616 3300005437 Ga0070710_10045864 Ga0070710_100458642 394
617 3300005439 Ga0070711_100014126 Ga0070711_1000141262 394
618 3300005458 Ga0070681_10053424 Ga0070681_100534245 394
619 3300005458 Ga0070681_10078795 Ga0070681_100787952 394
620 3300005530 Ga0070679_100011211 Ga0070679_1000112117 394
621 3300005539 Ga0068853_100208457 Ga0068853_1002084571 394
622 3300005563 Ga0068855_100265032 Ga0068855_1002650322 394
623 3300005616 Ga0068852_100265102 Ga0068852_1002651022 394
624 3300005937 Ga0081455_10035458 Ga0081455_100354582 394
625 3300005937 Ga0081455_10066786 Ga0081455_100667862 394
626 3300005983 Ga0081540_1003714 Ga0081540_10037144 394
627 3300005983 Ga0081540_1009502 Ga0081540_10095024 394
628 3300005983 Ga0081540_1010212 Ga0081540_10102124 394
629 3300005983 Ga0081540_1011152 Ga0081540_10111523 394
630 3300005983 Ga0081540_1018636 Ga0081540_10186364 394
631 3300005985 Ga0081539_10000199 Ga0081539_1000019983 394
632 3300006173 Ga0070716_100001146 Ga0070716_1000011469 394
633 3300006175 Ga0070712_100021391 Ga0070712_1000213911 394
634 3300009093 Ga0105240_10103796 Ga0105240_101037962 394
635 3300009147 Ga0114129_10319923 Ga0114129_103199232 394
636 3300013105 Ga0157369_10027368 Ga0157369_100273684 394
637 3300013105 Ga0157369_10114034 Ga0157369_101140341 394
638 3300013307 Ga0157372_10141448 Ga0157372_101414483 394
639 3300021377 Ga0213874_10004436 Ga0213874_100044362 394
640 3300021384 Ga0213876_10009271 Ga0213876_100092713 394
641 3300025898 Ga0207692_10001691 Ga0207692_100016918 394
642 3300025906 Ga0207699_10000253 Ga0207699_100002534 394
643 3300025906 Ga0207699_10041193 Ga0207699_100411932 394
644 3300025912 Ga0207707_10001093 Ga0207707_1000109319 394
645 3300025912 Ga0207707_10194243 Ga0207707_101942432 394
646 3300025912 Ga0207707_10197093 Ga0207707_101970932 394
647 3300025916 Ga0207663_10000261 Ga0207663_1000026113 394
648 3300025916 Ga0207663_10000913 Ga0207663_100009137 394
649 3300025916 Ga0207663_10047718 Ga0207663_100477182 394
650 3300025921 Ga0207652_10033926 Ga0207652_100339264 394
651 3300025921 Ga0207652_10304466 Ga0207652_103044662 394
652 3300025928 Ga0207700_10048942 Ga0207700_100489424 394
653 3300025929 Ga0207664_10050984 Ga0207664_100509843 394
654 3300025929 Ga0207664_10211370 Ga0207664_102113702 394
655 3300025929 Ga0207664_10221903 Ga0207664_102219032 394
656 3300025944 Ga0207661_10021638 Ga0207661_100216385 394
657 3300026067 Ga0207678_10066937 Ga0207678_100669372 394
658 3300031250 Ga0265331_10036046 Ga0265331_100360463 394
659 3300031711 Ga0265314_10074635 Ga0265314_100746352 394
660 3300035083 Ga0373926_0019447 Ga0373926_0019447_332_1525 394
661 3300035111 Ga0373923_0065096 Ga0373923_0065096_329_1522 394
662 3300035116 Ga0373945_0040718 Ga0373945_0040718_329_1522 394
663 3300035117 Ga0373953_0031272 Ga0373953_0031272_210_1403 394
664 3300035170 Ga0373943_0001707 Ga0373943_0001707_4152_5345 394
665 3300035695 Ga0373927_0029786 Ga0373927_0029786_2263_3456 394
666 3300037068 Ga0373925_0044340 Ga0373925_0044340_1461_2654 394
667 3300037068 Ga0373925_0139190 Ga0373925_0139190_232_1416 394
668 3300037312 Ga0395899_0078467 Ga0395899_0078467_861_2123 394
669 3300037466 Ga0395898_0038797 Ga0395898_0038797_2000_3196 394
670 3300037466 Ga0395898_0049484 Ga0395898_0049484_1768_3030 394
671 3300037853 Ga0436364_0441566 Ga0436364_0441566_424_1620 394
672 3300039437 Ga0436365_0167764 Ga0436365_0167764_6999_8198 394
673 3300039450 Ga0436363_0607283 Ga0436363_0607283_893_2119 394
674 3300045049 Ga0466959_0053950 Ga0466959_0053950_64_1287 394
675 3300046472 Ga0495580_0094615 Ga0495580_0094615_146_1339 394
676 3300046473 Ga0495582_0017650 Ga0495582_0017650_172_1365 394
677 3300046476 Ga0495662_0003360 Ga0495662_0003360_4232_5425 394
678 3300046477 Ga0495664_0009612 Ga0495664_0009612_696_1889 394
679 3300046477 Ga0495664_0014189 Ga0495664_0014189_3261_4457 394
680 3300046507 Ga0495606_0097769 Ga0495606_0097769_580_1764 394
681 3300046516 Ga0495628_0059791 Ga0495628_0059791_39_1232 394
682 3300046529 Ga0495652_0076070 Ga0495652_0076070_1059_2252 394
683 3300046531 Ga0495665_0010902 Ga0495665_0010902_2042_3235 394
684 3300046543 Ga0495645_0004096 Ga0495645_0004096_723_1919 394
685 3300046642 Ga0495634_0011308 Ga0495634_0011308_4565_5758 394
686 3300046683 Ga0495658_0028955 Ga0495658_0028955_1060_2253 394
687 3300046684 Ga0495669_0016999 Ga0495669_0016999_702_1886 394
688 3300047317 Ga0495604_0143864 Ga0495604_0143864_317_1510 394
689 3300047319 Ga0495674_0007899 Ga0495674_0007899_2103_3296 394
690 3300047471 Ga0495684_0012483 Ga0495684_0012483_3336_4529 394
691 3300047673 Ga0495593_0025486 Ga0495593_0025486_895_2088 394
692 3300048924 Ga0496121_0098894 Ga0496121_0098894_61_1260 394
693 3300048924 Ga0496121_0099505 Ga0496121_0099505_923_2116 394
694 3300048929 Ga0496126_0032011 Ga0496126_0032011_1276_2475 394
695 3300049580 Ga0501046_0104763 Ga0501046_0104763_161_1417 394
696 3300049581 Ga0501047_0005748 Ga0501047_0005748_1747_3003 394
697 3300049589 Ga0501073_0014495 Ga0501073_0014495_1478_2734 394
698 3300049742 Ga0501080_0044549 Ga0501080_0044549_1955_3211 394
699 3300049823 Ga0501044_0012350 Ga0501044_0012350_3036_4292 394
700 3300050492 nmdc:mga0yw44_22966_c1 nmdc:mga0yw44_22966_c1_1616_2839 394
701 3300053077 Ga0495601_0053353 Ga0495601_0053353_452_1645 394
702 3300053078 Ga0495612_0007244 Ga0495612_0007244_2173_3366 394
703 3300061719 Ga0466962_0057141 Ga0466962_0057141_65_1288 394

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00211

Guanylate_cyc

Adenylate and Guanylate cyclase catalytic domain

225

411

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mbg-assembly1.cif.gz_A-2 structure of a bacterial light-regulated adenylyl cyclase 0.8847 201 385
1ybu-assembly2.cif.gz_C mycobacterium tuberculosis adenylyl cyclase rv1900c chd, in complex with a substrate analog. 0.8703 201 387
1ybt-assembly1.cif.gz_B mycobacterium tuberculosis adenylyl cyclase, rv1900c chd 0.8666 201 388
1wc1-assembly2.cif.gz_B soluble adenylyl cyclase cyac from s. platensis in complex with rp- atpalphas 0.8636 199 384
1ybu-assembly2.cif.gz_C mycobacterium tuberculosis adenylyl cyclase rv1900c chd, in complex with a substrate analog. 0.8603 201 387
ID Description Score Start End Superfamily
af_Q55F68_1579_1775_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.9009 204 384 3.30.70.1230
1ybuC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8703 201 387 3.30.70.1230
1ybuC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8603 201 387 3.30.70.1230
af_A0A144A236_312_553_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8547 201 391 3.30.70.1230
af_P9WQ33_348_539_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8533 196 388 3.30.70.1230
ID Description Score Start End GO Terms
AF-A0A6I7P4R9-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9366 1 384 GO:0004016
GO:0006171
GO:0035556
AF-A0A849E7T4-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9339 166 382 GO:0004016
GO:0006171
GO:0035556
AF-A0A3M0XRQ6-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9313 5 394 GO:0000166
GO:0004016
GO:0006171
GO:0035556
AF-A0A211YWQ5-F1-model_v4 Guanylate cyclase domain-containing protein 0.9301 3 384 GO:0004016
GO:0006171
GO:0035556
AF-A0A6I7P4R9-F1-model_v4 Adenylate/guanylate cyclase domain-containing protein 0.9296 1 384 GO:0004016
GO:0006171
GO:0035556

Feature Viewer

pLDDT pTM Quality
90.72 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map