F476171

General Info

Members Datasets Scaffolds Average Seq Length
701 374 574 224

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_000010|Ga0495627_000010_343741_344559
Length 272
Sequence LKNKALTLKLLQAPEFPTIQGPVRLSPDLITNTASNNVIIPLIEQDIHMRILVVEDEPKTAEYMHQGLTESGYIVDVAVTGLDGLYLAQHQTYDIVILDVNLPEMDGWEVLARLRKTDNTRVMMVTARGRLDEKVKGLEMGADDYLVKPFEFPELLARVRTLMRRSEQSGLPDVLRVGDLELDQGRHRAFRGSQRIDLTTKEFALLHLLMRHSGEVMSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFNSKLIHTLRGVGYVLEVRE

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231010 Pseudomonas sp. GM25 Isolate Nodule
7 2511231011 Pseudomonas sp. GM30 Isolate Nodule
8 2511231016 Pseudomonas sp. GM50 Isolate Nodule
9 2511231023 Pseudomonas sp. GM80 Isolate Nodule
10 2511231031 Pseudomonas sp. GM16 Isolate Nodule
11 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
12 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
13 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
14 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
15 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
16 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
17 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
18 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
19 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
20 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
21 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
22 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
23 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
24 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
25 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
26 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
27 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
28 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
29 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
30 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
31 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
32 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
33 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
34 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
35 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
36 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
37 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
38 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
39 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
40 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
41 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
42 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
43 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
44 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
45 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
46 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
47 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
48 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
49 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
50 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
51 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
52 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
53 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
54 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
55 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
56 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
57 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
58 2738541277 Variovorax sp. GV051 Isolate Unclassified
59 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
60 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
61 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
62 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
63 2738543019 Variovorax sp. GV040 Isolate Unclassified
64 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
65 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
66 2773857673 Pseudomonas sp. 443 Isolate Unclassified
67 2784132063 Pseudomonas sp. 424 Isolate Unclassified
68 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
69 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
70 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
71 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
72 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
73 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
74 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
75 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
76 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
77 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
78 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
79 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
80 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
81 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
82 2885198086 Variovorax sp. 679 Isolate Unclassified
83 2885211737 Variovorax sp. 553 Isolate Unclassified
84 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
85 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
86 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
87 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
88 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
89 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
90 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
91 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
92 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
93 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
94 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
95 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
96 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
97 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
98 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
99 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
100 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
101 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
102 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
103 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
104 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
105 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
106 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
107 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
108 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
109 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
110 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
111 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
112 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
113 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
114 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
115 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
116 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
117 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
118 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
121 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
122 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
123 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
124 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
125 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
126 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
127 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
128 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
129 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
130 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
131 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
134 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
135 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
148 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
149 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
150 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
161 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
162 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
165 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
166 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
169 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
170 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
196 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
197 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
202 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
203 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
210 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
211 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
218 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
224 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
225 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
233 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
234 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
235 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
236 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
237 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
238 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
239 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
240 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
241 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
242 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
246 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
247 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
256 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
271 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
272 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
286 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
287 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
288 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
294 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
310 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
316 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
320 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
321 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
322 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
323 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
328 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
329 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
333 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
334 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
335 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
336 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
339 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
340 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
341 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
342 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
346 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
347 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
348 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
352 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
353 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
354 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
355 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
356 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
357 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
358 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
359 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
360 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
362 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
363 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
364 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
365 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
366 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
367 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
368 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
369 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
370 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
371 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
372 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
373 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
374 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.03
Metatranscriptomes 0.14
Isolates 17.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 2.14
Rhizoplane 5.28
Rhizosphere 73.04
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC39451_b1 2010549000 Bacteria 843
2 MRS2a_Contig_5562 2124908027 Bacteria 3108
3 SwRhRL2b_contig_554480 2162886007 Bacteria 1171
4 JGI25162J39368_1000197 3300002737 Bacteria 63232
5 JGI25163J39215_1000326 3300002771 Bacteria 15894
6 JGI25164J39214_1000309 3300002772 Bacteria 32356
7 JGI25165J46597_1000293 3300003214 Bacteria 63232
8 Ga0007416J51690_1043430 3300003577 Bacteria 1798
9 Ga0055536_1000014 3300003781 Bacteria 240624
10 Ga0055536_1000125 3300003781 Bacteria 65908
11 Ga0055536_1000185 3300003781 Bacteria 51529
12 Ga0055530_10000009 3300003791 Bacteria 174044
13 Ga0055530_10000130 3300003791 Bacteria 65904
14 Ga0055540_1000222 3300003792 Bacteria 53630
15 Ga0055540_1000560 3300003792 Bacteria 27426
16 Ga0055540_1000865 3300003792 Bacteria 20095
17 Ga0055531_10000215 3300003794 Bacteria 63490
18 Ga0065714_10003912 3300005288 Bacteria 6803
19 Ga0065704_10031668 3300005289 Bacteria 1442
20 Ga0065704_10121549 3300005289 Bacteria 1764
21 Ga0065712_10075586 3300005290 Bacteria 3830
22 Ga0070670_100000310 3300005331 Bacteria 41815
23 Ga0068868_100466895 3300005338 Bacteria 1100
24 Ga0070661_100000109 3300005344 Bacteria 68441
25 Ga0070669_100000452 3300005353 Bacteria 31263
26 Ga0070671_100340563 3300005355 Bacteria 1279
27 Ga0070705_100231301 3300005440 Bacteria 1286
28 Ga0070662_100002689 3300005457 Bacteria 10972
29 Ga0070662_100063661 3300005457 Bacteria 2698
30 Ga0070706_100551512 3300005467 Bacteria 1072
31 Ga0070679_100001343 3300005530 Bacteria 21712
32 Ga0068853_100000003 3300005539 Bacteria 434636
33 Ga0068853_100069863 3300005539 Bacteria 3056
34 Ga0068853_100101893 3300005539 Bacteria 2540
35 Ga0070665_100038852 3300005548 Bacteria 4785
36 Ga0070665_100063377 3300005548 Bacteria 3706
37 Ga0068855_100572153 3300005563 Bacteria 1221
38 Ga0070664_100000086 3300005564 Bacteria 58796
39 Ga0070664_100014287 3300005564 Bacteria 6474
40 Ga0068854_100028651 3300005578 Bacteria 3850
41 Ga0068856_100038076 3300005614 Bacteria 4720
42 Ga0068851_10000021 3300005834 Bacteria 132824
43 Ga0081455_10034885 3300005937 Bacteria 4503
44 Ga0081539_10018963 3300005985 Bacteria 4738
45 Ga0081539_10031372 3300005985 Bacteria 3276
46 Ga0070717_10034168 3300006028 Bacteria 4109
47 Ga0075364_10032691 3300006051 Bacteria 3345
48 Ga0075432_10003812 3300006058 Bacteria 5137
49 Ga0075432_10011338 3300006058 Bacteria 3028
50 Ga0075362_10086375 3300006177 Bacteria 1452
51 Ga0068871_100174312 3300006358 Bacteria 1845
52 Ga0099823_1000791 3300006944 Bacteria 23427
53 Ga0079104_1000239 3300006946 Bacteria 73048
54 Ga0079104_1002227 3300006946 Bacteria 10843
55 Ga0099794_10278996 3300007265 Bacteria 864
56 Ga0105251_10001070 3300009011 Bacteria 23980
57 Ga0105251_10001398 3300009011 Bacteria 20815
58 Ga0105251_10007350 3300009011 Bacteria 6805
59 Ga0105251_10008119 3300009011 Bacteria 6354
60 Ga0105251_10055141 3300009011 Bacteria 1885
61 Ga0105244_10006535 3300009036 Bacteria 7520
62 Ga0105244_10013404 3300009036 Bacteria 4795
63 Ga0105244_10038671 3300009036 Bacteria 2487
64 Ga0105244_10088915 3300009036 Bacteria 1521
65 Ga0105244_10124415 3300009036 Bacteria 1247
66 Ga0105244_10315355 3300009036 Bacteria 722
67 Ga0105250_10000120 3300009092 Bacteria 69464
68 Ga0105250_10001119 3300009092 Bacteria 15115
69 Ga0105250_10010602 3300009092 Bacteria 3839
70 Ga0105250_10022042 3300009092 Bacteria 2570
71 Ga0105240_10003869 3300009093 Bacteria 23131
72 Ga0111539_10063881 3300009094 Bacteria 4356
73 Ga0114129_10174704 3300009147 Bacteria 2926
74 Ga0105243_10000135 3300009148 Bacteria 84432
75 Ga0105243_10000587 3300009148 Bacteria 36543
76 Ga0105243_10016186 3300009148 Bacteria 5641
77 Ga0105243_10092697 3300009148 Bacteria 2491
78 Ga0105243_10122002 3300009148 Bacteria 2199
79 Ga0105242_10000314 3300009176 Bacteria 38796
80 Ga0105242_10328341 3300009176 Bacteria 1406
81 Ga0105248_10086220 3300009177 Bacteria 3533
82 Ga0105237_10000391 3300009545 Bacteria 62410
83 Ga0105238_10086397 3300009551 Bacteria 3124
84 Ga0105249_10032513 3300009553 Bacteria 4720
85 Ga0105239_10196713 3300010375 Bacteria 2258
86 Ga0105246_10000239 3300011119 Bacteria 28228
87 Ga0105246_10029271 3300011119 Bacteria 3626
88 Ga0105246_10043926 3300011119 Bacteria 3034
89 Ga0157345_1000249 3300012498 Bacteria 7686
90 Ga0157373_10001617 3300013100 Bacteria 17202
91 Ga0157373_10005283 3300013100 Bacteria 9696
92 Ga0157373_10008815 3300013100 Bacteria 7472
93 Ga0157371_10003122 3300013102 Bacteria 15314
94 Ga0157371_10212306 3300013102 Bacteria 1389
95 Ga0157370_10030390 3300013104 Bacteria 5294
96 Ga0157370_10078478 3300013104 Bacteria 3109
97 Ga0157370_10104320 3300013104 Bacteria 2654
98 Ga0157369_10009720 3300013105 Bacteria 11000
99 Ga0157369_10010109 3300013105 Bacteria 10768
100 Ga0157369_10037314 3300013105 Bacteria 5320
101 Ga0157369_10049351 3300013105 Bacteria 4563
102 Ga0163162_10003597 3300013306 Bacteria 14840
103 Ga0163162_10067695 3300013306 Bacteria 3621
104 Ga0163162_10098762 3300013306 Bacteria 3009
105 Ga0163162_10393868 3300013306 Bacteria 1518
106 Ga0157372_10004984 3300013307 Bacteria 14110
107 Ga0157375_10002219 3300013308 Bacteria 16809
108 Ga0157375_10426513 3300013308 Bacteria 1492
109 Ga0157380_10084066 3300014326 Bacteria 2609
110 Ga0182008_10000092 3300014497 Bacteria 68381
111 Ga0182008_10004811 3300014497 Bacteria 7809
112 Ga0182008_10005677 3300014497 Bacteria 7066
113 Ga0182008_10005922 3300014497 Bacteria 6899
114 Ga0182008_10029786 3300014497 Bacteria 2755
115 Ga0182006_1000920 3300015261 Bacteria 19652
116 Ga0182006_1002031 3300015261 Bacteria 11356
117 Ga0182006_1006929 3300015261 Bacteria 5219
118 Ga0182007_10000477 3300015262 Bacteria 24113
119 Ga0182007_10000786 3300015262 Bacteria 17736
120 Ga0182007_10027204 3300015262 Bacteria 1974
121 Ga0182005_1000604 3300015265 Bacteria 17458
122 Ga0182005_1001126 3300015265 Bacteria 11166
123 Ga0182005_1027100 3300015265 Bacteria 1563
124 Ga0182005_1027101 3300015265 Bacteria 1563
125 Ga0163161_10006936 3300017792 Bacteria 7832
126 Ga0163161_10064610 3300017792 Bacteria 2670
127 Ga0213876_10009936 3300021384 Bacteria 5114
128 Ga0209760_100108 3300025207 Bacteria 59315
129 Ga0209563_100826 3300025230 Bacteria 9245
130 Ga0207427_100007 3300025231 Bacteria 746220
131 Ga0209437_100006 3300025233 Bacteria 1042724
132 Ga0209233_1000059 3300025261 Bacteria 414562
133 Ga0209675_1003084 3300025291 Bacteria 8148
134 Ga0209676_1000002 3300025292 Bacteria 1732948
135 Ga0209676_1000003 3300025292 Bacteria 1454178
136 Ga0209676_1000006 3300025292 Bacteria 1039588
137 Ga0209050_1000004 3300025298 Bacteria 1600040
138 Ga0209050_1000242 3300025298 Bacteria 118006
139 Ga0209050_1000317 3300025298 Bacteria 98196
140 Ga0209051_1000001 3300025303 Bacteria 1732974
141 Ga0209051_1000006 3300025303 Bacteria 1015785
142 Ga0209051_1000218 3300025303 Bacteria 97013
143 Ga0209257_1000167 3300025304 Bacteria 171342
144 Ga0207656_10000020 3300025321 Bacteria 114666
145 Ga0207696_1000052 3300025711 Bacteria 272880
146 Ga0207696_1000147 3300025711 Bacteria 120603
147 Ga0207696_1002556 3300025711 Bacteria 8856
148 Ga0207696_1003391 3300025711 Bacteria 7287
149 Ga0207655_1000333 3300025728 Bacteria 68997
150 Ga0207655_1000409 3300025728 Bacteria 59139
151 Ga0207655_1003745 3300025728 Bacteria 11159
152 Ga0207655_1004101 3300025728 Bacteria 10480
153 Ga0207655_1004345 3300025728 Bacteria 10093
154 Ga0207655_1009742 3300025728 Bacteria 5925
155 Ga0207655_1032993 3300025728 Bacteria 2356
156 Ga0207713_1000453 3300025735 Bacteria 42968
157 Ga0207713_1001189 3300025735 Bacteria 21888
158 Ga0207713_1001663 3300025735 Bacteria 17230
159 Ga0207713_1002292 3300025735 Bacteria 14087
160 Ga0207713_1002467 3300025735 Bacteria 13449
161 Ga0207713_1007482 3300025735 Bacteria 6436
162 Ga0207713_1024048 3300025735 Bacteria 2850
163 Ga0207707_10235724 3300025912 Bacteria 1592
164 Ga0207671_10000356 3300025914 Bacteria 65770
165 Ga0207649_10000020 3300025920 Bacteria 211018
166 Ga0207652_10059071 3300025921 Bacteria 3305
167 Ga0207681_10000119 3300025923 Bacteria 66476
168 Ga0207694_10050584 3300025924 Bacteria 3219
169 Ga0207650_10000225 3300025925 Bacteria 63430
170 Ga0207664_10104985 3300025929 Bacteria 2340
171 Ga0207706_10000855 3300025933 Bacteria 31362
172 Ga0207706_10003236 3300025933 Bacteria 15610
173 Ga0207686_10000917 3300025934 Bacteria 17660
174 Ga0207686_10233565 3300025934 Bacteria 1335
175 Ga0207686_10533718 3300025934 Bacteria 915
176 Ga0207709_10000014 3300025935 Bacteria 526302
177 Ga0207709_10000251 3300025935 Bacteria 64622
178 Ga0207709_10009313 3300025935 Bacteria 5407
179 Ga0207709_10016757 3300025935 Bacteria 4079
180 Ga0207709_10036347 3300025935 Bacteria 2919
181 Ga0207679_10000023 3300025945 Bacteria 208356
182 Ga0207712_10017913 3300025961 Bacteria 4608
183 Ga0207640_10008460 3300025981 Bacteria 5717
184 Ga0207639_10000002 3300026041 Bacteria 903066
185 Ga0207639_10052357 3300026041 Bacteria 3111
186 Ga0207639_10254228 3300026041 Bacteria 1534
187 Ga0207674_10047145 3300026116 Bacteria 4420
188 Ga0209281_1000368 3300027111 Bacteria 73062
189 Ga0209281_1031951 3300027111 Bacteria 935
190 Ga0209389_1000114 3300027296 Bacteria 72204
191 Ga0209371_1000023 3300027312 Bacteria 519553
192 Ga0207428_10019494 3300027907 Bacteria 5781
193 Ga0268266_10012761 3300028379 Bacteria 7260
194 Ga0268266_10129392 3300028379 Bacteria 2256
195 Ga0307515_10059818 3300028794 Bacteria 5451
196 Ga0265338_10008353 3300028800 Bacteria 12589
197 Ga0268256_1000023 3300030500 Bacteria 519631
198 Ga0307511_10164558 3300030521 Bacteria 1235
199 Ga0265325_10036823 3300031241 Bacteria 2590
200 Ga0265327_10014199 3300031251 Bacteria 5224
201 Ga0265316_10023106 3300031344 Bacteria 5228
202 Ga0307513_10000667 3300031456 Bacteria 49266
203 Ga0307513_10012235 3300031456 Bacteria 10608
204 Ga0307408_100000265 3300031548 Bacteria 53136
205 Ga0316579_10001052 3300031691 Bacteria 9747
206 Ga0316576_10024632 3300031727 Bacteria 4203
207 Ga0316576_10186480 3300031727 Unclassified 1564
208 Ga0316578_10012455 3300031728 Bacteria 4485
209 Ga0307516_10261193 3300031730 Bacteria 1422
210 Ga0307405_10000084 3300031731 Bacteria 39538
211 Ga0307405_10000126 3300031731 Bacteria 30203
212 Ga0307405_10000151 3300031731 Bacteria 26435
213 Ga0307405_10001787 3300031731 Bacteria 9193
214 Ga0316577_10180111 3300031733 Bacteria 1193
215 Ga0307412_10000132 3300031911 Bacteria 54263
216 Ga0307412_10011956 3300031911 Bacteria 5043
217 Ga0307412_10154643 3300031911 Bacteria 1696
218 Ga0307412_10400298 3300031911 Bacteria 1117
219 Ga0307510_10017621 3300033180 Bacteria 8418
220 Ga0373951_0003422 3300035091 Bacteria 3852
221 Ga0373945_0110523 3300035116 Bacteria 1084
222 Ga0373943_0041918 3300035170 Bacteria 2216
223 Ga0373955_0010297 3300035172 Bacteria 4411
224 Ga0316574_0032201 3300035398 Bacteria 3185
225 Ga0373937_0381928 3300036401 Bacteria 1336
226 Ga0316582_0064155 3300036647 Unclassified 2362
227 Ga0316584_0016160 3300036712 Bacteria 5347
228 Ga0316584_0026596 3300036712 Bacteria 4253
229 Ga0316584_0371008 3300036712 Bacteria 1024
230 Ga0373925_0764102 3300037068 Bacteria 797
231 Ga0395900_0279749 3300037418 Bacteria 1661
232 Ga0395898_0696345 3300037466 Bacteria 958
233 Ga0395905_0000075 3300037471 Bacteria 165791
234 Ga0395905_0094769 3300037471 Bacteria 2800
235 Ga0237819_02360 3300038705 Bacteria 3852
236 Ga0436365_0605876 3300039437 Bacteria 6932
237 Ga0436361_0601543 3300039447 Bacteria 3484
238 Ga0439436_0000257 3300041404 Bacteria 12717
239 Ga0439438_002827 3300041405 Bacteria 7247
240 Ga0439447_009963 3300041407 Bacteria 2847
241 Ga0439447_015270 3300041407 Bacteria 2134
242 Ga0439447_031136 3300041407 Bacteria 1340
243 Ga0439466_0000026 3300041411 Bacteria 78192
244 Ga0439466_0000405 3300041411 Bacteria 16402
245 Ga0439432_000024 3300042006 Bacteria 50681
246 Ga0439432_000067 3300042006 Bacteria 32538
247 Ga0439432_000831 3300042006 Bacteria 11528
248 Ga0439451_000030 3300042009 Bacteria 28884
249 Ga0439452_000482 3300042010 Bacteria 22231
250 Ga0439456_020561 3300042013 Bacteria 1393
251 Ga0439463_000073 3300042016 Bacteria 22854
252 Ga0439463_000457 3300042016 Bacteria 11378
253 Ga0450923_021625 3300042125 Bacteria 1255
254 Ga0439446_0004554 3300042156 Bacteria 3514
255 Ga0439434_0000133 3300042435 Bacteria 19714
256 Ga0451577_0162781 3300042876 Bacteria 2010
257 Ga0451577_0297749 3300042876 Bacteria 1462
258 Ga0451577_0298616 3300042876 Bacteria 1459
259 Ga0451577_0346900 3300042876 Bacteria 1347
260 Ga0451577_0407886 3300042876 Bacteria 1233
261 Ga0451577_0414124 3300042876 Bacteria 1223
262 Ga0451577_0759835 3300042876 Bacteria 877
263 Ga0439440_0004516 3300042993 Bacteria 2733
264 Ga0466988_0156021 3300044536 Bacteria 1327
265 Ga0466969_0000348 3300044656 Bacteria 25379
266 Ga0453683_0000114 3300044673 Bacteria 119864
267 Ga0466966_0014941 3300044684 Bacteria 5138
268 Ga0466961_0003582 3300044693 Bacteria 9685
269 Ga0466963_0141753 3300044694 Bacteria 1665
270 Ga0453684_0007772 3300044712 Bacteria 19566
271 Ga0453684_0293268 3300044712 Bacteria 1851
272 Ga0453684_1184021 3300044712 Bacteria 803
273 Ga0453684_1481894 3300044712 Bacteria 701
274 Ga0466971_0013084 3300044719 Bacteria 3639
275 Ga0451576_0000151 3300045051 Bacteria 176466
276 Ga0451576_0004207 3300045051 Bacteria 18930
277 Ga0495617_006624 3300046452 Bacteria 4052
278 Ga0495617_022351 3300046452 Bacteria 2137
279 Ga0495617_054409 3300046452 Bacteria 1328
280 Ga0495627_000010 3300046453 Bacteria 381168
281 Ga0495627_000137 3300046453 Bacteria 87495
282 Ga0495627_001498 3300046453 Bacteria 13495
283 Ga0495627_004025 3300046453 Bacteria 6270
284 Ga0495627_004564 3300046453 Bacteria 5759
285 Ga0495627_006204 3300046453 Bacteria 4708
286 Ga0495592_0187357 3300046454 Bacteria 1405
287 Ga0495603_0016844 3300046455 Bacteria 4422
288 Ga0495603_0039511 3300046455 Bacteria 2826
289 Ga0495591_000163 3300046458 Bacteria 71039
290 Ga0495591_000975 3300046458 Bacteria 19539
291 Ga0495591_001553 3300046458 Bacteria 14008
292 Ga0495591_001986 3300046458 Bacteria 11929
293 Ga0495591_002129 3300046458 Bacteria 11376
294 Ga0495591_007858 3300046458 Bacteria 4456
295 Ga0495591_017563 3300046458 Bacteria 2453
296 Ga0495638_0001429 3300046460 Bacteria 21654
297 Ga0495638_0003116 3300046460 Bacteria 13136
298 Ga0495638_0014481 3300046460 Bacteria 5327
299 Ga0495638_0029181 3300046460 Bacteria 3557
300 Ga0495638_0041357 3300046460 Bacteria 2916
301 Ga0495653_0000110 3300046463 Bacteria 68799
302 Ga0495653_0268167 3300046463 Bacteria 1125
303 Ga0495650_0005492 3300046471 Bacteria 8200
304 Ga0495650_0017624 3300046471 Bacteria 3575
305 Ga0495650_0070269 3300046471 Bacteria 1375
306 Ga0495580_0002981 3300046472 Bacteria 14525
307 Ga0495582_0016926 3300046473 Bacteria 3992
308 Ga0495605_0000001 3300046474 Bacteria 614538
309 Ga0495605_0000324 3300046474 Bacteria 49042
310 Ga0495605_0007188 3300046474 Bacteria 6332
311 Ga0495605_0022426 3300046474 Bacteria 3334
312 Ga0495639_0001252 3300046475 Bacteria 11445
313 Ga0495639_0111950 3300046475 Bacteria 1296
314 Ga0495664_0002038 3300046477 Bacteria 10801
315 Ga0495664_0305090 3300046477 Bacteria 961
316 Ga0495584_0001304 3300046491 Bacteria 15175
317 Ga0495584_0072103 3300046491 Bacteria 1735
318 Ga0495585_0000283 3300046492 Bacteria 50893
319 Ga0495585_0006867 3300046492 Bacteria 7016
320 Ga0495585_0011854 3300046492 Bacteria 5150
321 Ga0495585_0057474 3300046492 Bacteria 2146
322 Ga0495596_0022516 3300046500 Bacteria 2564
323 Ga0495607_0000066 3300046501 Bacteria 103573
324 Ga0495607_0000094 3300046501 Bacteria 92515
325 Ga0495607_0000391 3300046501 Bacteria 44683
326 Ga0495607_0001397 3300046501 Bacteria 21475
327 Ga0495607_0001852 3300046501 Bacteria 17971
328 Ga0495607_0009143 3300046501 Bacteria 6735
329 Ga0495607_0013393 3300046501 Bacteria 5375
330 Ga0495607_0014374 3300046501 Bacteria 5156
331 Ga0495607_0016645 3300046501 Bacteria 4741
332 Ga0495607_0018619 3300046501 Bacteria 4423
333 Ga0495607_0039552 3300046501 Bacteria 2816
334 Ga0495607_0072518 3300046501 Bacteria 1917
335 Ga0495607_0296405 3300046501 Bacteria 762
336 Ga0495583_0000611 3300046506 Bacteria 48395
337 Ga0495583_0000778 3300046506 Bacteria 39897
338 Ga0495606_0000421 3300046507 Bacteria 70842
339 Ga0495606_0005295 3300046507 Bacteria 12427
340 Ga0495606_0006865 3300046507 Bacteria 10384
341 Ga0495606_0015567 3300046507 Bacteria 5851
342 Ga0495606_0019528 3300046507 Bacteria 5036
343 Ga0495606_0026643 3300046507 Bacteria 4117
344 Ga0495606_0028625 3300046507 Bacteria 3926
345 Ga0495606_0081415 3300046507 Bacteria 2012
346 Ga0495608_0146181 3300046511 Bacteria 1508
347 Ga0495610_0000644 3300046512 Bacteria 34165
348 Ga0495610_0002650 3300046512 Bacteria 14785
349 Ga0495610_0038069 3300046512 Bacteria 2443
350 Ga0495610_0047155 3300046512 Bacteria 2121
351 Ga0495610_0059027 3300046512 Bacteria 1832
352 Ga0495616_0004820 3300046513 Bacteria 8452
353 Ga0495616_0004858 3300046513 Bacteria 8411
354 Ga0495616_0008984 3300046513 Bacteria 5868
355 Ga0495616_0010017 3300046513 Bacteria 5505
356 Ga0495616_0017609 3300046513 Bacteria 3938
357 Ga0495618_0018455 3300046514 Bacteria 4282
358 Ga0495618_0062853 3300046514 Bacteria 2356
359 Ga0495620_0000242 3300046515 Bacteria 40695
360 Ga0495620_0016449 3300046515 Bacteria 3710
361 Ga0495620_0019057 3300046515 Bacteria 3385
362 Ga0495620_0030056 3300046515 Bacteria 2506
363 Ga0495628_0016953 3300046516 Bacteria 6069
364 Ga0495628_0022294 3300046516 Bacteria 5203
365 Ga0495630_0041985 3300046517 Bacteria 3416
366 Ga0495631_0003453 3300046518 Bacteria 8646
367 Ga0495631_0003954 3300046518 Bacteria 8002
368 Ga0495631_0005013 3300046518 Bacteria 6975
369 Ga0495632_0002747 3300046519 Bacteria 13065
370 Ga0495632_0008701 3300046519 Bacteria 6192
371 Ga0495632_0018143 3300046519 Bacteria 3867
372 Ga0495632_0058262 3300046519 Bacteria 1883
373 Ga0495637_0001790 3300046520 Bacteria 12300
374 Ga0495637_0002035 3300046520 Bacteria 11394
375 Ga0495637_0003556 3300046520 Bacteria 8260
376 Ga0495637_0010237 3300046520 Bacteria 4541
377 Ga0495637_0013928 3300046520 Bacteria 3806
378 Ga0495637_0050087 3300046520 Bacteria 1752
379 Ga0495637_0056271 3300046520 Bacteria 1628
380 Ga0495637_0063902 3300046520 Bacteria 1503
381 Ga0495643_0011083 3300046522 Bacteria 5509
382 Ga0495643_0067390 3300046522 Bacteria 1886
383 Ga0495644_0004529 3300046523 Bacteria 5459
384 Ga0495648_0006976 3300046524 Bacteria 9111
385 Ga0495648_0013697 3300046524 Bacteria 5979
386 Ga0495648_0036764 3300046524 Bacteria 3153
387 Ga0495648_0109968 3300046524 Bacteria 1501
388 Ga0495652_0105911 3300046529 Bacteria 2271
389 Ga0495654_0000137 3300046530 Bacteria 76186
390 Ga0495654_0001197 3300046530 Bacteria 18448
391 Ga0495654_0003840 3300046530 Bacteria 9082
392 Ga0495654_0007592 3300046530 Bacteria 6042
393 Ga0495654_0014855 3300046530 Bacteria 4138
394 Ga0495654_0026131 3300046530 Bacteria 3004
395 Ga0495654_0035730 3300046530 Bacteria 2499
396 Ga0495654_0050606 3300046530 Bacteria 2029
397 Ga0495654_0128661 3300046530 Bacteria 1139
398 Ga0495665_0036639 3300046531 Bacteria 2618
399 Ga0495640_0067498 3300046533 Bacteria 2408
400 Ga0495586_0047412 3300046535 Bacteria 2319
401 Ga0495587_0036651 3300046536 Bacteria 2949
402 Ga0495609_0007641 3300046538 Bacteria 5371
403 Ga0495609_0007717 3300046538 Bacteria 5336
404 Ga0495609_0013695 3300046538 Bacteria 3826
405 Ga0495609_0030273 3300046538 Bacteria 2463
406 Ga0495609_0107756 3300046538 Bacteria 1204
407 Ga0495597_0000008 3300046542 Bacteria 232976
408 Ga0495622_0002337 3300046557 Bacteria 9230
409 Ga0495622_0126077 3300046557 Bacteria 1167
410 Ga0495633_0013961 3300046558 Bacteria 4212
411 Ga0495668_0007713 3300046616 Bacteria 6839
412 Ga0495668_0012004 3300046616 Bacteria 5156
413 Ga0495634_0045399 3300046642 Bacteria 2970
414 Ga0495611_0001236 3300046648 Bacteria 13151
415 Ga0495611_0201691 3300046648 Bacteria 927
416 Ga0495625_0009513 3300046660 Bacteria 8119
417 Ga0495625_0025532 3300046660 Bacteria 4479
418 Ga0495625_0026892 3300046660 Bacteria 4338
419 Ga0495625_0094194 3300046660 Bacteria 2067
420 Ga0495635_0048412 3300046663 Bacteria 2930
421 Ga0495635_0112572 3300046663 Bacteria 1859
422 Ga0495661_0000013 3300046665 Bacteria 259387
423 Ga0495661_0000503 3300046665 Bacteria 40790
424 Ga0495661_0000977 3300046665 Bacteria 25842
425 Ga0495661_0021526 3300046665 Bacteria 4203
426 Ga0495661_0026481 3300046665 Bacteria 3735
427 Ga0495588_0126974 3300046674 Bacteria 1345
428 Ga0495599_0020830 3300046678 Bacteria 4086
429 Ga0495613_0126184 3300046689 Bacteria 1835
430 Ga0495624_0001949 3300046690 Bacteria 15699
431 Ga0495624_0006092 3300046690 Bacteria 8593
432 Ga0495670_0002982 3300046691 Bacteria 8343
433 Ga0495671_0001003 3300046692 Bacteria 19655
434 Ga0495671_0011250 3300046692 Bacteria 4934
435 Ga0495671_0017339 3300046692 Bacteria 3834
436 Ga0495671_0024305 3300046692 Bacteria 3156
437 Ga0495671_0027335 3300046692 Bacteria 2947
438 Ga0495671_0064665 3300046692 Bacteria 1800
439 Ga0495649_0000205 3300046694 Bacteria 52102
440 Ga0495649_0001249 3300046694 Bacteria 19572
441 Ga0495649_0011541 3300046694 Bacteria 5176
442 Ga0495649_0027832 3300046694 Bacteria 3134
443 Ga0495649_0062763 3300046694 Bacteria 1997
444 Ga0495589_0000318 3300046794 Bacteria 38201
445 Ga0495589_0010769 3300046794 Bacteria 4753
446 Ga0495589_0025458 3300046794 Bacteria 3002
447 Ga0495589_0044039 3300046794 Bacteria 2220
448 Ga0495589_0127724 3300046794 Bacteria 1222
449 Ga0495600_0191635 3300046809 Bacteria 1314
450 Ga0495660_0000142 3300046810 Bacteria 77290
451 Ga0495660_0000528 3300046810 Bacteria 31279
452 Ga0495660_0001037 3300046810 Bacteria 20156
453 Ga0495660_0019958 3300046810 Bacteria 3843
454 Ga0495660_0024615 3300046810 Bacteria 3428
455 Ga0495660_0052402 3300046810 Bacteria 2216
456 Ga0495581_0048251 3300047315 Bacteria 2459
457 Ga0495604_0048411 3300047317 Bacteria 3306
458 Ga0495674_0115527 3300047319 Bacteria 2271
459 Ga0495672_0002987 3300047320 Bacteria 14881
460 Ga0495672_0004835 3300047320 Bacteria 10855
461 Ga0495672_0011316 3300047320 Bacteria 6305
462 Ga0495672_0014008 3300047320 Bacteria 5510
463 Ga0495672_0041233 3300047320 Bacteria 2793
464 Ga0495672_0047982 3300047320 Bacteria 2536
465 Ga0495672_0261835 3300047320 Bacteria 834
466 Ga0495676_0003671 3300047321 Bacteria 13926
467 Ga0495676_0014550 3300047321 Bacteria 7038
468 Ga0495680_0017125 3300047322 Bacteria 6201
469 Ga0495680_0041178 3300047322 Bacteria 3674
470 Ga0495680_0098278 3300047322 Bacteria 2185
471 Ga0495683_0005772 3300047323 Bacteria 6819
472 Ga0495683_0016186 3300047323 Bacteria 3873
473 Ga0495687_010472 3300047443 Bacteria 5084
474 Ga0495679_000372 3300047446 Bacteria 34335
475 Ga0495679_001766 3300047446 Bacteria 11852
476 Ga0495679_004120 3300047446 Bacteria 6791
477 Ga0495679_013938 3300047446 Bacteria 2997
478 Ga0495679_015872 3300047446 Bacteria 2738
479 Ga0495673_0005503 3300047469 Bacteria 7645
480 Ga0495673_0006518 3300047469 Bacteria 6849
481 Ga0495673_0011071 3300047469 Bacteria 4874
482 Ga0495673_0184386 3300047469 Bacteria 788
483 Ga0495681_0000329 3300047470 Bacteria 37635
484 Ga0495681_0003223 3300047470 Bacteria 11386
485 Ga0495681_0005528 3300047470 Bacteria 8443
486 Ga0495681_0008962 3300047470 Bacteria 6210
487 Ga0495681_0011670 3300047470 Bacteria 5214
488 Ga0495681_0013305 3300047470 Bacteria 4782
489 Ga0495681_0023485 3300047470 Bacteria 3274
490 Ga0495681_0092780 3300047470 Bacteria 1330
491 Ga0495686_0010032 3300047472 Bacteria 6765
492 Ga0495686_0056916 3300047472 Bacteria 2441
493 Ga0495686_0269347 3300047472 Bacteria 950
494 Ga0495593_0001599 3300047673 Bacteria 13382
495 Ga0495593_0020673 3300047673 Bacteria 3683
496 Ga0495602_0034419 3300048088 Bacteria 4739
497 Ga0495626_0004692 3300048091 Bacteria 8286
498 Ga0495626_0007255 3300048091 Bacteria 6187
499 Ga0495626_0022508 3300048091 Bacteria 3110
500 Ga0496116_0000318 3300048919 Bacteria 79091
501 Ga0496116_0003624 3300048919 Bacteria 15181
502 Ga0496116_0011989 3300048919 Bacteria 7117
503 Ga0496116_0014741 3300048919 Bacteria 6225
504 Ga0496117_0000838 3300048920 Bacteria 47560
505 Ga0496117_0000981 3300048920 Bacteria 43680
506 Ga0496117_0020784 3300048920 Bacteria 5341
507 Ga0496117_0118547 3300048920 Bacteria 1631
508 Ga0496118_0010399 3300048921 Bacteria 9222
509 Ga0496118_0036828 3300048921 Bacteria 3948
510 Ga0496118_0042581 3300048921 Bacteria 3580
511 Ga0496118_0042951 3300048921 Bacteria 3559
512 Ga0496118_0058872 3300048921 Bacteria 2866
513 Ga0496118_0278520 3300048921 Bacteria 932
514 Ga0496119_0018764 3300048922 Bacteria 5130
515 Ga0496119_0047252 3300048922 Bacteria 2679
516 Ga0496120_0015063 3300048923 Bacteria 5116
517 Ga0496120_0075948 3300048923 Bacteria 1832
518 Ga0496121_0000463 3300048924 Bacteria 79640
519 Ga0496121_0026911 3300048924 Bacteria 5398
520 Ga0496121_0096575 3300048924 Bacteria 2292
521 Ga0496121_0110830 3300048924 Bacteria 2094
522 Ga0496122_0012229 3300048925 Bacteria 8582
523 Ga0496122_0055546 3300048925 Bacteria 2961
524 Ga0496122_0218830 3300048925 Bacteria 1095
525 Ga0496123_0002822 3300048926 Bacteria 20585
526 Ga0496123_0021112 3300048926 Bacteria 5071
527 Ga0496123_0029837 3300048926 Bacteria 4004
528 Ga0496123_0045582 3300048926 Bacteria 2985
529 Ga0496123_0085236 3300048926 Bacteria 1901
530 Ga0496124_0001258 3300048927 Bacteria 38669
531 Ga0496124_0017104 3300048927 Bacteria 6855
532 Ga0496124_0029852 3300048927 Bacteria 4850
533 Ga0496124_0091167 3300048927 Bacteria 2484
534 Ga0496124_0170579 3300048927 Bacteria 1685
535 Ga0496125_0001178 3300048928 Bacteria 39572
536 Ga0496125_0004482 3300048928 Bacteria 16087
537 Ga0496125_0042987 3300048928 Bacteria 3841
538 Ga0496125_0056206 3300048928 Bacteria 3198
539 Ga0496125_0061733 3300048928 Bacteria 3003
540 Ga0496125_0065148 3300048928 Bacteria 2889
541 Ga0496125_0073480 3300048928 Bacteria 2658
542 Ga0496125_0120158 3300048928 Bacteria 1877
543 Ga0496126_0001092 3300048929 Bacteria 45620
544 Ga0496126_0041933 3300048929 Bacteria 4231
545 Ga0496126_0054646 3300048929 Bacteria 3615
546 Ga0495678_002022 3300049459 Bacteria 14541
547 Ga0495678_005389 3300049459 Bacteria 7075
548 Ga0495678_005852 3300049459 Bacteria 6661
549 Ga0495678_006693 3300049459 Bacteria 6082
550 Ga0495678_041662 3300049459 Bacteria 1835
551 Ga0495682_0001091 3300049460 Bacteria 15846
552 Ga0501300_012846 3300049523 Bacteria 1221
553 Ga0501031_0120135 3300049568 Bacteria 1717
554 Ga0501034_0000164 3300049571 Bacteria 125152
555 Ga0501034_0000430 3300049571 Bacteria 69762
556 Ga0501034_0043921 3300049571 Bacteria 4520
557 Ga0501038_0099730 3300049574 Bacteria 2421
558 Ga0501079_0456844 3300049741 Bacteria 1003
559 Ga0501081_0448005 3300049743 Bacteria 959
560 Ga0501280_000259 3300049776 Bacteria 13340
561 Ga0501282_000766 3300049778 Bacteria 3684
562 Ga0501035_0353621 3300049822 Bacteria 1229
563 nmdc:mga08y16_50221_c1 3300050511 Bacteria 4365
564 Ga0495612_0063528 3300053078 Bacteria 1531
565 Ga0500610_0017782 3300053079 Bacteria 3422
566 Ga0500608_002755 3300053122 Bacteria 6472
567 Ga0500655_023484 3300053133 Bacteria 1165
568 Ga0500573_0002848 3300053140 Bacteria 8783
569 Ga0500577_0138633 3300053142 Bacteria 1024
570 Ga0500619_000105 3300053154 Bacteria 22703
571 Ga0500634_0000099 3300053161 Bacteria 33876
572 Ga0500637_0194736 3300053178 Bacteria 1157
573 Ga0500661_021735 3300055283 Bacteria 1139
574 Ga0466962_0031844 3300061719 Bacteria 2525

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044536 Ga0466988_0156021 Ga0466988_0156021_12_608 176
2 3300005614 Ga0068856_100038076 Ga0068856_1000380762 197
3 3300009093 Ga0105240_10003869 Ga0105240_1000386917 197
4 3300013104 Ga0157370_10078478 Ga0157370_100784785 197
5 3300013105 Ga0157369_10037314 Ga0157369_100373145 197
6 3300044712 Ga0453684_1481894 Ga0453684_1481894_13_627 203
7 3300005467 Ga0070706_100551512 Ga0070706_1005515122 207
8 3300025912 Ga0207707_10235724 Ga0207707_102357242 207
9 3300044656 Ga0466969_0000348 Ga0466969_0000348_3742_4458 216
10 3300044684 Ga0466966_0014941 Ga0466966_0014941_3684_4400 216
11 3300044693 Ga0466961_0003582 Ga0466961_0003582_1467_2183 216
12 3300044694 Ga0466963_0141753 Ga0466963_0141753_488_1204 216
13 3300044719 Ga0466971_0013084 Ga0466971_0013084_352_1068 216
14 3300061719 Ga0466962_0031844 Ga0466962_0031844_722_1438 216
15 iso_pu_bacteria 2513020051 2513226751 218
16 iso_pu_bacteria 2599185214 2599621280 218
17 iso_pu_bacteria 2599185226 2599675299 218
18 iso_pu_bacteria 2599185227 2599678103 218
19 iso_pu_bacteria 2599185229 2599690791 218
20 iso_pu_bacteria 2738541277 2738718360 218
21 iso_pu_bacteria 2738543019 2739281547 218
22 iso_pu_bacteria 2885198086 2885201744 218
23 iso_pu_bacteria 2885198086 2885203175 218
24 iso_pu_bacteria 2885211737 2885215546 218
25 iso_pu_bacteria 2885211737 2885216428 218
26 iso_pu_bacteria 2511231006 2511264003 219
27 iso_pu_bacteria 2511231006 2511268155 219
28 iso_pu_bacteria 2511231007 2511273832 219
29 iso_pu_bacteria 2511231010 2511288207 219
30 iso_pu_bacteria 2511231011 2511298171 219
31 iso_pu_bacteria 2511231016 2511329016 219
32 iso_pu_bacteria 2511231023 2511370203 219
33 iso_pu_bacteria 2511231031 2511416389 219
34 iso_pu_bacteria 2512047018 2512323769 219
35 iso_pu_bacteria 2512047018 2512324533 219
36 iso_pu_bacteria 2554235341 2555672137 219
37 iso_pu_bacteria 2582580891 2583791973 219
38 iso_pu_bacteria 2582580891 2583794646 219
39 iso_pu_bacteria 2597489887 2597857996 219
40 iso_pu_bacteria 2597489887 2597860205 219
41 iso_pu_bacteria 2599185160 2599353696 219
42 iso_pu_bacteria 2599185161 2599360610 219
43 iso_pu_bacteria 2599185162 2599366932 219
44 iso_pu_bacteria 2599185163 2599373721 219
45 iso_pu_bacteria 2599185164 2599378804 219
46 iso_pu_bacteria 2599185165 2599386218 219
47 iso_pu_bacteria 2599185166 2599392580 219
48 iso_pu_bacteria 2599185167 2599397447 219
49 iso_pu_bacteria 2599185168 2599404346 219
50 iso_pu_bacteria 2599185179 2599449444 219
51 iso_pu_bacteria 2599185181 2599460530 219
52 iso_pu_bacteria 2599185182 2599470092 219
53 iso_pu_bacteria 2599185185 2599483048 219
54 iso_pu_bacteria 2599185185 2599485027 219
55 iso_pu_bacteria 2599185186 2599489551 219
56 iso_pu_bacteria 2599185190 2599510818 219
57 iso_pu_bacteria 2599185191 2599519692 219
58 iso_pu_bacteria 2599185257 2599802658 219
59 iso_pu_bacteria 2599185257 2599803232 219
60 iso_pu_bacteria 2599185288 2599883968 219
61 iso_pu_bacteria 2599185290 2599890192 219
62 iso_pu_bacteria 2599185303 2599950322 219
63 iso_pu_bacteria 2599185356 2600213142 219
64 iso_pu_bacteria 2600254931 2600366567 219
65 iso_pu_bacteria 2600254931 2600368389 219
66 iso_pu_bacteria 2600255313 2601773310 219
67 iso_pu_bacteria 2600255318 2601797239 219
68 iso_pu_bacteria 2603880185 2606076030 219
69 iso_pu_bacteria 2603880199 2606130681 219
70 iso_pu_bacteria 2619619299 2621301940 219
71 iso_pu_bacteria 2623620446 2624493070 219
72 iso_pu_bacteria 2643221589 2643954025 219
73 iso_pu_bacteria 2643221602 2644022051 219
74 iso_pu_bacteria 2667528171 2671096291 219
75 iso_pu_bacteria 2671180172 2671769722 219
76 iso_pu_bacteria 2671180172 2671771195 219
77 iso_pu_bacteria 2713897149 2715756033 219
78 iso_pu_bacteria 2728369097 2729147945 219
79 iso_pu_bacteria 2738541265 2738672374 219
80 iso_pu_bacteria 2738541282 2738750767 219
81 iso_pu_bacteria 2738541294 2738808720 219
82 iso_pu_bacteria 2738541303 2738859808 219
83 iso_pu_bacteria 2738541309 2738896080 219
84 iso_pu_bacteria 2738543025 2739313694 219
85 iso_pu_bacteria 2740892503 2743737462 219
86 iso_pu_bacteria 2740892503 2743739748 219
87 iso_pu_bacteria 2773857673 2774135101 219
88 iso_pu_bacteria 2784132063 2784265170 219
89 iso_pu_bacteria 2808606377 2808931725 219
90 iso_pu_bacteria 2808606381 2808953845 219
91 iso_pu_bacteria 2808606385 2808974794 219
92 iso_pu_bacteria 2808606388 2808991567 219
93 iso_pu_bacteria 2816332298 2817488664 219
94 iso_pu_bacteria 2818991456 2819657710 219
95 iso_pu_bacteria 2818991464 2819701383 219
96 iso_pu_bacteria 2834028612 2834028634 219
97 iso_pu_bacteria 2852612431 2852615997 219
98 iso_pu_bacteria 2852657418 2852659390 219
99 iso_pu_bacteria 2852667396 2852670965 219
100 iso_pu_bacteria 2878029506 2878033489 219
101 iso_pu_bacteria 2880230671 2880232790 219
102 iso_pu_bacteria 2904518522 2904520472 219
103 iso_pu_bacteria 2917070673 2917076013 219
104 iso_pu_bacteria 2919456309 2919461335 219
105 iso_pu_bacteria 2919697872 2919699656 219
106 iso_pu_bacteria 2923153595 2923156503 219
107 iso_pu_bacteria 2923153595 2923158836 219
108 iso_pu_bacteria 2931390751 2931391653 219
109 iso_pu_bacteria 2935353572 2935356984 219
110 iso_pu_bacteria 2945961074 2945961101 219
111 iso_pu_bacteria 2969304461 2969308252 219
112 iso_pu_bacteria 2984286254 2984287338 219
113 iso_pu_bacteria 2984286254 2984289559 219
114 iso_pu_bacteria 3007395558 3007395885 219
115 iso_pu_bacteria 3007395558 3007398465 219
116 iso_pu_bacteria 3007419365 3007423844 219
117 iso_pu_bacteria 3007718800 3007719690 219
118 iso_pu_bacteria 637000220 637322556 219
119 iso_pu_bacteria 651053060 651177410 219
120 iso_pu_bacteria 8015687852 8015690697 219
121 iso_pu_bacteria 8015687852 8015692921 219
122 iso_pu_bacteria 8019769354 8019773768 219
123 iso_pu_bacteria 8019775933 8019776073 219
124 iso_pu_bacteria 8054285046 8054289245 219
125 iso_pu_bacteria 8054503363 8054504242 219
126 iso_pu_bacteria 8055770955 8055773832 219
127 iso_pu_bacteria 8055770955 8055776168 219
128 iso_pu_bacteria 8055817908 8055818673 219
129 iso_pu_bacteria 8056172158 8056173648 219
130 iso_pu_bacteria 8056569372 8056573585 219
131 iso_pu_bacteria 8057798959 8057805019 219
132 iso_pu_bacteria 2554235132 2554814574 220
133 iso_pu_bacteria 2606217733 2608381958 220
134 iso_pu_bacteria 2643221713 2644623668 220
135 iso_pu_bacteria 2643221713 2644624622 220
136 iso_pu_bacteria 3007803356 3007806255 220
137 3300005457 Ga0070662_100063661 Ga0070662_1000636612 222
138 3300005539 Ga0068853_100101893 Ga0068853_1001018932 222
139 3300005563 Ga0068855_100572153 Ga0068855_1005721532 222
140 3300005564 Ga0070664_100014287 Ga0070664_1000142872 222
141 3300006358 Ga0068871_100174312 Ga0068871_1001743122 222
142 3300009148 Ga0105243_10016186 Ga0105243_100161865 222
143 3300009551 Ga0105238_10086397 Ga0105238_100863972 222
144 3300010375 Ga0105239_10196713 Ga0105239_101967133 222
145 3300011119 Ga0105246_10029271 Ga0105246_100292716 222
146 3300014497 Ga0182008_10005677 Ga0182008_100056776 222
147 3300015262 Ga0182007_10027204 Ga0182007_100272042 222
148 3300025728 Ga0207655_1004345 Ga0207655_10043457 222
149 3300025924 Ga0207694_10050584 Ga0207694_100505842 222
150 3300025933 Ga0207706_10003236 Ga0207706_1000323611 222
151 3300025934 Ga0207686_10533718 Ga0207686_105337182 222
152 3300025935 Ga0207709_10009313 Ga0207709_100093137 222
153 3300026041 Ga0207639_10254228 Ga0207639_102542282 222
154 3300026116 Ga0207674_10047145 Ga0207674_100471456 222
155 3300031241 Ga0265325_10036823 Ga0265325_100368232 222
156 3300031251 Ga0265327_10014199 Ga0265327_100141992 222
157 3300031344 Ga0265316_10023106 Ga0265316_100231062 222
158 3300035091 Ga0373951_0003422 Ga0373951_0003422_2576_3256 222
159 3300037418 Ga0395900_0279749 Ga0395900_0279749_621_1298 222
160 3300037466 Ga0395898_0696345 Ga0395898_0696345_231_908 222
161 3300037471 Ga0395905_0094769 Ga0395905_0094769_2015_2692 222
162 3300042876 Ga0451577_0759835 Ga0451577_0759835_111_782 222
163 3300044712 Ga0453684_1184021 Ga0453684_1184021_120_791 222
164 3300046455 Ga0495603_0039511 Ga0495603_0039511_471_1142 222
165 3300046460 Ga0495638_0041357 Ga0495638_0041357_987_1691 222
166 3300046472 Ga0495580_0002981 Ga0495580_0002981_416_1087 222
167 3300046473 Ga0495582_0016926 Ga0495582_0016926_1848_2519 222
168 3300046477 Ga0495664_0002038 Ga0495664_0002038_1205_1876 222
169 3300046511 Ga0495608_0146181 Ga0495608_0146181_363_1034 222
170 3300046514 Ga0495618_0062853 Ga0495618_0062853_530_1201 222
171 3300046516 Ga0495628_0016953 Ga0495628_0016953_4983_5654 222
172 3300046517 Ga0495630_0041985 Ga0495630_0041985_440_1111 222
173 3300046520 Ga0495637_0003556 Ga0495637_0003556_6773_7471 222
174 3300046520 Ga0495637_0063902 Ga0495637_0063902_606_1289 222
175 3300046529 Ga0495652_0105911 Ga0495652_0105911_1185_1856 222
176 3300046531 Ga0495665_0036639 Ga0495665_0036639_544_1215 222
177 3300046533 Ga0495640_0067498 Ga0495640_0067498_490_1161 222
178 3300046535 Ga0495586_0047412 Ga0495586_0047412_464_1135 222
179 3300046536 Ga0495587_0036651 Ga0495587_0036651_580_1251 222
180 3300046616 Ga0495668_0012004 Ga0495668_0012004_1156_1854 222
181 3300046642 Ga0495634_0045399 Ga0495634_0045399_1806_2477 222
182 3300046663 Ga0495635_0048412 Ga0495635_0048412_323_994 222
183 3300046665 Ga0495661_0026481 Ga0495661_0026481_2532_3203 222
184 3300046674 Ga0495588_0126974 Ga0495588_0126974_209_880 222
185 3300046678 Ga0495599_0020830 Ga0495599_0020830_2985_3656 222
186 3300046690 Ga0495624_0006092 Ga0495624_0006092_583_1254 222
187 3300046694 Ga0495649_0000205 Ga0495649_0000205_16003_16701 222
188 3300046809 Ga0495600_0191635 Ga0495600_0191635_323_994 222
189 3300047315 Ga0495581_0048251 Ga0495581_0048251_1465_2136 222
190 3300047317 Ga0495604_0048411 Ga0495604_0048411_2119_2790 222
191 3300047319 Ga0495674_0115527 Ga0495674_0115527_416_1087 222
192 3300047322 Ga0495680_0017125 Ga0495680_0017125_420_1091 222
193 3300047446 Ga0495679_001766 Ga0495679_001766_10639_11310 222
194 3300047673 Ga0495593_0020673 Ga0495593_0020673_514_1185 222
195 3300048088 Ga0495602_0034419 Ga0495602_0034419_538_1209 222
196 3300048920 Ga0496117_0118547 Ga0496117_0118547_59_742 222
197 3300048921 Ga0496118_0036828 Ga0496118_0036828_2660_3343 222
198 3300048924 Ga0496121_0110830 Ga0496121_0110830_1209_1892 222
199 3300053079 Ga0500610_0017782 Ga0500610_0017782_1931_2614 222
200 3300053122 Ga0500608_002755 Ga0500608_002755_2727_3410 222
201 2124908027 MRS2a_Contig_5562 MRS2a_00436800 223
202 2162886007 SwRhRL2b_contig_554480 SwRhRL2b_0389.00006610 223
203 3300002737 JGI25162J39368_1000197 JGI25162J39368_100019723 223
204 3300002771 JGI25163J39215_1000326 JGI25163J39215_10003269 223
205 3300002772 JGI25164J39214_1000309 JGI25164J39214_10003094 223
206 3300003214 JGI25165J46597_1000293 JGI25165J46597_100029340 223
207 3300003577 Ga0007416J51690_1043430 Ga0007416J51690_10434303 223
208 3300003781 Ga0055536_1000014 Ga0055536_1000014105 223
209 3300003781 Ga0055536_1000125 Ga0055536_100012550 223
210 3300003781 Ga0055536_1000185 Ga0055536_100018510 223
211 3300003791 Ga0055530_10000009 Ga0055530_10000009105 223
212 3300003791 Ga0055530_10000130 Ga0055530_1000013021 223
213 3300003792 Ga0055540_1000222 Ga0055540_100022211 223
214 3300003792 Ga0055540_1000560 Ga0055540_100056021 223
215 3300003792 Ga0055540_1000865 Ga0055540_100086511 223
216 3300003794 Ga0055531_10000215 Ga0055531_1000021533 223
217 3300005288 Ga0065714_10003912 Ga0065714_100039123 223
218 3300005289 Ga0065704_10031668 Ga0065704_100316682 223
219 3300005289 Ga0065704_10121549 Ga0065704_101215492 223
220 3300005290 Ga0065712_10075586 Ga0065712_100755863 223
221 3300005331 Ga0070670_100000310 Ga0070670_1000003106 223
222 3300005344 Ga0070661_100000109 Ga0070661_10000010926 223
223 3300005353 Ga0070669_100000452 Ga0070669_10000045212 223
224 3300005355 Ga0070671_100340563 Ga0070671_1003405632 223
225 3300005440 Ga0070705_100231301 Ga0070705_1002313011 223
226 3300005457 Ga0070662_100002689 Ga0070662_1000026897 223
227 3300005530 Ga0070679_100001343 Ga0070679_1000013438 223
228 3300005539 Ga0068853_100000003 Ga0068853_10000000330 223
229 3300005539 Ga0068853_100069863 Ga0068853_1000698632 223
230 3300005548 Ga0070665_100038852 Ga0070665_1000388524 223
231 3300005548 Ga0070665_100063377 Ga0070665_1000633774 223
232 3300005564 Ga0070664_100000086 Ga0070664_10000008619 223
233 3300005578 Ga0068854_100028651 Ga0068854_1000286513 223
234 3300005834 Ga0068851_10000021 Ga0068851_1000002123 223
235 3300005937 Ga0081455_10034885 Ga0081455_100348853 223
236 3300005985 Ga0081539_10018963 Ga0081539_100189632 223
237 3300005985 Ga0081539_10031372 Ga0081539_100313722 223
238 3300006028 Ga0070717_10034168 Ga0070717_100341683 223
239 3300006051 Ga0075364_10032691 Ga0075364_100326913 223
240 3300006058 Ga0075432_10003812 Ga0075432_100038123 223
241 3300006058 Ga0075432_10011338 Ga0075432_100113381 223
242 3300006177 Ga0075362_10086375 Ga0075362_100863751 223
243 3300006946 Ga0079104_1000239 Ga0079104_100023954 223
244 3300006946 Ga0079104_1002227 Ga0079104_10022277 223
245 3300007265 Ga0099794_10278996 Ga0099794_102789961 223
246 3300009011 Ga0105251_10001070 Ga0105251_1000107011 223
247 3300009011 Ga0105251_10001398 Ga0105251_100013988 223
248 3300009011 Ga0105251_10007350 Ga0105251_100073502 223
249 3300009011 Ga0105251_10008119 Ga0105251_100081191 223
250 3300009011 Ga0105251_10055141 Ga0105251_100551411 223
251 3300009036 Ga0105244_10006535 Ga0105244_100065358 223
252 3300009036 Ga0105244_10013404 Ga0105244_100134043 223
253 3300009036 Ga0105244_10038671 Ga0105244_100386713 223
254 3300009036 Ga0105244_10088915 Ga0105244_100889151 223
255 3300009036 Ga0105244_10124415 Ga0105244_101244151 223
256 3300009036 Ga0105244_10315355 Ga0105244_103153551 223
257 3300009092 Ga0105250_10000120 Ga0105250_1000012021 223
258 3300009092 Ga0105250_10001119 Ga0105250_100011193 223
259 3300009092 Ga0105250_10010602 Ga0105250_100106022 223
260 3300009092 Ga0105250_10022042 Ga0105250_100220422 223
261 3300009094 Ga0111539_10063881 Ga0111539_100638812 223
262 3300009147 Ga0114129_10174704 Ga0114129_101747043 223
263 3300009148 Ga0105243_10000135 Ga0105243_1000013557 223
264 3300009148 Ga0105243_10000587 Ga0105243_1000058721 223
265 3300009148 Ga0105243_10122002 Ga0105243_101220021 223
266 3300009176 Ga0105242_10000314 Ga0105242_1000031410 223
267 3300009176 Ga0105242_10328341 Ga0105242_103283412 223
268 3300009177 Ga0105248_10086220 Ga0105248_100862203 223
269 3300009545 Ga0105237_10000391 Ga0105237_1000039125 223
270 3300009553 Ga0105249_10032513 Ga0105249_100325132 223
271 3300011119 Ga0105246_10000239 Ga0105246_100002399 223
272 3300011119 Ga0105246_10043926 Ga0105246_100439262 223
273 3300012498 Ga0157345_1000249 Ga0157345_10002495 223
274 3300013100 Ga0157373_10001617 Ga0157373_1000161711 223
275 3300013100 Ga0157373_10005283 Ga0157373_1000528310 223
276 3300013100 Ga0157373_10008815 Ga0157373_100088154 223
277 3300013102 Ga0157371_10003122 Ga0157371_1000312210 223
278 3300013102 Ga0157371_10212306 Ga0157371_102123061 223
279 3300013104 Ga0157370_10030390 Ga0157370_100303903 223
280 3300013104 Ga0157370_10104320 Ga0157370_101043202 223
281 3300013105 Ga0157369_10009720 Ga0157369_100097204 223
282 3300013105 Ga0157369_10010109 Ga0157369_1001010911 223
283 3300013105 Ga0157369_10049351 Ga0157369_100493514 223
284 3300013306 Ga0163162_10003597 Ga0163162_100035973 223
285 3300013306 Ga0163162_10067695 Ga0163162_100676952 223
286 3300013306 Ga0163162_10098762 Ga0163162_100987622 223
287 3300013306 Ga0163162_10393868 Ga0163162_103938682 223
288 3300013307 Ga0157372_10004984 Ga0157372_1000498412 223
289 3300013308 Ga0157375_10002219 Ga0157375_100022195 223
290 3300013308 Ga0157375_10426513 Ga0157375_104265132 223
291 3300014326 Ga0157380_10084066 Ga0157380_100840662 223
292 3300014497 Ga0182008_10000092 Ga0182008_1000009249 223
293 3300014497 Ga0182008_10004811 Ga0182008_100048114 223
294 3300014497 Ga0182008_10005922 Ga0182008_100059221 223
295 3300014497 Ga0182008_10029786 Ga0182008_100297862 223
296 3300015261 Ga0182006_1000920 Ga0182006_100092010 223
297 3300015261 Ga0182006_1002031 Ga0182006_10020318 223
298 3300015261 Ga0182006_1006929 Ga0182006_10069293 223
299 3300015262 Ga0182007_10000477 Ga0182007_100004774 223
300 3300015262 Ga0182007_10000786 Ga0182007_1000078611 223
301 3300015265 Ga0182005_1000604 Ga0182005_10006043 223
302 3300015265 Ga0182005_1001126 Ga0182005_100112611 223
303 3300015265 Ga0182005_1027100 Ga0182005_10271002 223
304 3300015265 Ga0182005_1027101 Ga0182005_10271012 223
305 3300017792 Ga0163161_10006936 Ga0163161_100069364 223
306 3300017792 Ga0163161_10064610 Ga0163161_100646102 223
307 3300021384 Ga0213876_10009936 Ga0213876_100099363 223
308 3300025207 Ga0209760_100108 Ga0209760_10010819 223
309 3300025230 Ga0209563_100826 Ga0209563_1008267 223
310 3300025231 Ga0207427_100007 Ga0207427_100007706 223
311 3300025233 Ga0209437_100006 Ga0209437_100006972 223
312 3300025261 Ga0209233_1000059 Ga0209233_100005923 223
313 3300025291 Ga0209675_1003084 Ga0209675_10030849 223
314 3300025292 Ga0209676_1000002 Ga0209676_1000002313 223
315 3300025292 Ga0209676_1000003 Ga0209676_1000003797 223
316 3300025292 Ga0209676_1000006 Ga0209676_1000006981 223
317 3300025298 Ga0209050_1000004 Ga0209050_1000004779 223
318 3300025298 Ga0209050_1000242 Ga0209050_100024283 223
319 3300025298 Ga0209050_1000317 Ga0209050_100031722 223
320 3300025303 Ga0209051_1000001 Ga0209051_1000001313 223
321 3300025303 Ga0209051_1000006 Ga0209051_1000006196 223
322 3300025303 Ga0209051_1000218 Ga0209051_100021876 223
323 3300025304 Ga0209257_1000167 Ga0209257_1000167141 223
324 3300025321 Ga0207656_10000020 Ga0207656_1000002095 223
325 3300025711 Ga0207696_1000052 Ga0207696_100005223 223
326 3300025711 Ga0207696_1000147 Ga0207696_100014785 223
327 3300025711 Ga0207696_1002556 Ga0207696_10025564 223
328 3300025711 Ga0207696_1003391 Ga0207696_10033913 223
329 3300025728 Ga0207655_1000333 Ga0207655_100033340 223
330 3300025728 Ga0207655_1000409 Ga0207655_100040929 223
331 3300025728 Ga0207655_1003745 Ga0207655_10037456 223
332 3300025728 Ga0207655_1004101 Ga0207655_10041015 223
333 3300025728 Ga0207655_1009742 Ga0207655_10097424 223
334 3300025728 Ga0207655_1032993 Ga0207655_10329932 223
335 3300025735 Ga0207713_1000453 Ga0207713_100045310 223
336 3300025735 Ga0207713_1001189 Ga0207713_100118922 223
337 3300025735 Ga0207713_1001663 Ga0207713_100166312 223
338 3300025735 Ga0207713_1002292 Ga0207713_10022924 223
339 3300025735 Ga0207713_1002467 Ga0207713_10024678 223
340 3300025735 Ga0207713_1007482 Ga0207713_10074824 223
341 3300025735 Ga0207713_1024048 Ga0207713_10240482 223
342 3300025914 Ga0207671_10000356 Ga0207671_1000035626 223
343 3300025920 Ga0207649_10000020 Ga0207649_1000002026 223
344 3300025921 Ga0207652_10059071 Ga0207652_100590713 223
345 3300025923 Ga0207681_10000119 Ga0207681_1000011931 223
346 3300025925 Ga0207650_10000225 Ga0207650_1000022534 223
347 3300025929 Ga0207664_10104985 Ga0207664_101049852 223
348 3300025933 Ga0207706_10000855 Ga0207706_1000085519 223
349 3300025934 Ga0207686_10000917 Ga0207686_100009177 223
350 3300025934 Ga0207686_10233565 Ga0207686_102335652 223
351 3300025935 Ga0207709_10000014 Ga0207709_10000014389 223
352 3300025935 Ga0207709_10000251 Ga0207709_1000025148 223
353 3300025935 Ga0207709_10016757 Ga0207709_100167572 223
354 3300025945 Ga0207679_10000023 Ga0207679_1000002326 223
355 3300025961 Ga0207712_10017913 Ga0207712_100179134 223
356 3300025981 Ga0207640_10008460 Ga0207640_100084603 223
357 3300026041 Ga0207639_10000002 Ga0207639_10000002398 223
358 3300026041 Ga0207639_10052357 Ga0207639_100523572 223
359 3300027111 Ga0209281_1000368 Ga0209281_100036854 223
360 3300027111 Ga0209281_1031951 Ga0209281_10319512 223
361 3300027907 Ga0207428_10019494 Ga0207428_100194942 223
362 3300028379 Ga0268266_10012761 Ga0268266_100127614 223
363 3300028379 Ga0268266_10129392 Ga0268266_101293922 223
364 3300028794 Ga0307515_10059818 Ga0307515_100598185 223
365 3300030521 Ga0307511_10164558 Ga0307511_101645581 223
366 3300031456 Ga0307513_10000667 Ga0307513_1000066717 223
367 3300031456 Ga0307513_10012235 Ga0307513_1001223510 223
368 3300031548 Ga0307408_100000265 Ga0307408_10000026516 223
369 3300031730 Ga0307516_10261193 Ga0307516_102611931 223
370 3300031731 Ga0307405_10000084 Ga0307405_100000848 223
371 3300031731 Ga0307405_10000126 Ga0307405_1000012612 223
372 3300031731 Ga0307405_10001787 Ga0307405_100017871 223
373 3300031911 Ga0307412_10000132 Ga0307412_1000013234 223
374 3300031911 Ga0307412_10011956 Ga0307412_100119565 223
375 3300031911 Ga0307412_10154643 Ga0307412_101546432 223
376 3300033180 Ga0307510_10017621 Ga0307510_100176212 223
377 3300035116 Ga0373945_0110523 Ga0373945_0110523_376_1050 223
378 3300035170 Ga0373943_0041918 Ga0373943_0041918_1056_1730 223
379 3300035172 Ga0373955_0010297 Ga0373955_0010297_2967_3641 223
380 3300036401 Ga0373937_0381928 Ga0373937_0381928_515_1189 223
381 3300037068 Ga0373925_0764102 Ga0373925_0764102_30_704 223
382 3300038705 Ga0237819_02360 Ga0237819_02360_1388_2062 223
383 3300039437 Ga0436365_0605876 Ga0436365_0605876_5521_6264 223
384 3300041404 Ga0439436_0000257 Ga0439436_0000257_3992_4666 223
385 3300041405 Ga0439438_002827 Ga0439438_002827_449_1123 223
386 3300041407 Ga0439447_009963 Ga0439447_009963_635_1309 223
387 3300041411 Ga0439466_0000026 Ga0439466_0000026_60186_60860 223
388 3300041411 Ga0439466_0000405 Ga0439466_0000405_14008_14682 223
389 3300042006 Ga0439432_000831 Ga0439432_000831_155_829 223
390 3300042009 Ga0439451_000030 Ga0439451_000030_11233_11907 223
391 3300042010 Ga0439452_000482 Ga0439452_000482_14642_15316 223
392 3300042013 Ga0439456_020561 Ga0439456_020561_681_1355 223
393 3300042016 Ga0439463_000073 Ga0439463_000073_15560_16234 223
394 3300042016 Ga0439463_000457 Ga0439463_000457_7174_7848 223
395 3300042125 Ga0450923_021625 Ga0450923_021625_97_771 223
396 3300042156 Ga0439446_0004554 Ga0439446_0004554_2342_3016 223
397 3300042435 Ga0439434_0000133 Ga0439434_0000133_4601_5275 223
398 3300042876 Ga0451577_0162781 Ga0451577_0162781_1186_1860 223
399 3300042876 Ga0451577_0297749 Ga0451577_0297749_58_729 223
400 3300042876 Ga0451577_0298616 Ga0451577_0298616_320_991 223
401 3300042876 Ga0451577_0346900 Ga0451577_0346900_274_948 223
402 3300042876 Ga0451577_0407886 Ga0451577_0407886_238_912 223
403 3300042876 Ga0451577_0414124 Ga0451577_0414124_309_980 223
404 3300042993 Ga0439440_0004516 Ga0439440_0004516_695_1369 223
405 3300044673 Ga0453683_0000114 Ga0453683_0000114_17790_18464 223
406 3300044712 Ga0453684_0007772 Ga0453684_0007772_11097_11771 223
407 3300044712 Ga0453684_0293268 Ga0453684_0293268_370_1041 223
408 3300045051 Ga0451576_0000151 Ga0451576_0000151_146933_147607 223
409 3300045051 Ga0451576_0004207 Ga0451576_0004207_4614_5288 223
410 3300046452 Ga0495617_006624 Ga0495617_006624_1764_2438 223
411 3300046452 Ga0495617_022351 Ga0495617_022351_1241_1915 223
412 3300046452 Ga0495617_054409 Ga0495617_054409_634_1308 223
413 3300046453 Ga0495627_000010 Ga0495627_000010_343741_344559 223
414 3300046453 Ga0495627_000137 Ga0495627_000137_42163_42837 223
415 3300046453 Ga0495627_001498 Ga0495627_001498_1604_2278 223
416 3300046453 Ga0495627_004025 Ga0495627_004025_3173_3847 223
417 3300046453 Ga0495627_004564 Ga0495627_004564_1467_2141 223
418 3300046453 Ga0495627_006204 Ga0495627_006204_1378_2052 223
419 3300046454 Ga0495592_0187357 Ga0495592_0187357_94_768 223
420 3300046455 Ga0495603_0016844 Ga0495603_0016844_3721_4395 223
421 3300046458 Ga0495591_000163 Ga0495591_000163_56129_56803 223
422 3300046458 Ga0495591_000975 Ga0495591_000975_14910_15584 223
423 3300046458 Ga0495591_001553 Ga0495591_001553_714_1388 223
424 3300046458 Ga0495591_001986 Ga0495591_001986_9294_9968 223
425 3300046458 Ga0495591_002129 Ga0495591_002129_8022_8696 223
426 3300046458 Ga0495591_007858 Ga0495591_007858_2012_2686 223
427 3300046458 Ga0495591_017563 Ga0495591_017563_345_1019 223
428 3300046460 Ga0495638_0001429 Ga0495638_0001429_2644_3318 223
429 3300046460 Ga0495638_0003116 Ga0495638_0003116_2768_3442 223
430 3300046460 Ga0495638_0014481 Ga0495638_0014481_3111_3785 223
431 3300046460 Ga0495638_0029181 Ga0495638_0029181_2634_3308 223
432 3300046463 Ga0495653_0000110 Ga0495653_0000110_55160_55834 223
433 3300046463 Ga0495653_0268167 Ga0495653_0268167_34_708 223
434 3300046471 Ga0495650_0005492 Ga0495650_0005492_3275_3949 223
435 3300046471 Ga0495650_0017624 Ga0495650_0017624_1409_2083 223
436 3300046471 Ga0495650_0070269 Ga0495650_0070269_583_1257 223
437 3300046474 Ga0495605_0000001 Ga0495605_0000001_258904_259578 223
438 3300046474 Ga0495605_0000324 Ga0495605_0000324_36259_36933 223
439 3300046474 Ga0495605_0007188 Ga0495605_0007188_2120_2794 223
440 3300046474 Ga0495605_0022426 Ga0495605_0022426_1633_2307 223
441 3300046475 Ga0495639_0001252 Ga0495639_0001252_6317_6991 223
442 3300046475 Ga0495639_0111950 Ga0495639_0111950_32_706 223
443 3300046477 Ga0495664_0305090 Ga0495664_0305090_196_870 223
444 3300046491 Ga0495584_0001304 Ga0495584_0001304_12695_13369 223
445 3300046491 Ga0495584_0072103 Ga0495584_0072103_889_1563 223
446 3300046492 Ga0495585_0000283 Ga0495585_0000283_33584_34258 223
447 3300046492 Ga0495585_0006867 Ga0495585_0006867_3238_3912 223
448 3300046492 Ga0495585_0011854 Ga0495585_0011854_2430_3104 223
449 3300046492 Ga0495585_0057474 Ga0495585_0057474_175_849 223
450 3300046500 Ga0495596_0022516 Ga0495596_0022516_863_1537 223
451 3300046501 Ga0495607_0000094 Ga0495607_0000094_76935_77609 223
452 3300046501 Ga0495607_0000391 Ga0495607_0000391_33644_34318 223
453 3300046501 Ga0495607_0001397 Ga0495607_0001397_13265_13939 223
454 3300046501 Ga0495607_0001852 Ga0495607_0001852_13821_14495 223
455 3300046501 Ga0495607_0009143 Ga0495607_0009143_2639_3313 223
456 3300046501 Ga0495607_0013393 Ga0495607_0013393_4412_5086 223
457 3300046501 Ga0495607_0014374 Ga0495607_0014374_2897_3571 223
458 3300046501 Ga0495607_0016645 Ga0495607_0016645_1619_2293 223
459 3300046501 Ga0495607_0018619 Ga0495607_0018619_1597_2271 223
460 3300046501 Ga0495607_0039552 Ga0495607_0039552_229_903 223
461 3300046501 Ga0495607_0072518 Ga0495607_0072518_722_1396 223
462 3300046501 Ga0495607_0296405 Ga0495607_0296405_78_752 223
463 3300046506 Ga0495583_0000611 Ga0495583_0000611_7328_8002 223
464 3300046506 Ga0495583_0000778 Ga0495583_0000778_30231_30905 223
465 3300046507 Ga0495606_0000421 Ga0495606_0000421_55523_56197 223
466 3300046507 Ga0495606_0005295 Ga0495606_0005295_8459_9133 223
467 3300046507 Ga0495606_0006865 Ga0495606_0006865_6337_7011 223
468 3300046507 Ga0495606_0015567 Ga0495606_0015567_3094_3768 223
469 3300046507 Ga0495606_0019528 Ga0495606_0019528_2552_3226 223
470 3300046507 Ga0495606_0026643 Ga0495606_0026643_1885_2559 223
471 3300046507 Ga0495606_0028625 Ga0495606_0028625_1937_2611 223
472 3300046507 Ga0495606_0081415 Ga0495606_0081415_902_1576 223
473 3300046512 Ga0495610_0000644 Ga0495610_0000644_11765_12439 223
474 3300046512 Ga0495610_0002650 Ga0495610_0002650_10180_10854 223
475 3300046512 Ga0495610_0038069 Ga0495610_0038069_1588_2262 223
476 3300046512 Ga0495610_0047155 Ga0495610_0047155_1205_1879 223
477 3300046512 Ga0495610_0059027 Ga0495610_0059027_39_713 223
478 3300046513 Ga0495616_0004820 Ga0495616_0004820_4344_5018 223
479 3300046513 Ga0495616_0004858 Ga0495616_0004858_4376_5050 223
480 3300046513 Ga0495616_0008984 Ga0495616_0008984_3223_3897 223
481 3300046513 Ga0495616_0010017 Ga0495616_0010017_3360_4034 223
482 3300046513 Ga0495616_0017609 Ga0495616_0017609_1964_2638 223
483 3300046514 Ga0495618_0018455 Ga0495618_0018455_2291_2965 223
484 3300046515 Ga0495620_0000242 Ga0495620_0000242_37200_37874 223
485 3300046515 Ga0495620_0016449 Ga0495620_0016449_2520_3194 223
486 3300046515 Ga0495620_0019057 Ga0495620_0019057_2048_2722 223
487 3300046515 Ga0495620_0030056 Ga0495620_0030056_1634_2308 223
488 3300046516 Ga0495628_0022294 Ga0495628_0022294_1317_1991 223
489 3300046518 Ga0495631_0003453 Ga0495631_0003453_3270_3944 223
490 3300046518 Ga0495631_0003954 Ga0495631_0003954_3386_4060 223
491 3300046518 Ga0495631_0005013 Ga0495631_0005013_3433_4107 223
492 3300046519 Ga0495632_0002747 Ga0495632_0002747_2269_2943 223
493 3300046519 Ga0495632_0008701 Ga0495632_0008701_3148_3822 223
494 3300046519 Ga0495632_0018143 Ga0495632_0018143_1834_2508 223
495 3300046519 Ga0495632_0058262 Ga0495632_0058262_562_1236 223
496 3300046520 Ga0495637_0001790 Ga0495637_0001790_8453_9127 223
497 3300046520 Ga0495637_0002035 Ga0495637_0002035_3868_4542 223
498 3300046520 Ga0495637_0010237 Ga0495637_0010237_1069_1743 223
499 3300046520 Ga0495637_0013928 Ga0495637_0013928_2561_3235 223
500 3300046520 Ga0495637_0050087 Ga0495637_0050087_475_1149 223
501 3300046520 Ga0495637_0056271 Ga0495637_0056271_418_1092 223
502 3300046522 Ga0495643_0011083 Ga0495643_0011083_2392_3066 223
503 3300046522 Ga0495643_0067390 Ga0495643_0067390_94_768 223
504 3300046523 Ga0495644_0004529 Ga0495644_0004529_1627_2301 223
505 3300046524 Ga0495648_0006976 Ga0495648_0006976_4151_4825 223
506 3300046524 Ga0495648_0013697 Ga0495648_0013697_2195_2869 223
507 3300046524 Ga0495648_0036764 Ga0495648_0036764_1837_2511 223
508 3300046524 Ga0495648_0109968 Ga0495648_0109968_799_1473 223
509 3300046530 Ga0495654_0000137 Ga0495654_0000137_17898_18572 223
510 3300046530 Ga0495654_0001197 Ga0495654_0001197_3426_4100 223
511 3300046530 Ga0495654_0003840 Ga0495654_0003840_4851_5525 223
512 3300046530 Ga0495654_0007592 Ga0495654_0007592_4315_4989 223
513 3300046530 Ga0495654_0014855 Ga0495654_0014855_1856_2530 223
514 3300046530 Ga0495654_0026131 Ga0495654_0026131_713_1387 223
515 3300046530 Ga0495654_0035730 Ga0495654_0035730_1007_1681 223
516 3300046530 Ga0495654_0050606 Ga0495654_0050606_1212_1886 223
517 3300046530 Ga0495654_0128661 Ga0495654_0128661_287_961 223
518 3300046538 Ga0495609_0007641 Ga0495609_0007641_303_977 223
519 3300046538 Ga0495609_0007717 Ga0495609_0007717_1640_2314 223
520 3300046538 Ga0495609_0013695 Ga0495609_0013695_164_838 223
521 3300046538 Ga0495609_0030273 Ga0495609_0030273_15_689 223
522 3300046538 Ga0495609_0107756 Ga0495609_0107756_423_1097 223
523 3300046542 Ga0495597_0000008 Ga0495597_0000008_14407_15081 223
524 3300046557 Ga0495622_0002337 Ga0495622_0002337_8455_9129 223
525 3300046557 Ga0495622_0126077 Ga0495622_0126077_313_987 223
526 3300046558 Ga0495633_0013961 Ga0495633_0013961_1990_2664 223
527 3300046616 Ga0495668_0007713 Ga0495668_0007713_3041_3715 223
528 3300046648 Ga0495611_0001236 Ga0495611_0001236_2011_2685 223
529 3300046648 Ga0495611_0201691 Ga0495611_0201691_186_860 223
530 3300046660 Ga0495625_0009513 Ga0495625_0009513_3119_3793 223
531 3300046660 Ga0495625_0025532 Ga0495625_0025532_2889_3563 223
532 3300046660 Ga0495625_0026892 Ga0495625_0026892_3593_4267 223
533 3300046660 Ga0495625_0094194 Ga0495625_0094194_610_1485 223
534 3300046663 Ga0495635_0112572 Ga0495635_0112572_737_1411 223
535 3300046665 Ga0495661_0000013 Ga0495661_0000013_195415_196089 223
536 3300046665 Ga0495661_0000503 Ga0495661_0000503_7855_8529 223
537 3300046665 Ga0495661_0000977 Ga0495661_0000977_12435_13109 223
538 3300046665 Ga0495661_0021526 Ga0495661_0021526_1993_2667 223
539 3300046689 Ga0495613_0126184 Ga0495613_0126184_170_844 223
540 3300046690 Ga0495624_0001949 Ga0495624_0001949_11110_11784 223
541 3300046691 Ga0495670_0002982 Ga0495670_0002982_3467_4141 223
542 3300046692 Ga0495671_0001003 Ga0495671_0001003_11082_11756 223
543 3300046692 Ga0495671_0011250 Ga0495671_0011250_1037_1717 223
544 3300046692 Ga0495671_0017339 Ga0495671_0017339_1351_2025 223
545 3300046692 Ga0495671_0024305 Ga0495671_0024305_1989_2663 223
546 3300046692 Ga0495671_0027335 Ga0495671_0027335_355_1029 223
547 3300046692 Ga0495671_0064665 Ga0495671_0064665_197_871 223
548 3300046694 Ga0495649_0001249 Ga0495649_0001249_15981_16655 223
549 3300046694 Ga0495649_0011541 Ga0495649_0011541_3045_3719 223
550 3300046694 Ga0495649_0027832 Ga0495649_0027832_844_1518 223
551 3300046694 Ga0495649_0062763 Ga0495649_0062763_352_1026 223
552 3300046794 Ga0495589_0000318 Ga0495589_0000318_35105_35779 223
553 3300046794 Ga0495589_0010769 Ga0495589_0010769_1508_2182 223
554 3300046794 Ga0495589_0025458 Ga0495589_0025458_1972_2646 223
555 3300046794 Ga0495589_0044039 Ga0495589_0044039_120_794 223
556 3300046794 Ga0495589_0127724 Ga0495589_0127724_532_1206 223
557 3300046810 Ga0495660_0000142 Ga0495660_0000142_54771_55445 223
558 3300046810 Ga0495660_0000528 Ga0495660_0000528_28217_28891 223
559 3300046810 Ga0495660_0001037 Ga0495660_0001037_5856_6530 223
560 3300046810 Ga0495660_0019958 Ga0495660_0019958_494_1168 223
561 3300046810 Ga0495660_0024615 Ga0495660_0024615_2305_2979 223
562 3300046810 Ga0495660_0052402 Ga0495660_0052402_1079_1753 223
563 3300047320 Ga0495672_0002987 Ga0495672_0002987_3252_3926 223
564 3300047320 Ga0495672_0004835 Ga0495672_0004835_4270_4944 223
565 3300047320 Ga0495672_0011316 Ga0495672_0011316_1881_2555 223
566 3300047320 Ga0495672_0014008 Ga0495672_0014008_506_1180 223
567 3300047320 Ga0495672_0041233 Ga0495672_0041233_509_1183 223
568 3300047320 Ga0495672_0047982 Ga0495672_0047982_647_1321 223
569 3300047320 Ga0495672_0261835 Ga0495672_0261835_68_742 223
570 3300047321 Ga0495676_0003671 Ga0495676_0003671_7390_8064 223
571 3300047321 Ga0495676_0014550 Ga0495676_0014550_3090_3764 223
572 3300047322 Ga0495680_0041178 Ga0495680_0041178_2762_3436 223
573 3300047322 Ga0495680_0098278 Ga0495680_0098278_378_1052 223
574 3300047323 Ga0495683_0005772 Ga0495683_0005772_4105_4779 223
575 3300047323 Ga0495683_0016186 Ga0495683_0016186_1198_1872 223
576 3300047443 Ga0495687_010472 Ga0495687_010472_4145_4819 223
577 3300047446 Ga0495679_000372 Ga0495679_000372_4478_5152 223
578 3300047446 Ga0495679_004120 Ga0495679_004120_1840_2514 223
579 3300047446 Ga0495679_013938 Ga0495679_013938_282_956 223
580 3300047446 Ga0495679_015872 Ga0495679_015872_320_994 223
581 3300047469 Ga0495673_0005503 Ga0495673_0005503_2464_3138 223
582 3300047469 Ga0495673_0006518 Ga0495673_0006518_4135_4809 223
583 3300047469 Ga0495673_0011071 Ga0495673_0011071_1486_2160 223
584 3300047469 Ga0495673_0184386 Ga0495673_0184386_62_736 223
585 3300047470 Ga0495681_0000329 Ga0495681_0000329_15620_16294 223
586 3300047470 Ga0495681_0003223 Ga0495681_0003223_7538_8212 223
587 3300047470 Ga0495681_0005528 Ga0495681_0005528_3385_4059 223
588 3300047470 Ga0495681_0008962 Ga0495681_0008962_3161_3835 223
589 3300047470 Ga0495681_0011670 Ga0495681_0011670_3173_3847 223
590 3300047470 Ga0495681_0013305 Ga0495681_0013305_2505_3179 223
591 3300047470 Ga0495681_0023485 Ga0495681_0023485_826_1500 223
592 3300047470 Ga0495681_0092780 Ga0495681_0092780_122_796 223
593 3300047472 Ga0495686_0010032 Ga0495686_0010032_4415_5089 223
594 3300047673 Ga0495593_0001599 Ga0495593_0001599_10896_11570 223
595 3300048091 Ga0495626_0004692 Ga0495626_0004692_3432_4106 223
596 3300048091 Ga0495626_0007255 Ga0495626_0007255_3879_4553 223
597 3300048091 Ga0495626_0022508 Ga0495626_0022508_186_860 223
598 3300048919 Ga0496116_0000318 Ga0496116_0000318_22959_23633 223
599 3300048919 Ga0496116_0003624 Ga0496116_0003624_10679_11353 223
600 3300048919 Ga0496116_0011989 Ga0496116_0011989_3355_4029 223
601 3300048919 Ga0496116_0014741 Ga0496116_0014741_1021_1695 223
602 3300048920 Ga0496117_0000838 Ga0496117_0000838_28715_29389 223
603 3300048920 Ga0496117_0000838 Ga0496117_0000838_36622_37296 223
604 3300048920 Ga0496117_0000981 Ga0496117_0000981_15269_15943 223
605 3300048920 Ga0496117_0020784 Ga0496117_0020784_2278_2952 223
606 3300048921 Ga0496118_0010399 Ga0496118_0010399_3390_4064 223
607 3300048921 Ga0496118_0042581 Ga0496118_0042581_937_1611 223
608 3300048921 Ga0496118_0042951 Ga0496118_0042951_750_1424 223
609 3300048921 Ga0496118_0058872 Ga0496118_0058872_874_1548 223
610 3300048921 Ga0496118_0278520 Ga0496118_0278520_18_692 223
611 3300048922 Ga0496119_0018764 Ga0496119_0018764_4071_4745 223
612 3300048922 Ga0496119_0047252 Ga0496119_0047252_234_908 223
613 3300048923 Ga0496120_0015063 Ga0496120_0015063_888_1562 223
614 3300048923 Ga0496120_0075948 Ga0496120_0075948_816_1490 223
615 3300048924 Ga0496121_0000463 Ga0496121_0000463_56025_56699 223
616 3300048924 Ga0496121_0026911 Ga0496121_0026911_2777_3451 223
617 3300048924 Ga0496121_0096575 Ga0496121_0096575_281_955 223
618 3300048925 Ga0496122_0012229 Ga0496122_0012229_1599_2273 223
619 3300048925 Ga0496122_0055546 Ga0496122_0055546_1605_2279 223
620 3300048925 Ga0496122_0218830 Ga0496122_0218830_65_739 223
621 3300048926 Ga0496123_0002822 Ga0496123_0002822_3467_4141 223
622 3300048926 Ga0496123_0029837 Ga0496123_0029837_580_1254 223
623 3300048926 Ga0496123_0045582 Ga0496123_0045582_926_1600 223
624 3300048926 Ga0496123_0085236 Ga0496123_0085236_580_1254 223
625 3300048927 Ga0496124_0001258 Ga0496124_0001258_19514_20188 223
626 3300048927 Ga0496124_0001258 Ga0496124_0001258_27422_28096 223
627 3300048927 Ga0496124_0017104 Ga0496124_0017104_2198_2872 223
628 3300048927 Ga0496124_0029852 Ga0496124_0029852_1651_2325 223
629 3300048927 Ga0496124_0091167 Ga0496124_0091167_1439_2113 223
630 3300048927 Ga0496124_0170579 Ga0496124_0170579_402_1076 223
631 3300048928 Ga0496125_0001178 Ga0496125_0001178_31174_31848 223
632 3300048928 Ga0496125_0004482 Ga0496125_0004482_12782_13456 223
633 3300048928 Ga0496125_0042987 Ga0496125_0042987_1582_2256 223
634 3300048928 Ga0496125_0056206 Ga0496125_0056206_528_1202 223
635 3300048928 Ga0496125_0061733 Ga0496125_0061733_1671_2345 223
636 3300048928 Ga0496125_0065148 Ga0496125_0065148_700_1374 223
637 3300048928 Ga0496125_0073480 Ga0496125_0073480_1490_2164 223
638 3300048928 Ga0496125_0120158 Ga0496125_0120158_1180_1854 223
639 3300048929 Ga0496126_0001092 Ga0496126_0001092_41732_42406 223
640 3300048929 Ga0496126_0041933 Ga0496126_0041933_1426_2100 223
641 3300048929 Ga0496126_0054646 Ga0496126_0054646_323_997 223
642 3300049459 Ga0495678_002022 Ga0495678_002022_10620_11294 223
643 3300049459 Ga0495678_005389 Ga0495678_005389_3699_4373 223
644 3300049459 Ga0495678_005852 Ga0495678_005852_2949_3623 223
645 3300049459 Ga0495678_006693 Ga0495678_006693_1424_2098 223
646 3300049459 Ga0495678_041662 Ga0495678_041662_553_1227 223
647 3300049460 Ga0495682_0001091 Ga0495682_0001091_3062_3736 223
648 3300049568 Ga0501031_0120135 Ga0501031_0120135_615_1289 223
649 3300049571 Ga0501034_0043921 Ga0501034_0043921_2164_2838 223
650 3300049574 Ga0501038_0099730 Ga0501038_0099730_1608_2282 223
651 3300049741 Ga0501079_0456844 Ga0501079_0456844_309_986 223
652 3300049743 Ga0501081_0448005 Ga0501081_0448005_33_710 223
653 3300049822 Ga0501035_0353621 Ga0501035_0353621_31_705 223
654 3300050511 nmdc:mga08y16_50221_c1 nmdc:mga08y16_50221_c1_482_1156 223
655 3300053078 Ga0495612_0063528 Ga0495612_0063528_686_1360 223
656 3300053133 Ga0500655_023484 Ga0500655_023484_135_806 223
657 3300053140 Ga0500573_0002848 Ga0500573_0002848_7822_8496 223
658 3300053142 Ga0500577_0138633 Ga0500577_0138633_270_944 223
659 3300053161 Ga0500634_0000099 Ga0500634_0000099_917_1591 223
660 3300053178 Ga0500637_0194736 Ga0500637_0194736_117_788 223
661 iso_pu_bacteria 2844665904 2844666305 223
662 iso_pu_bacteria 2885211737 2885215108 223
663 iso_pu_bacteria 640427133 640489363 223
664 2010549000 RicEn_FSXC39451_b1 RicEn_382160 224
665 3300005338 Ga0068868_100466895 Ga0068868_1004668952 224
666 3300006944 Ga0099823_1000791 Ga0099823_100079115 224
667 3300009148 Ga0105243_10092697 Ga0105243_100926973 224
668 3300025935 Ga0207709_10036347 Ga0207709_100363472 224
669 3300027296 Ga0209389_1000114 Ga0209389_100011432 224
670 3300027312 Ga0209371_1000023 Ga0209371_1000023262 224
671 3300028800 Ga0265338_10008353 Ga0265338_100083534 224
672 3300030500 Ga0268256_1000023 Ga0268256_1000023178 224
673 3300031691 Ga0316579_10001052 Ga0316579_100010524 224
674 3300031727 Ga0316576_10024632 Ga0316576_100246324 224
675 3300031727 Ga0316576_10186480 Ga0316576_101864802 224
676 3300031728 Ga0316578_10012455 Ga0316578_100124551 224
677 3300031731 Ga0307405_10000151 Ga0307405_1000015116 224
678 3300031733 Ga0316577_10180111 Ga0316577_101801112 224
679 3300031911 Ga0307412_10400298 Ga0307412_104002981 224
680 3300035398 Ga0316574_0032201 Ga0316574_0032201_764_1444 224
681 3300036647 Ga0316582_0064155 Ga0316582_0064155_430_1110 224
682 3300036712 Ga0316584_0016160 Ga0316584_0016160_1021_1701 224
683 3300036712 Ga0316584_0026596 Ga0316584_0026596_2631_3311 224
684 3300036712 Ga0316584_0371008 Ga0316584_0371008_160_870 224
685 3300037471 Ga0395905_0000075 Ga0395905_0000075_29923_30609 224
686 3300039447 Ga0436361_0601543 Ga0436361_0601543_128_820 224
687 3300041407 Ga0439447_015270 Ga0439447_015270_808_1482 224
688 3300041407 Ga0439447_031136 Ga0439447_031136_83_757 224
689 3300042006 Ga0439432_000024 Ga0439432_000024_40156_40830 224
690 3300042006 Ga0439432_000067 Ga0439432_000067_19328_20002 224
691 3300046501 Ga0495607_0000066 Ga0495607_0000066_67870_68553 224
692 3300047472 Ga0495686_0056916 Ga0495686_0056916_838_1530 224
693 3300047472 Ga0495686_0269347 Ga0495686_0269347_159_851 224
694 3300048926 Ga0496123_0021112 Ga0496123_0021112_2464_3162 224
695 3300049523 Ga0501300_012846 Ga0501300_012846_182_892 224
696 3300049571 Ga0501034_0000164 Ga0501034_0000164_8179_8853 224
697 3300049571 Ga0501034_0000430 Ga0501034_0000430_38205_38882 224
698 3300049776 Ga0501280_000259 Ga0501280_000259_3314_4024 224
699 3300049778 Ga0501282_000766 Ga0501282_000766_2319_3029 224
700 3300053154 Ga0500619_000105 Ga0500619_000105_7656_8348 224
701 3300055283 Ga0500661_021735 Ga0500661_021735_249_941 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

51

160

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

193

268

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9824 1 118
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9811 1 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9758 1 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9748 1 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9729 2 121
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.994 1 80 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9856 1 80 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9815 2 120 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9797 1 82 3.40.50.2300
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9785 1 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A849ZME1-F1-model_v4 Response regulator 0.801 1 150 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2V9X674-F1-model_v4 Response regulatory domain-containing protein 0.7992 1 152 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2V6FEF3-F1-model_v4 Response regulatory domain-containing protein 0.7979 1 153 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A849ZME1-F1-model_v4 Response regulator 0.7957 1 150 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-G6FW36-F1-model_v4 Response regulator receiver protein 0.7909 1 152 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
88.23 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map