F476171
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 701 | 374 | 574 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300046453|Ga0495627_000010|Ga0495627_000010_343741_344559 |
| Length | 272 |
| Sequence | LKNKALTLKLLQAPEFPTIQGPVRLSPDLITNTASNNVIIPLIEQDIHMRILVVEDEPKTAEYMHQGLTESGYIVDVAVTGLDGLYLAQHQTYDIVILDVNLPEMDGWEVLARLRKTDNTRVMMVTARGRLDEKVKGLEMGADDYLVKPFEFPELLARVRTLMRRSEQSGLPDVLRVGDLELDQGRHRAFRGSQRIDLTTKEFALLHLLMRHSGEVMSRTQIISLVWDMNFDCDTNVVEVSIRRLRAKIDDPFNSKLIHTLRGVGYVLEVRE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 5 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 9 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 10 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 11 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 12 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 13 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 14 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 15 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 16 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 17 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 18 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 19 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 20 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 21 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 22 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 23 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 24 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 25 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 26 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 27 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 28 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 29 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 30 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 31 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 32 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 33 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 34 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 35 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 36 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 37 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 38 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 39 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 40 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 41 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 42 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 43 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 44 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 45 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 46 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 47 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 48 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 49 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 50 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 51 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 52 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 53 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 54 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 55 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 56 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 57 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 58 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 59 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 60 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 61 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 62 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 63 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 64 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 65 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 66 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 67 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 68 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 69 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 70 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 71 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 72 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 73 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 74 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 75 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 76 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 77 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 78 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 79 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 80 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 81 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 82 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 83 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 84 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 85 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 86 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 87 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 88 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 89 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 90 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 91 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 92 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 93 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 94 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 95 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 96 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 97 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 98 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 99 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 100 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 101 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 102 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 103 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 104 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 105 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 106 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 107 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 109 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 110 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 112 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 119 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 120 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 122 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 124 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 125 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 126 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 127 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 128 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 130 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 131 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 132 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 133 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 134 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 135 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 136 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 162 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 165 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 210 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 211 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 217 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 233 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 234 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 235 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 236 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 237 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 238 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 239 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 240 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 241 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 242 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 243 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 246 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 247 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 248 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 253 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 329 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 330 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 331 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 332 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 333 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 334 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 335 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 336 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 339 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 342 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 348 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 354 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 355 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 356 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 359 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 360 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 361 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 362 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 363 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 364 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 365 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 366 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 367 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 368 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 369 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 370 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 371 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 372 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 373 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 374 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.03 |
| Metatranscriptomes | 0.14 |
| Isolates | 17.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.99 |
| Nodule | 2.14 |
| Rhizoplane | 5.28 |
| Rhizosphere | 73.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC39451_b1 | 2010549000 | Bacteria | 843 |
| 2 | MRS2a_Contig_5562 | 2124908027 | Bacteria | 3108 |
| 3 | SwRhRL2b_contig_554480 | 2162886007 | Bacteria | 1171 |
| 4 | JGI25162J39368_1000197 | 3300002737 | Bacteria | 63232 |
| 5 | JGI25163J39215_1000326 | 3300002771 | Bacteria | 15894 |
| 6 | JGI25164J39214_1000309 | 3300002772 | Bacteria | 32356 |
| 7 | JGI25165J46597_1000293 | 3300003214 | Bacteria | 63232 |
| 8 | Ga0007416J51690_1043430 | 3300003577 | Bacteria | 1798 |
| 9 | Ga0055536_1000014 | 3300003781 | Bacteria | 240624 |
| 10 | Ga0055536_1000125 | 3300003781 | Bacteria | 65908 |
| 11 | Ga0055536_1000185 | 3300003781 | Bacteria | 51529 |
| 12 | Ga0055530_10000009 | 3300003791 | Bacteria | 174044 |
| 13 | Ga0055530_10000130 | 3300003791 | Bacteria | 65904 |
| 14 | Ga0055540_1000222 | 3300003792 | Bacteria | 53630 |
| 15 | Ga0055540_1000560 | 3300003792 | Bacteria | 27426 |
| 16 | Ga0055540_1000865 | 3300003792 | Bacteria | 20095 |
| 17 | Ga0055531_10000215 | 3300003794 | Bacteria | 63490 |
| 18 | Ga0065714_10003912 | 3300005288 | Bacteria | 6803 |
| 19 | Ga0065704_10031668 | 3300005289 | Bacteria | 1442 |
| 20 | Ga0065704_10121549 | 3300005289 | Bacteria | 1764 |
| 21 | Ga0065712_10075586 | 3300005290 | Bacteria | 3830 |
| 22 | Ga0070670_100000310 | 3300005331 | Bacteria | 41815 |
| 23 | Ga0068868_100466895 | 3300005338 | Bacteria | 1100 |
| 24 | Ga0070661_100000109 | 3300005344 | Bacteria | 68441 |
| 25 | Ga0070669_100000452 | 3300005353 | Bacteria | 31263 |
| 26 | Ga0070671_100340563 | 3300005355 | Bacteria | 1279 |
| 27 | Ga0070705_100231301 | 3300005440 | Bacteria | 1286 |
| 28 | Ga0070662_100002689 | 3300005457 | Bacteria | 10972 |
| 29 | Ga0070662_100063661 | 3300005457 | Bacteria | 2698 |
| 30 | Ga0070706_100551512 | 3300005467 | Bacteria | 1072 |
| 31 | Ga0070679_100001343 | 3300005530 | Bacteria | 21712 |
| 32 | Ga0068853_100000003 | 3300005539 | Bacteria | 434636 |
| 33 | Ga0068853_100069863 | 3300005539 | Bacteria | 3056 |
| 34 | Ga0068853_100101893 | 3300005539 | Bacteria | 2540 |
| 35 | Ga0070665_100038852 | 3300005548 | Bacteria | 4785 |
| 36 | Ga0070665_100063377 | 3300005548 | Bacteria | 3706 |
| 37 | Ga0068855_100572153 | 3300005563 | Bacteria | 1221 |
| 38 | Ga0070664_100000086 | 3300005564 | Bacteria | 58796 |
| 39 | Ga0070664_100014287 | 3300005564 | Bacteria | 6474 |
| 40 | Ga0068854_100028651 | 3300005578 | Bacteria | 3850 |
| 41 | Ga0068856_100038076 | 3300005614 | Bacteria | 4720 |
| 42 | Ga0068851_10000021 | 3300005834 | Bacteria | 132824 |
| 43 | Ga0081455_10034885 | 3300005937 | Bacteria | 4503 |
| 44 | Ga0081539_10018963 | 3300005985 | Bacteria | 4738 |
| 45 | Ga0081539_10031372 | 3300005985 | Bacteria | 3276 |
| 46 | Ga0070717_10034168 | 3300006028 | Bacteria | 4109 |
| 47 | Ga0075364_10032691 | 3300006051 | Bacteria | 3345 |
| 48 | Ga0075432_10003812 | 3300006058 | Bacteria | 5137 |
| 49 | Ga0075432_10011338 | 3300006058 | Bacteria | 3028 |
| 50 | Ga0075362_10086375 | 3300006177 | Bacteria | 1452 |
| 51 | Ga0068871_100174312 | 3300006358 | Bacteria | 1845 |
| 52 | Ga0099823_1000791 | 3300006944 | Bacteria | 23427 |
| 53 | Ga0079104_1000239 | 3300006946 | Bacteria | 73048 |
| 54 | Ga0079104_1002227 | 3300006946 | Bacteria | 10843 |
| 55 | Ga0099794_10278996 | 3300007265 | Bacteria | 864 |
| 56 | Ga0105251_10001070 | 3300009011 | Bacteria | 23980 |
| 57 | Ga0105251_10001398 | 3300009011 | Bacteria | 20815 |
| 58 | Ga0105251_10007350 | 3300009011 | Bacteria | 6805 |
| 59 | Ga0105251_10008119 | 3300009011 | Bacteria | 6354 |
| 60 | Ga0105251_10055141 | 3300009011 | Bacteria | 1885 |
| 61 | Ga0105244_10006535 | 3300009036 | Bacteria | 7520 |
| 62 | Ga0105244_10013404 | 3300009036 | Bacteria | 4795 |
| 63 | Ga0105244_10038671 | 3300009036 | Bacteria | 2487 |
| 64 | Ga0105244_10088915 | 3300009036 | Bacteria | 1521 |
| 65 | Ga0105244_10124415 | 3300009036 | Bacteria | 1247 |
| 66 | Ga0105244_10315355 | 3300009036 | Bacteria | 722 |
| 67 | Ga0105250_10000120 | 3300009092 | Bacteria | 69464 |
| 68 | Ga0105250_10001119 | 3300009092 | Bacteria | 15115 |
| 69 | Ga0105250_10010602 | 3300009092 | Bacteria | 3839 |
| 70 | Ga0105250_10022042 | 3300009092 | Bacteria | 2570 |
| 71 | Ga0105240_10003869 | 3300009093 | Bacteria | 23131 |
| 72 | Ga0111539_10063881 | 3300009094 | Bacteria | 4356 |
| 73 | Ga0114129_10174704 | 3300009147 | Bacteria | 2926 |
| 74 | Ga0105243_10000135 | 3300009148 | Bacteria | 84432 |
| 75 | Ga0105243_10000587 | 3300009148 | Bacteria | 36543 |
| 76 | Ga0105243_10016186 | 3300009148 | Bacteria | 5641 |
| 77 | Ga0105243_10092697 | 3300009148 | Bacteria | 2491 |
| 78 | Ga0105243_10122002 | 3300009148 | Bacteria | 2199 |
| 79 | Ga0105242_10000314 | 3300009176 | Bacteria | 38796 |
| 80 | Ga0105242_10328341 | 3300009176 | Bacteria | 1406 |
| 81 | Ga0105248_10086220 | 3300009177 | Bacteria | 3533 |
| 82 | Ga0105237_10000391 | 3300009545 | Bacteria | 62410 |
| 83 | Ga0105238_10086397 | 3300009551 | Bacteria | 3124 |
| 84 | Ga0105249_10032513 | 3300009553 | Bacteria | 4720 |
| 85 | Ga0105239_10196713 | 3300010375 | Bacteria | 2258 |
| 86 | Ga0105246_10000239 | 3300011119 | Bacteria | 28228 |
| 87 | Ga0105246_10029271 | 3300011119 | Bacteria | 3626 |
| 88 | Ga0105246_10043926 | 3300011119 | Bacteria | 3034 |
| 89 | Ga0157345_1000249 | 3300012498 | Bacteria | 7686 |
| 90 | Ga0157373_10001617 | 3300013100 | Bacteria | 17202 |
| 91 | Ga0157373_10005283 | 3300013100 | Bacteria | 9696 |
| 92 | Ga0157373_10008815 | 3300013100 | Bacteria | 7472 |
| 93 | Ga0157371_10003122 | 3300013102 | Bacteria | 15314 |
| 94 | Ga0157371_10212306 | 3300013102 | Bacteria | 1389 |
| 95 | Ga0157370_10030390 | 3300013104 | Bacteria | 5294 |
| 96 | Ga0157370_10078478 | 3300013104 | Bacteria | 3109 |
| 97 | Ga0157370_10104320 | 3300013104 | Bacteria | 2654 |
| 98 | Ga0157369_10009720 | 3300013105 | Bacteria | 11000 |
| 99 | Ga0157369_10010109 | 3300013105 | Bacteria | 10768 |
| 100 | Ga0157369_10037314 | 3300013105 | Bacteria | 5320 |
| 101 | Ga0157369_10049351 | 3300013105 | Bacteria | 4563 |
| 102 | Ga0163162_10003597 | 3300013306 | Bacteria | 14840 |
| 103 | Ga0163162_10067695 | 3300013306 | Bacteria | 3621 |
| 104 | Ga0163162_10098762 | 3300013306 | Bacteria | 3009 |
| 105 | Ga0163162_10393868 | 3300013306 | Bacteria | 1518 |
| 106 | Ga0157372_10004984 | 3300013307 | Bacteria | 14110 |
| 107 | Ga0157375_10002219 | 3300013308 | Bacteria | 16809 |
| 108 | Ga0157375_10426513 | 3300013308 | Bacteria | 1492 |
| 109 | Ga0157380_10084066 | 3300014326 | Bacteria | 2609 |
| 110 | Ga0182008_10000092 | 3300014497 | Bacteria | 68381 |
| 111 | Ga0182008_10004811 | 3300014497 | Bacteria | 7809 |
| 112 | Ga0182008_10005677 | 3300014497 | Bacteria | 7066 |
| 113 | Ga0182008_10005922 | 3300014497 | Bacteria | 6899 |
| 114 | Ga0182008_10029786 | 3300014497 | Bacteria | 2755 |
| 115 | Ga0182006_1000920 | 3300015261 | Bacteria | 19652 |
| 116 | Ga0182006_1002031 | 3300015261 | Bacteria | 11356 |
| 117 | Ga0182006_1006929 | 3300015261 | Bacteria | 5219 |
| 118 | Ga0182007_10000477 | 3300015262 | Bacteria | 24113 |
| 119 | Ga0182007_10000786 | 3300015262 | Bacteria | 17736 |
| 120 | Ga0182007_10027204 | 3300015262 | Bacteria | 1974 |
| 121 | Ga0182005_1000604 | 3300015265 | Bacteria | 17458 |
| 122 | Ga0182005_1001126 | 3300015265 | Bacteria | 11166 |
| 123 | Ga0182005_1027100 | 3300015265 | Bacteria | 1563 |
| 124 | Ga0182005_1027101 | 3300015265 | Bacteria | 1563 |
| 125 | Ga0163161_10006936 | 3300017792 | Bacteria | 7832 |
| 126 | Ga0163161_10064610 | 3300017792 | Bacteria | 2670 |
| 127 | Ga0213876_10009936 | 3300021384 | Bacteria | 5114 |
| 128 | Ga0209760_100108 | 3300025207 | Bacteria | 59315 |
| 129 | Ga0209563_100826 | 3300025230 | Bacteria | 9245 |
| 130 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 131 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 132 | Ga0209233_1000059 | 3300025261 | Bacteria | 414562 |
| 133 | Ga0209675_1003084 | 3300025291 | Bacteria | 8148 |
| 134 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 135 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 136 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 137 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 138 | Ga0209050_1000242 | 3300025298 | Bacteria | 118006 |
| 139 | Ga0209050_1000317 | 3300025298 | Bacteria | 98196 |
| 140 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 141 | Ga0209051_1000006 | 3300025303 | Bacteria | 1015785 |
| 142 | Ga0209051_1000218 | 3300025303 | Bacteria | 97013 |
| 143 | Ga0209257_1000167 | 3300025304 | Bacteria | 171342 |
| 144 | Ga0207656_10000020 | 3300025321 | Bacteria | 114666 |
| 145 | Ga0207696_1000052 | 3300025711 | Bacteria | 272880 |
| 146 | Ga0207696_1000147 | 3300025711 | Bacteria | 120603 |
| 147 | Ga0207696_1002556 | 3300025711 | Bacteria | 8856 |
| 148 | Ga0207696_1003391 | 3300025711 | Bacteria | 7287 |
| 149 | Ga0207655_1000333 | 3300025728 | Bacteria | 68997 |
| 150 | Ga0207655_1000409 | 3300025728 | Bacteria | 59139 |
| 151 | Ga0207655_1003745 | 3300025728 | Bacteria | 11159 |
| 152 | Ga0207655_1004101 | 3300025728 | Bacteria | 10480 |
| 153 | Ga0207655_1004345 | 3300025728 | Bacteria | 10093 |
| 154 | Ga0207655_1009742 | 3300025728 | Bacteria | 5925 |
| 155 | Ga0207655_1032993 | 3300025728 | Bacteria | 2356 |
| 156 | Ga0207713_1000453 | 3300025735 | Bacteria | 42968 |
| 157 | Ga0207713_1001189 | 3300025735 | Bacteria | 21888 |
| 158 | Ga0207713_1001663 | 3300025735 | Bacteria | 17230 |
| 159 | Ga0207713_1002292 | 3300025735 | Bacteria | 14087 |
| 160 | Ga0207713_1002467 | 3300025735 | Bacteria | 13449 |
| 161 | Ga0207713_1007482 | 3300025735 | Bacteria | 6436 |
| 162 | Ga0207713_1024048 | 3300025735 | Bacteria | 2850 |
| 163 | Ga0207707_10235724 | 3300025912 | Bacteria | 1592 |
| 164 | Ga0207671_10000356 | 3300025914 | Bacteria | 65770 |
| 165 | Ga0207649_10000020 | 3300025920 | Bacteria | 211018 |
| 166 | Ga0207652_10059071 | 3300025921 | Bacteria | 3305 |
| 167 | Ga0207681_10000119 | 3300025923 | Bacteria | 66476 |
| 168 | Ga0207694_10050584 | 3300025924 | Bacteria | 3219 |
| 169 | Ga0207650_10000225 | 3300025925 | Bacteria | 63430 |
| 170 | Ga0207664_10104985 | 3300025929 | Bacteria | 2340 |
| 171 | Ga0207706_10000855 | 3300025933 | Bacteria | 31362 |
| 172 | Ga0207706_10003236 | 3300025933 | Bacteria | 15610 |
| 173 | Ga0207686_10000917 | 3300025934 | Bacteria | 17660 |
| 174 | Ga0207686_10233565 | 3300025934 | Bacteria | 1335 |
| 175 | Ga0207686_10533718 | 3300025934 | Bacteria | 915 |
| 176 | Ga0207709_10000014 | 3300025935 | Bacteria | 526302 |
| 177 | Ga0207709_10000251 | 3300025935 | Bacteria | 64622 |
| 178 | Ga0207709_10009313 | 3300025935 | Bacteria | 5407 |
| 179 | Ga0207709_10016757 | 3300025935 | Bacteria | 4079 |
| 180 | Ga0207709_10036347 | 3300025935 | Bacteria | 2919 |
| 181 | Ga0207679_10000023 | 3300025945 | Bacteria | 208356 |
| 182 | Ga0207712_10017913 | 3300025961 | Bacteria | 4608 |
| 183 | Ga0207640_10008460 | 3300025981 | Bacteria | 5717 |
| 184 | Ga0207639_10000002 | 3300026041 | Bacteria | 903066 |
| 185 | Ga0207639_10052357 | 3300026041 | Bacteria | 3111 |
| 186 | Ga0207639_10254228 | 3300026041 | Bacteria | 1534 |
| 187 | Ga0207674_10047145 | 3300026116 | Bacteria | 4420 |
| 188 | Ga0209281_1000368 | 3300027111 | Bacteria | 73062 |
| 189 | Ga0209281_1031951 | 3300027111 | Bacteria | 935 |
| 190 | Ga0209389_1000114 | 3300027296 | Bacteria | 72204 |
| 191 | Ga0209371_1000023 | 3300027312 | Bacteria | 519553 |
| 192 | Ga0207428_10019494 | 3300027907 | Bacteria | 5781 |
| 193 | Ga0268266_10012761 | 3300028379 | Bacteria | 7260 |
| 194 | Ga0268266_10129392 | 3300028379 | Bacteria | 2256 |
| 195 | Ga0307515_10059818 | 3300028794 | Bacteria | 5451 |
| 196 | Ga0265338_10008353 | 3300028800 | Bacteria | 12589 |
| 197 | Ga0268256_1000023 | 3300030500 | Bacteria | 519631 |
| 198 | Ga0307511_10164558 | 3300030521 | Bacteria | 1235 |
| 199 | Ga0265325_10036823 | 3300031241 | Bacteria | 2590 |
| 200 | Ga0265327_10014199 | 3300031251 | Bacteria | 5224 |
| 201 | Ga0265316_10023106 | 3300031344 | Bacteria | 5228 |
| 202 | Ga0307513_10000667 | 3300031456 | Bacteria | 49266 |
| 203 | Ga0307513_10012235 | 3300031456 | Bacteria | 10608 |
| 204 | Ga0307408_100000265 | 3300031548 | Bacteria | 53136 |
| 205 | Ga0316579_10001052 | 3300031691 | Bacteria | 9747 |
| 206 | Ga0316576_10024632 | 3300031727 | Bacteria | 4203 |
| 207 | Ga0316576_10186480 | 3300031727 | Unclassified | 1564 |
| 208 | Ga0316578_10012455 | 3300031728 | Bacteria | 4485 |
| 209 | Ga0307516_10261193 | 3300031730 | Bacteria | 1422 |
| 210 | Ga0307405_10000084 | 3300031731 | Bacteria | 39538 |
| 211 | Ga0307405_10000126 | 3300031731 | Bacteria | 30203 |
| 212 | Ga0307405_10000151 | 3300031731 | Bacteria | 26435 |
| 213 | Ga0307405_10001787 | 3300031731 | Bacteria | 9193 |
| 214 | Ga0316577_10180111 | 3300031733 | Bacteria | 1193 |
| 215 | Ga0307412_10000132 | 3300031911 | Bacteria | 54263 |
| 216 | Ga0307412_10011956 | 3300031911 | Bacteria | 5043 |
| 217 | Ga0307412_10154643 | 3300031911 | Bacteria | 1696 |
| 218 | Ga0307412_10400298 | 3300031911 | Bacteria | 1117 |
| 219 | Ga0307510_10017621 | 3300033180 | Bacteria | 8418 |
| 220 | Ga0373951_0003422 | 3300035091 | Bacteria | 3852 |
| 221 | Ga0373945_0110523 | 3300035116 | Bacteria | 1084 |
| 222 | Ga0373943_0041918 | 3300035170 | Bacteria | 2216 |
| 223 | Ga0373955_0010297 | 3300035172 | Bacteria | 4411 |
| 224 | Ga0316574_0032201 | 3300035398 | Bacteria | 3185 |
| 225 | Ga0373937_0381928 | 3300036401 | Bacteria | 1336 |
| 226 | Ga0316582_0064155 | 3300036647 | Unclassified | 2362 |
| 227 | Ga0316584_0016160 | 3300036712 | Bacteria | 5347 |
| 228 | Ga0316584_0026596 | 3300036712 | Bacteria | 4253 |
| 229 | Ga0316584_0371008 | 3300036712 | Bacteria | 1024 |
| 230 | Ga0373925_0764102 | 3300037068 | Bacteria | 797 |
| 231 | Ga0395900_0279749 | 3300037418 | Bacteria | 1661 |
| 232 | Ga0395898_0696345 | 3300037466 | Bacteria | 958 |
| 233 | Ga0395905_0000075 | 3300037471 | Bacteria | 165791 |
| 234 | Ga0395905_0094769 | 3300037471 | Bacteria | 2800 |
| 235 | Ga0237819_02360 | 3300038705 | Bacteria | 3852 |
| 236 | Ga0436365_0605876 | 3300039437 | Bacteria | 6932 |
| 237 | Ga0436361_0601543 | 3300039447 | Bacteria | 3484 |
| 238 | Ga0439436_0000257 | 3300041404 | Bacteria | 12717 |
| 239 | Ga0439438_002827 | 3300041405 | Bacteria | 7247 |
| 240 | Ga0439447_009963 | 3300041407 | Bacteria | 2847 |
| 241 | Ga0439447_015270 | 3300041407 | Bacteria | 2134 |
| 242 | Ga0439447_031136 | 3300041407 | Bacteria | 1340 |
| 243 | Ga0439466_0000026 | 3300041411 | Bacteria | 78192 |
| 244 | Ga0439466_0000405 | 3300041411 | Bacteria | 16402 |
| 245 | Ga0439432_000024 | 3300042006 | Bacteria | 50681 |
| 246 | Ga0439432_000067 | 3300042006 | Bacteria | 32538 |
| 247 | Ga0439432_000831 | 3300042006 | Bacteria | 11528 |
| 248 | Ga0439451_000030 | 3300042009 | Bacteria | 28884 |
| 249 | Ga0439452_000482 | 3300042010 | Bacteria | 22231 |
| 250 | Ga0439456_020561 | 3300042013 | Bacteria | 1393 |
| 251 | Ga0439463_000073 | 3300042016 | Bacteria | 22854 |
| 252 | Ga0439463_000457 | 3300042016 | Bacteria | 11378 |
| 253 | Ga0450923_021625 | 3300042125 | Bacteria | 1255 |
| 254 | Ga0439446_0004554 | 3300042156 | Bacteria | 3514 |
| 255 | Ga0439434_0000133 | 3300042435 | Bacteria | 19714 |
| 256 | Ga0451577_0162781 | 3300042876 | Bacteria | 2010 |
| 257 | Ga0451577_0297749 | 3300042876 | Bacteria | 1462 |
| 258 | Ga0451577_0298616 | 3300042876 | Bacteria | 1459 |
| 259 | Ga0451577_0346900 | 3300042876 | Bacteria | 1347 |
| 260 | Ga0451577_0407886 | 3300042876 | Bacteria | 1233 |
| 261 | Ga0451577_0414124 | 3300042876 | Bacteria | 1223 |
| 262 | Ga0451577_0759835 | 3300042876 | Bacteria | 877 |
| 263 | Ga0439440_0004516 | 3300042993 | Bacteria | 2733 |
| 264 | Ga0466988_0156021 | 3300044536 | Bacteria | 1327 |
| 265 | Ga0466969_0000348 | 3300044656 | Bacteria | 25379 |
| 266 | Ga0453683_0000114 | 3300044673 | Bacteria | 119864 |
| 267 | Ga0466966_0014941 | 3300044684 | Bacteria | 5138 |
| 268 | Ga0466961_0003582 | 3300044693 | Bacteria | 9685 |
| 269 | Ga0466963_0141753 | 3300044694 | Bacteria | 1665 |
| 270 | Ga0453684_0007772 | 3300044712 | Bacteria | 19566 |
| 271 | Ga0453684_0293268 | 3300044712 | Bacteria | 1851 |
| 272 | Ga0453684_1184021 | 3300044712 | Bacteria | 803 |
| 273 | Ga0453684_1481894 | 3300044712 | Bacteria | 701 |
| 274 | Ga0466971_0013084 | 3300044719 | Bacteria | 3639 |
| 275 | Ga0451576_0000151 | 3300045051 | Bacteria | 176466 |
| 276 | Ga0451576_0004207 | 3300045051 | Bacteria | 18930 |
| 277 | Ga0495617_006624 | 3300046452 | Bacteria | 4052 |
| 278 | Ga0495617_022351 | 3300046452 | Bacteria | 2137 |
| 279 | Ga0495617_054409 | 3300046452 | Bacteria | 1328 |
| 280 | Ga0495627_000010 | 3300046453 | Bacteria | 381168 |
| 281 | Ga0495627_000137 | 3300046453 | Bacteria | 87495 |
| 282 | Ga0495627_001498 | 3300046453 | Bacteria | 13495 |
| 283 | Ga0495627_004025 | 3300046453 | Bacteria | 6270 |
| 284 | Ga0495627_004564 | 3300046453 | Bacteria | 5759 |
| 285 | Ga0495627_006204 | 3300046453 | Bacteria | 4708 |
| 286 | Ga0495592_0187357 | 3300046454 | Bacteria | 1405 |
| 287 | Ga0495603_0016844 | 3300046455 | Bacteria | 4422 |
| 288 | Ga0495603_0039511 | 3300046455 | Bacteria | 2826 |
| 289 | Ga0495591_000163 | 3300046458 | Bacteria | 71039 |
| 290 | Ga0495591_000975 | 3300046458 | Bacteria | 19539 |
| 291 | Ga0495591_001553 | 3300046458 | Bacteria | 14008 |
| 292 | Ga0495591_001986 | 3300046458 | Bacteria | 11929 |
| 293 | Ga0495591_002129 | 3300046458 | Bacteria | 11376 |
| 294 | Ga0495591_007858 | 3300046458 | Bacteria | 4456 |
| 295 | Ga0495591_017563 | 3300046458 | Bacteria | 2453 |
| 296 | Ga0495638_0001429 | 3300046460 | Bacteria | 21654 |
| 297 | Ga0495638_0003116 | 3300046460 | Bacteria | 13136 |
| 298 | Ga0495638_0014481 | 3300046460 | Bacteria | 5327 |
| 299 | Ga0495638_0029181 | 3300046460 | Bacteria | 3557 |
| 300 | Ga0495638_0041357 | 3300046460 | Bacteria | 2916 |
| 301 | Ga0495653_0000110 | 3300046463 | Bacteria | 68799 |
| 302 | Ga0495653_0268167 | 3300046463 | Bacteria | 1125 |
| 303 | Ga0495650_0005492 | 3300046471 | Bacteria | 8200 |
| 304 | Ga0495650_0017624 | 3300046471 | Bacteria | 3575 |
| 305 | Ga0495650_0070269 | 3300046471 | Bacteria | 1375 |
| 306 | Ga0495580_0002981 | 3300046472 | Bacteria | 14525 |
| 307 | Ga0495582_0016926 | 3300046473 | Bacteria | 3992 |
| 308 | Ga0495605_0000001 | 3300046474 | Bacteria | 614538 |
| 309 | Ga0495605_0000324 | 3300046474 | Bacteria | 49042 |
| 310 | Ga0495605_0007188 | 3300046474 | Bacteria | 6332 |
| 311 | Ga0495605_0022426 | 3300046474 | Bacteria | 3334 |
| 312 | Ga0495639_0001252 | 3300046475 | Bacteria | 11445 |
| 313 | Ga0495639_0111950 | 3300046475 | Bacteria | 1296 |
| 314 | Ga0495664_0002038 | 3300046477 | Bacteria | 10801 |
| 315 | Ga0495664_0305090 | 3300046477 | Bacteria | 961 |
| 316 | Ga0495584_0001304 | 3300046491 | Bacteria | 15175 |
| 317 | Ga0495584_0072103 | 3300046491 | Bacteria | 1735 |
| 318 | Ga0495585_0000283 | 3300046492 | Bacteria | 50893 |
| 319 | Ga0495585_0006867 | 3300046492 | Bacteria | 7016 |
| 320 | Ga0495585_0011854 | 3300046492 | Bacteria | 5150 |
| 321 | Ga0495585_0057474 | 3300046492 | Bacteria | 2146 |
| 322 | Ga0495596_0022516 | 3300046500 | Bacteria | 2564 |
| 323 | Ga0495607_0000066 | 3300046501 | Bacteria | 103573 |
| 324 | Ga0495607_0000094 | 3300046501 | Bacteria | 92515 |
| 325 | Ga0495607_0000391 | 3300046501 | Bacteria | 44683 |
| 326 | Ga0495607_0001397 | 3300046501 | Bacteria | 21475 |
| 327 | Ga0495607_0001852 | 3300046501 | Bacteria | 17971 |
| 328 | Ga0495607_0009143 | 3300046501 | Bacteria | 6735 |
| 329 | Ga0495607_0013393 | 3300046501 | Bacteria | 5375 |
| 330 | Ga0495607_0014374 | 3300046501 | Bacteria | 5156 |
| 331 | Ga0495607_0016645 | 3300046501 | Bacteria | 4741 |
| 332 | Ga0495607_0018619 | 3300046501 | Bacteria | 4423 |
| 333 | Ga0495607_0039552 | 3300046501 | Bacteria | 2816 |
| 334 | Ga0495607_0072518 | 3300046501 | Bacteria | 1917 |
| 335 | Ga0495607_0296405 | 3300046501 | Bacteria | 762 |
| 336 | Ga0495583_0000611 | 3300046506 | Bacteria | 48395 |
| 337 | Ga0495583_0000778 | 3300046506 | Bacteria | 39897 |
| 338 | Ga0495606_0000421 | 3300046507 | Bacteria | 70842 |
| 339 | Ga0495606_0005295 | 3300046507 | Bacteria | 12427 |
| 340 | Ga0495606_0006865 | 3300046507 | Bacteria | 10384 |
| 341 | Ga0495606_0015567 | 3300046507 | Bacteria | 5851 |
| 342 | Ga0495606_0019528 | 3300046507 | Bacteria | 5036 |
| 343 | Ga0495606_0026643 | 3300046507 | Bacteria | 4117 |
| 344 | Ga0495606_0028625 | 3300046507 | Bacteria | 3926 |
| 345 | Ga0495606_0081415 | 3300046507 | Bacteria | 2012 |
| 346 | Ga0495608_0146181 | 3300046511 | Bacteria | 1508 |
| 347 | Ga0495610_0000644 | 3300046512 | Bacteria | 34165 |
| 348 | Ga0495610_0002650 | 3300046512 | Bacteria | 14785 |
| 349 | Ga0495610_0038069 | 3300046512 | Bacteria | 2443 |
| 350 | Ga0495610_0047155 | 3300046512 | Bacteria | 2121 |
| 351 | Ga0495610_0059027 | 3300046512 | Bacteria | 1832 |
| 352 | Ga0495616_0004820 | 3300046513 | Bacteria | 8452 |
| 353 | Ga0495616_0004858 | 3300046513 | Bacteria | 8411 |
| 354 | Ga0495616_0008984 | 3300046513 | Bacteria | 5868 |
| 355 | Ga0495616_0010017 | 3300046513 | Bacteria | 5505 |
| 356 | Ga0495616_0017609 | 3300046513 | Bacteria | 3938 |
| 357 | Ga0495618_0018455 | 3300046514 | Bacteria | 4282 |
| 358 | Ga0495618_0062853 | 3300046514 | Bacteria | 2356 |
| 359 | Ga0495620_0000242 | 3300046515 | Bacteria | 40695 |
| 360 | Ga0495620_0016449 | 3300046515 | Bacteria | 3710 |
| 361 | Ga0495620_0019057 | 3300046515 | Bacteria | 3385 |
| 362 | Ga0495620_0030056 | 3300046515 | Bacteria | 2506 |
| 363 | Ga0495628_0016953 | 3300046516 | Bacteria | 6069 |
| 364 | Ga0495628_0022294 | 3300046516 | Bacteria | 5203 |
| 365 | Ga0495630_0041985 | 3300046517 | Bacteria | 3416 |
| 366 | Ga0495631_0003453 | 3300046518 | Bacteria | 8646 |
| 367 | Ga0495631_0003954 | 3300046518 | Bacteria | 8002 |
| 368 | Ga0495631_0005013 | 3300046518 | Bacteria | 6975 |
| 369 | Ga0495632_0002747 | 3300046519 | Bacteria | 13065 |
| 370 | Ga0495632_0008701 | 3300046519 | Bacteria | 6192 |
| 371 | Ga0495632_0018143 | 3300046519 | Bacteria | 3867 |
| 372 | Ga0495632_0058262 | 3300046519 | Bacteria | 1883 |
| 373 | Ga0495637_0001790 | 3300046520 | Bacteria | 12300 |
| 374 | Ga0495637_0002035 | 3300046520 | Bacteria | 11394 |
| 375 | Ga0495637_0003556 | 3300046520 | Bacteria | 8260 |
| 376 | Ga0495637_0010237 | 3300046520 | Bacteria | 4541 |
| 377 | Ga0495637_0013928 | 3300046520 | Bacteria | 3806 |
| 378 | Ga0495637_0050087 | 3300046520 | Bacteria | 1752 |
| 379 | Ga0495637_0056271 | 3300046520 | Bacteria | 1628 |
| 380 | Ga0495637_0063902 | 3300046520 | Bacteria | 1503 |
| 381 | Ga0495643_0011083 | 3300046522 | Bacteria | 5509 |
| 382 | Ga0495643_0067390 | 3300046522 | Bacteria | 1886 |
| 383 | Ga0495644_0004529 | 3300046523 | Bacteria | 5459 |
| 384 | Ga0495648_0006976 | 3300046524 | Bacteria | 9111 |
| 385 | Ga0495648_0013697 | 3300046524 | Bacteria | 5979 |
| 386 | Ga0495648_0036764 | 3300046524 | Bacteria | 3153 |
| 387 | Ga0495648_0109968 | 3300046524 | Bacteria | 1501 |
| 388 | Ga0495652_0105911 | 3300046529 | Bacteria | 2271 |
| 389 | Ga0495654_0000137 | 3300046530 | Bacteria | 76186 |
| 390 | Ga0495654_0001197 | 3300046530 | Bacteria | 18448 |
| 391 | Ga0495654_0003840 | 3300046530 | Bacteria | 9082 |
| 392 | Ga0495654_0007592 | 3300046530 | Bacteria | 6042 |
| 393 | Ga0495654_0014855 | 3300046530 | Bacteria | 4138 |
| 394 | Ga0495654_0026131 | 3300046530 | Bacteria | 3004 |
| 395 | Ga0495654_0035730 | 3300046530 | Bacteria | 2499 |
| 396 | Ga0495654_0050606 | 3300046530 | Bacteria | 2029 |
| 397 | Ga0495654_0128661 | 3300046530 | Bacteria | 1139 |
| 398 | Ga0495665_0036639 | 3300046531 | Bacteria | 2618 |
| 399 | Ga0495640_0067498 | 3300046533 | Bacteria | 2408 |
| 400 | Ga0495586_0047412 | 3300046535 | Bacteria | 2319 |
| 401 | Ga0495587_0036651 | 3300046536 | Bacteria | 2949 |
| 402 | Ga0495609_0007641 | 3300046538 | Bacteria | 5371 |
| 403 | Ga0495609_0007717 | 3300046538 | Bacteria | 5336 |
| 404 | Ga0495609_0013695 | 3300046538 | Bacteria | 3826 |
| 405 | Ga0495609_0030273 | 3300046538 | Bacteria | 2463 |
| 406 | Ga0495609_0107756 | 3300046538 | Bacteria | 1204 |
| 407 | Ga0495597_0000008 | 3300046542 | Bacteria | 232976 |
| 408 | Ga0495622_0002337 | 3300046557 | Bacteria | 9230 |
| 409 | Ga0495622_0126077 | 3300046557 | Bacteria | 1167 |
| 410 | Ga0495633_0013961 | 3300046558 | Bacteria | 4212 |
| 411 | Ga0495668_0007713 | 3300046616 | Bacteria | 6839 |
| 412 | Ga0495668_0012004 | 3300046616 | Bacteria | 5156 |
| 413 | Ga0495634_0045399 | 3300046642 | Bacteria | 2970 |
| 414 | Ga0495611_0001236 | 3300046648 | Bacteria | 13151 |
| 415 | Ga0495611_0201691 | 3300046648 | Bacteria | 927 |
| 416 | Ga0495625_0009513 | 3300046660 | Bacteria | 8119 |
| 417 | Ga0495625_0025532 | 3300046660 | Bacteria | 4479 |
| 418 | Ga0495625_0026892 | 3300046660 | Bacteria | 4338 |
| 419 | Ga0495625_0094194 | 3300046660 | Bacteria | 2067 |
| 420 | Ga0495635_0048412 | 3300046663 | Bacteria | 2930 |
| 421 | Ga0495635_0112572 | 3300046663 | Bacteria | 1859 |
| 422 | Ga0495661_0000013 | 3300046665 | Bacteria | 259387 |
| 423 | Ga0495661_0000503 | 3300046665 | Bacteria | 40790 |
| 424 | Ga0495661_0000977 | 3300046665 | Bacteria | 25842 |
| 425 | Ga0495661_0021526 | 3300046665 | Bacteria | 4203 |
| 426 | Ga0495661_0026481 | 3300046665 | Bacteria | 3735 |
| 427 | Ga0495588_0126974 | 3300046674 | Bacteria | 1345 |
| 428 | Ga0495599_0020830 | 3300046678 | Bacteria | 4086 |
| 429 | Ga0495613_0126184 | 3300046689 | Bacteria | 1835 |
| 430 | Ga0495624_0001949 | 3300046690 | Bacteria | 15699 |
| 431 | Ga0495624_0006092 | 3300046690 | Bacteria | 8593 |
| 432 | Ga0495670_0002982 | 3300046691 | Bacteria | 8343 |
| 433 | Ga0495671_0001003 | 3300046692 | Bacteria | 19655 |
| 434 | Ga0495671_0011250 | 3300046692 | Bacteria | 4934 |
| 435 | Ga0495671_0017339 | 3300046692 | Bacteria | 3834 |
| 436 | Ga0495671_0024305 | 3300046692 | Bacteria | 3156 |
| 437 | Ga0495671_0027335 | 3300046692 | Bacteria | 2947 |
| 438 | Ga0495671_0064665 | 3300046692 | Bacteria | 1800 |
| 439 | Ga0495649_0000205 | 3300046694 | Bacteria | 52102 |
| 440 | Ga0495649_0001249 | 3300046694 | Bacteria | 19572 |
| 441 | Ga0495649_0011541 | 3300046694 | Bacteria | 5176 |
| 442 | Ga0495649_0027832 | 3300046694 | Bacteria | 3134 |
| 443 | Ga0495649_0062763 | 3300046694 | Bacteria | 1997 |
| 444 | Ga0495589_0000318 | 3300046794 | Bacteria | 38201 |
| 445 | Ga0495589_0010769 | 3300046794 | Bacteria | 4753 |
| 446 | Ga0495589_0025458 | 3300046794 | Bacteria | 3002 |
| 447 | Ga0495589_0044039 | 3300046794 | Bacteria | 2220 |
| 448 | Ga0495589_0127724 | 3300046794 | Bacteria | 1222 |
| 449 | Ga0495600_0191635 | 3300046809 | Bacteria | 1314 |
| 450 | Ga0495660_0000142 | 3300046810 | Bacteria | 77290 |
| 451 | Ga0495660_0000528 | 3300046810 | Bacteria | 31279 |
| 452 | Ga0495660_0001037 | 3300046810 | Bacteria | 20156 |
| 453 | Ga0495660_0019958 | 3300046810 | Bacteria | 3843 |
| 454 | Ga0495660_0024615 | 3300046810 | Bacteria | 3428 |
| 455 | Ga0495660_0052402 | 3300046810 | Bacteria | 2216 |
| 456 | Ga0495581_0048251 | 3300047315 | Bacteria | 2459 |
| 457 | Ga0495604_0048411 | 3300047317 | Bacteria | 3306 |
| 458 | Ga0495674_0115527 | 3300047319 | Bacteria | 2271 |
| 459 | Ga0495672_0002987 | 3300047320 | Bacteria | 14881 |
| 460 | Ga0495672_0004835 | 3300047320 | Bacteria | 10855 |
| 461 | Ga0495672_0011316 | 3300047320 | Bacteria | 6305 |
| 462 | Ga0495672_0014008 | 3300047320 | Bacteria | 5510 |
| 463 | Ga0495672_0041233 | 3300047320 | Bacteria | 2793 |
| 464 | Ga0495672_0047982 | 3300047320 | Bacteria | 2536 |
| 465 | Ga0495672_0261835 | 3300047320 | Bacteria | 834 |
| 466 | Ga0495676_0003671 | 3300047321 | Bacteria | 13926 |
| 467 | Ga0495676_0014550 | 3300047321 | Bacteria | 7038 |
| 468 | Ga0495680_0017125 | 3300047322 | Bacteria | 6201 |
| 469 | Ga0495680_0041178 | 3300047322 | Bacteria | 3674 |
| 470 | Ga0495680_0098278 | 3300047322 | Bacteria | 2185 |
| 471 | Ga0495683_0005772 | 3300047323 | Bacteria | 6819 |
| 472 | Ga0495683_0016186 | 3300047323 | Bacteria | 3873 |
| 473 | Ga0495687_010472 | 3300047443 | Bacteria | 5084 |
| 474 | Ga0495679_000372 | 3300047446 | Bacteria | 34335 |
| 475 | Ga0495679_001766 | 3300047446 | Bacteria | 11852 |
| 476 | Ga0495679_004120 | 3300047446 | Bacteria | 6791 |
| 477 | Ga0495679_013938 | 3300047446 | Bacteria | 2997 |
| 478 | Ga0495679_015872 | 3300047446 | Bacteria | 2738 |
| 479 | Ga0495673_0005503 | 3300047469 | Bacteria | 7645 |
| 480 | Ga0495673_0006518 | 3300047469 | Bacteria | 6849 |
| 481 | Ga0495673_0011071 | 3300047469 | Bacteria | 4874 |
| 482 | Ga0495673_0184386 | 3300047469 | Bacteria | 788 |
| 483 | Ga0495681_0000329 | 3300047470 | Bacteria | 37635 |
| 484 | Ga0495681_0003223 | 3300047470 | Bacteria | 11386 |
| 485 | Ga0495681_0005528 | 3300047470 | Bacteria | 8443 |
| 486 | Ga0495681_0008962 | 3300047470 | Bacteria | 6210 |
| 487 | Ga0495681_0011670 | 3300047470 | Bacteria | 5214 |
| 488 | Ga0495681_0013305 | 3300047470 | Bacteria | 4782 |
| 489 | Ga0495681_0023485 | 3300047470 | Bacteria | 3274 |
| 490 | Ga0495681_0092780 | 3300047470 | Bacteria | 1330 |
| 491 | Ga0495686_0010032 | 3300047472 | Bacteria | 6765 |
| 492 | Ga0495686_0056916 | 3300047472 | Bacteria | 2441 |
| 493 | Ga0495686_0269347 | 3300047472 | Bacteria | 950 |
| 494 | Ga0495593_0001599 | 3300047673 | Bacteria | 13382 |
| 495 | Ga0495593_0020673 | 3300047673 | Bacteria | 3683 |
| 496 | Ga0495602_0034419 | 3300048088 | Bacteria | 4739 |
| 497 | Ga0495626_0004692 | 3300048091 | Bacteria | 8286 |
| 498 | Ga0495626_0007255 | 3300048091 | Bacteria | 6187 |
| 499 | Ga0495626_0022508 | 3300048091 | Bacteria | 3110 |
| 500 | Ga0496116_0000318 | 3300048919 | Bacteria | 79091 |
| 501 | Ga0496116_0003624 | 3300048919 | Bacteria | 15181 |
| 502 | Ga0496116_0011989 | 3300048919 | Bacteria | 7117 |
| 503 | Ga0496116_0014741 | 3300048919 | Bacteria | 6225 |
| 504 | Ga0496117_0000838 | 3300048920 | Bacteria | 47560 |
| 505 | Ga0496117_0000981 | 3300048920 | Bacteria | 43680 |
| 506 | Ga0496117_0020784 | 3300048920 | Bacteria | 5341 |
| 507 | Ga0496117_0118547 | 3300048920 | Bacteria | 1631 |
| 508 | Ga0496118_0010399 | 3300048921 | Bacteria | 9222 |
| 509 | Ga0496118_0036828 | 3300048921 | Bacteria | 3948 |
| 510 | Ga0496118_0042581 | 3300048921 | Bacteria | 3580 |
| 511 | Ga0496118_0042951 | 3300048921 | Bacteria | 3559 |
| 512 | Ga0496118_0058872 | 3300048921 | Bacteria | 2866 |
| 513 | Ga0496118_0278520 | 3300048921 | Bacteria | 932 |
| 514 | Ga0496119_0018764 | 3300048922 | Bacteria | 5130 |
| 515 | Ga0496119_0047252 | 3300048922 | Bacteria | 2679 |
| 516 | Ga0496120_0015063 | 3300048923 | Bacteria | 5116 |
| 517 | Ga0496120_0075948 | 3300048923 | Bacteria | 1832 |
| 518 | Ga0496121_0000463 | 3300048924 | Bacteria | 79640 |
| 519 | Ga0496121_0026911 | 3300048924 | Bacteria | 5398 |
| 520 | Ga0496121_0096575 | 3300048924 | Bacteria | 2292 |
| 521 | Ga0496121_0110830 | 3300048924 | Bacteria | 2094 |
| 522 | Ga0496122_0012229 | 3300048925 | Bacteria | 8582 |
| 523 | Ga0496122_0055546 | 3300048925 | Bacteria | 2961 |
| 524 | Ga0496122_0218830 | 3300048925 | Bacteria | 1095 |
| 525 | Ga0496123_0002822 | 3300048926 | Bacteria | 20585 |
| 526 | Ga0496123_0021112 | 3300048926 | Bacteria | 5071 |
| 527 | Ga0496123_0029837 | 3300048926 | Bacteria | 4004 |
| 528 | Ga0496123_0045582 | 3300048926 | Bacteria | 2985 |
| 529 | Ga0496123_0085236 | 3300048926 | Bacteria | 1901 |
| 530 | Ga0496124_0001258 | 3300048927 | Bacteria | 38669 |
| 531 | Ga0496124_0017104 | 3300048927 | Bacteria | 6855 |
| 532 | Ga0496124_0029852 | 3300048927 | Bacteria | 4850 |
| 533 | Ga0496124_0091167 | 3300048927 | Bacteria | 2484 |
| 534 | Ga0496124_0170579 | 3300048927 | Bacteria | 1685 |
| 535 | Ga0496125_0001178 | 3300048928 | Bacteria | 39572 |
| 536 | Ga0496125_0004482 | 3300048928 | Bacteria | 16087 |
| 537 | Ga0496125_0042987 | 3300048928 | Bacteria | 3841 |
| 538 | Ga0496125_0056206 | 3300048928 | Bacteria | 3198 |
| 539 | Ga0496125_0061733 | 3300048928 | Bacteria | 3003 |
| 540 | Ga0496125_0065148 | 3300048928 | Bacteria | 2889 |
| 541 | Ga0496125_0073480 | 3300048928 | Bacteria | 2658 |
| 542 | Ga0496125_0120158 | 3300048928 | Bacteria | 1877 |
| 543 | Ga0496126_0001092 | 3300048929 | Bacteria | 45620 |
| 544 | Ga0496126_0041933 | 3300048929 | Bacteria | 4231 |
| 545 | Ga0496126_0054646 | 3300048929 | Bacteria | 3615 |
| 546 | Ga0495678_002022 | 3300049459 | Bacteria | 14541 |
| 547 | Ga0495678_005389 | 3300049459 | Bacteria | 7075 |
| 548 | Ga0495678_005852 | 3300049459 | Bacteria | 6661 |
| 549 | Ga0495678_006693 | 3300049459 | Bacteria | 6082 |
| 550 | Ga0495678_041662 | 3300049459 | Bacteria | 1835 |
| 551 | Ga0495682_0001091 | 3300049460 | Bacteria | 15846 |
| 552 | Ga0501300_012846 | 3300049523 | Bacteria | 1221 |
| 553 | Ga0501031_0120135 | 3300049568 | Bacteria | 1717 |
| 554 | Ga0501034_0000164 | 3300049571 | Bacteria | 125152 |
| 555 | Ga0501034_0000430 | 3300049571 | Bacteria | 69762 |
| 556 | Ga0501034_0043921 | 3300049571 | Bacteria | 4520 |
| 557 | Ga0501038_0099730 | 3300049574 | Bacteria | 2421 |
| 558 | Ga0501079_0456844 | 3300049741 | Bacteria | 1003 |
| 559 | Ga0501081_0448005 | 3300049743 | Bacteria | 959 |
| 560 | Ga0501280_000259 | 3300049776 | Bacteria | 13340 |
| 561 | Ga0501282_000766 | 3300049778 | Bacteria | 3684 |
| 562 | Ga0501035_0353621 | 3300049822 | Bacteria | 1229 |
| 563 | nmdc:mga08y16_50221_c1 | 3300050511 | Bacteria | 4365 |
| 564 | Ga0495612_0063528 | 3300053078 | Bacteria | 1531 |
| 565 | Ga0500610_0017782 | 3300053079 | Bacteria | 3422 |
| 566 | Ga0500608_002755 | 3300053122 | Bacteria | 6472 |
| 567 | Ga0500655_023484 | 3300053133 | Bacteria | 1165 |
| 568 | Ga0500573_0002848 | 3300053140 | Bacteria | 8783 |
| 569 | Ga0500577_0138633 | 3300053142 | Bacteria | 1024 |
| 570 | Ga0500619_000105 | 3300053154 | Bacteria | 22703 |
| 571 | Ga0500634_0000099 | 3300053161 | Bacteria | 33876 |
| 572 | Ga0500637_0194736 | 3300053178 | Bacteria | 1157 |
| 573 | Ga0500661_021735 | 3300055283 | Bacteria | 1139 |
| 574 | Ga0466962_0031844 | 3300061719 | Bacteria | 2525 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044536 | Ga0466988_0156021 | Ga0466988_0156021_12_608 | 176 |
| 2 | 3300005614 | Ga0068856_100038076 | Ga0068856_1000380762 | 197 |
| 3 | 3300009093 | Ga0105240_10003869 | Ga0105240_1000386917 | 197 |
| 4 | 3300013104 | Ga0157370_10078478 | Ga0157370_100784785 | 197 |
| 5 | 3300013105 | Ga0157369_10037314 | Ga0157369_100373145 | 197 |
| 6 | 3300044712 | Ga0453684_1481894 | Ga0453684_1481894_13_627 | 203 |
| 7 | 3300005467 | Ga0070706_100551512 | Ga0070706_1005515122 | 207 |
| 8 | 3300025912 | Ga0207707_10235724 | Ga0207707_102357242 | 207 |
| 9 | 3300044656 | Ga0466969_0000348 | Ga0466969_0000348_3742_4458 | 216 |
| 10 | 3300044684 | Ga0466966_0014941 | Ga0466966_0014941_3684_4400 | 216 |
| 11 | 3300044693 | Ga0466961_0003582 | Ga0466961_0003582_1467_2183 | 216 |
| 12 | 3300044694 | Ga0466963_0141753 | Ga0466963_0141753_488_1204 | 216 |
| 13 | 3300044719 | Ga0466971_0013084 | Ga0466971_0013084_352_1068 | 216 |
| 14 | 3300061719 | Ga0466962_0031844 | Ga0466962_0031844_722_1438 | 216 |
| 15 | iso_pu_bacteria | 2513020051 | 2513226751 | 218 |
| 16 | iso_pu_bacteria | 2599185214 | 2599621280 | 218 |
| 17 | iso_pu_bacteria | 2599185226 | 2599675299 | 218 |
| 18 | iso_pu_bacteria | 2599185227 | 2599678103 | 218 |
| 19 | iso_pu_bacteria | 2599185229 | 2599690791 | 218 |
| 20 | iso_pu_bacteria | 2738541277 | 2738718360 | 218 |
| 21 | iso_pu_bacteria | 2738543019 | 2739281547 | 218 |
| 22 | iso_pu_bacteria | 2885198086 | 2885201744 | 218 |
| 23 | iso_pu_bacteria | 2885198086 | 2885203175 | 218 |
| 24 | iso_pu_bacteria | 2885211737 | 2885215546 | 218 |
| 25 | iso_pu_bacteria | 2885211737 | 2885216428 | 218 |
| 26 | iso_pu_bacteria | 2511231006 | 2511264003 | 219 |
| 27 | iso_pu_bacteria | 2511231006 | 2511268155 | 219 |
| 28 | iso_pu_bacteria | 2511231007 | 2511273832 | 219 |
| 29 | iso_pu_bacteria | 2511231010 | 2511288207 | 219 |
| 30 | iso_pu_bacteria | 2511231011 | 2511298171 | 219 |
| 31 | iso_pu_bacteria | 2511231016 | 2511329016 | 219 |
| 32 | iso_pu_bacteria | 2511231023 | 2511370203 | 219 |
| 33 | iso_pu_bacteria | 2511231031 | 2511416389 | 219 |
| 34 | iso_pu_bacteria | 2512047018 | 2512323769 | 219 |
| 35 | iso_pu_bacteria | 2512047018 | 2512324533 | 219 |
| 36 | iso_pu_bacteria | 2554235341 | 2555672137 | 219 |
| 37 | iso_pu_bacteria | 2582580891 | 2583791973 | 219 |
| 38 | iso_pu_bacteria | 2582580891 | 2583794646 | 219 |
| 39 | iso_pu_bacteria | 2597489887 | 2597857996 | 219 |
| 40 | iso_pu_bacteria | 2597489887 | 2597860205 | 219 |
| 41 | iso_pu_bacteria | 2599185160 | 2599353696 | 219 |
| 42 | iso_pu_bacteria | 2599185161 | 2599360610 | 219 |
| 43 | iso_pu_bacteria | 2599185162 | 2599366932 | 219 |
| 44 | iso_pu_bacteria | 2599185163 | 2599373721 | 219 |
| 45 | iso_pu_bacteria | 2599185164 | 2599378804 | 219 |
| 46 | iso_pu_bacteria | 2599185165 | 2599386218 | 219 |
| 47 | iso_pu_bacteria | 2599185166 | 2599392580 | 219 |
| 48 | iso_pu_bacteria | 2599185167 | 2599397447 | 219 |
| 49 | iso_pu_bacteria | 2599185168 | 2599404346 | 219 |
| 50 | iso_pu_bacteria | 2599185179 | 2599449444 | 219 |
| 51 | iso_pu_bacteria | 2599185181 | 2599460530 | 219 |
| 52 | iso_pu_bacteria | 2599185182 | 2599470092 | 219 |
| 53 | iso_pu_bacteria | 2599185185 | 2599483048 | 219 |
| 54 | iso_pu_bacteria | 2599185185 | 2599485027 | 219 |
| 55 | iso_pu_bacteria | 2599185186 | 2599489551 | 219 |
| 56 | iso_pu_bacteria | 2599185190 | 2599510818 | 219 |
| 57 | iso_pu_bacteria | 2599185191 | 2599519692 | 219 |
| 58 | iso_pu_bacteria | 2599185257 | 2599802658 | 219 |
| 59 | iso_pu_bacteria | 2599185257 | 2599803232 | 219 |
| 60 | iso_pu_bacteria | 2599185288 | 2599883968 | 219 |
| 61 | iso_pu_bacteria | 2599185290 | 2599890192 | 219 |
| 62 | iso_pu_bacteria | 2599185303 | 2599950322 | 219 |
| 63 | iso_pu_bacteria | 2599185356 | 2600213142 | 219 |
| 64 | iso_pu_bacteria | 2600254931 | 2600366567 | 219 |
| 65 | iso_pu_bacteria | 2600254931 | 2600368389 | 219 |
| 66 | iso_pu_bacteria | 2600255313 | 2601773310 | 219 |
| 67 | iso_pu_bacteria | 2600255318 | 2601797239 | 219 |
| 68 | iso_pu_bacteria | 2603880185 | 2606076030 | 219 |
| 69 | iso_pu_bacteria | 2603880199 | 2606130681 | 219 |
| 70 | iso_pu_bacteria | 2619619299 | 2621301940 | 219 |
| 71 | iso_pu_bacteria | 2623620446 | 2624493070 | 219 |
| 72 | iso_pu_bacteria | 2643221589 | 2643954025 | 219 |
| 73 | iso_pu_bacteria | 2643221602 | 2644022051 | 219 |
| 74 | iso_pu_bacteria | 2667528171 | 2671096291 | 219 |
| 75 | iso_pu_bacteria | 2671180172 | 2671769722 | 219 |
| 76 | iso_pu_bacteria | 2671180172 | 2671771195 | 219 |
| 77 | iso_pu_bacteria | 2713897149 | 2715756033 | 219 |
| 78 | iso_pu_bacteria | 2728369097 | 2729147945 | 219 |
| 79 | iso_pu_bacteria | 2738541265 | 2738672374 | 219 |
| 80 | iso_pu_bacteria | 2738541282 | 2738750767 | 219 |
| 81 | iso_pu_bacteria | 2738541294 | 2738808720 | 219 |
| 82 | iso_pu_bacteria | 2738541303 | 2738859808 | 219 |
| 83 | iso_pu_bacteria | 2738541309 | 2738896080 | 219 |
| 84 | iso_pu_bacteria | 2738543025 | 2739313694 | 219 |
| 85 | iso_pu_bacteria | 2740892503 | 2743737462 | 219 |
| 86 | iso_pu_bacteria | 2740892503 | 2743739748 | 219 |
| 87 | iso_pu_bacteria | 2773857673 | 2774135101 | 219 |
| 88 | iso_pu_bacteria | 2784132063 | 2784265170 | 219 |
| 89 | iso_pu_bacteria | 2808606377 | 2808931725 | 219 |
| 90 | iso_pu_bacteria | 2808606381 | 2808953845 | 219 |
| 91 | iso_pu_bacteria | 2808606385 | 2808974794 | 219 |
| 92 | iso_pu_bacteria | 2808606388 | 2808991567 | 219 |
| 93 | iso_pu_bacteria | 2816332298 | 2817488664 | 219 |
| 94 | iso_pu_bacteria | 2818991456 | 2819657710 | 219 |
| 95 | iso_pu_bacteria | 2818991464 | 2819701383 | 219 |
| 96 | iso_pu_bacteria | 2834028612 | 2834028634 | 219 |
| 97 | iso_pu_bacteria | 2852612431 | 2852615997 | 219 |
| 98 | iso_pu_bacteria | 2852657418 | 2852659390 | 219 |
| 99 | iso_pu_bacteria | 2852667396 | 2852670965 | 219 |
| 100 | iso_pu_bacteria | 2878029506 | 2878033489 | 219 |
| 101 | iso_pu_bacteria | 2880230671 | 2880232790 | 219 |
| 102 | iso_pu_bacteria | 2904518522 | 2904520472 | 219 |
| 103 | iso_pu_bacteria | 2917070673 | 2917076013 | 219 |
| 104 | iso_pu_bacteria | 2919456309 | 2919461335 | 219 |
| 105 | iso_pu_bacteria | 2919697872 | 2919699656 | 219 |
| 106 | iso_pu_bacteria | 2923153595 | 2923156503 | 219 |
| 107 | iso_pu_bacteria | 2923153595 | 2923158836 | 219 |
| 108 | iso_pu_bacteria | 2931390751 | 2931391653 | 219 |
| 109 | iso_pu_bacteria | 2935353572 | 2935356984 | 219 |
| 110 | iso_pu_bacteria | 2945961074 | 2945961101 | 219 |
| 111 | iso_pu_bacteria | 2969304461 | 2969308252 | 219 |
| 112 | iso_pu_bacteria | 2984286254 | 2984287338 | 219 |
| 113 | iso_pu_bacteria | 2984286254 | 2984289559 | 219 |
| 114 | iso_pu_bacteria | 3007395558 | 3007395885 | 219 |
| 115 | iso_pu_bacteria | 3007395558 | 3007398465 | 219 |
| 116 | iso_pu_bacteria | 3007419365 | 3007423844 | 219 |
| 117 | iso_pu_bacteria | 3007718800 | 3007719690 | 219 |
| 118 | iso_pu_bacteria | 637000220 | 637322556 | 219 |
| 119 | iso_pu_bacteria | 651053060 | 651177410 | 219 |
| 120 | iso_pu_bacteria | 8015687852 | 8015690697 | 219 |
| 121 | iso_pu_bacteria | 8015687852 | 8015692921 | 219 |
| 122 | iso_pu_bacteria | 8019769354 | 8019773768 | 219 |
| 123 | iso_pu_bacteria | 8019775933 | 8019776073 | 219 |
| 124 | iso_pu_bacteria | 8054285046 | 8054289245 | 219 |
| 125 | iso_pu_bacteria | 8054503363 | 8054504242 | 219 |
| 126 | iso_pu_bacteria | 8055770955 | 8055773832 | 219 |
| 127 | iso_pu_bacteria | 8055770955 | 8055776168 | 219 |
| 128 | iso_pu_bacteria | 8055817908 | 8055818673 | 219 |
| 129 | iso_pu_bacteria | 8056172158 | 8056173648 | 219 |
| 130 | iso_pu_bacteria | 8056569372 | 8056573585 | 219 |
| 131 | iso_pu_bacteria | 8057798959 | 8057805019 | 219 |
| 132 | iso_pu_bacteria | 2554235132 | 2554814574 | 220 |
| 133 | iso_pu_bacteria | 2606217733 | 2608381958 | 220 |
| 134 | iso_pu_bacteria | 2643221713 | 2644623668 | 220 |
| 135 | iso_pu_bacteria | 2643221713 | 2644624622 | 220 |
| 136 | iso_pu_bacteria | 3007803356 | 3007806255 | 220 |
| 137 | 3300005457 | Ga0070662_100063661 | Ga0070662_1000636612 | 222 |
| 138 | 3300005539 | Ga0068853_100101893 | Ga0068853_1001018932 | 222 |
| 139 | 3300005563 | Ga0068855_100572153 | Ga0068855_1005721532 | 222 |
| 140 | 3300005564 | Ga0070664_100014287 | Ga0070664_1000142872 | 222 |
| 141 | 3300006358 | Ga0068871_100174312 | Ga0068871_1001743122 | 222 |
| 142 | 3300009148 | Ga0105243_10016186 | Ga0105243_100161865 | 222 |
| 143 | 3300009551 | Ga0105238_10086397 | Ga0105238_100863972 | 222 |
| 144 | 3300010375 | Ga0105239_10196713 | Ga0105239_101967133 | 222 |
| 145 | 3300011119 | Ga0105246_10029271 | Ga0105246_100292716 | 222 |
| 146 | 3300014497 | Ga0182008_10005677 | Ga0182008_100056776 | 222 |
| 147 | 3300015262 | Ga0182007_10027204 | Ga0182007_100272042 | 222 |
| 148 | 3300025728 | Ga0207655_1004345 | Ga0207655_10043457 | 222 |
| 149 | 3300025924 | Ga0207694_10050584 | Ga0207694_100505842 | 222 |
| 150 | 3300025933 | Ga0207706_10003236 | Ga0207706_1000323611 | 222 |
| 151 | 3300025934 | Ga0207686_10533718 | Ga0207686_105337182 | 222 |
| 152 | 3300025935 | Ga0207709_10009313 | Ga0207709_100093137 | 222 |
| 153 | 3300026041 | Ga0207639_10254228 | Ga0207639_102542282 | 222 |
| 154 | 3300026116 | Ga0207674_10047145 | Ga0207674_100471456 | 222 |
| 155 | 3300031241 | Ga0265325_10036823 | Ga0265325_100368232 | 222 |
| 156 | 3300031251 | Ga0265327_10014199 | Ga0265327_100141992 | 222 |
| 157 | 3300031344 | Ga0265316_10023106 | Ga0265316_100231062 | 222 |
| 158 | 3300035091 | Ga0373951_0003422 | Ga0373951_0003422_2576_3256 | 222 |
| 159 | 3300037418 | Ga0395900_0279749 | Ga0395900_0279749_621_1298 | 222 |
| 160 | 3300037466 | Ga0395898_0696345 | Ga0395898_0696345_231_908 | 222 |
| 161 | 3300037471 | Ga0395905_0094769 | Ga0395905_0094769_2015_2692 | 222 |
| 162 | 3300042876 | Ga0451577_0759835 | Ga0451577_0759835_111_782 | 222 |
| 163 | 3300044712 | Ga0453684_1184021 | Ga0453684_1184021_120_791 | 222 |
| 164 | 3300046455 | Ga0495603_0039511 | Ga0495603_0039511_471_1142 | 222 |
| 165 | 3300046460 | Ga0495638_0041357 | Ga0495638_0041357_987_1691 | 222 |
| 166 | 3300046472 | Ga0495580_0002981 | Ga0495580_0002981_416_1087 | 222 |
| 167 | 3300046473 | Ga0495582_0016926 | Ga0495582_0016926_1848_2519 | 222 |
| 168 | 3300046477 | Ga0495664_0002038 | Ga0495664_0002038_1205_1876 | 222 |
| 169 | 3300046511 | Ga0495608_0146181 | Ga0495608_0146181_363_1034 | 222 |
| 170 | 3300046514 | Ga0495618_0062853 | Ga0495618_0062853_530_1201 | 222 |
| 171 | 3300046516 | Ga0495628_0016953 | Ga0495628_0016953_4983_5654 | 222 |
| 172 | 3300046517 | Ga0495630_0041985 | Ga0495630_0041985_440_1111 | 222 |
| 173 | 3300046520 | Ga0495637_0003556 | Ga0495637_0003556_6773_7471 | 222 |
| 174 | 3300046520 | Ga0495637_0063902 | Ga0495637_0063902_606_1289 | 222 |
| 175 | 3300046529 | Ga0495652_0105911 | Ga0495652_0105911_1185_1856 | 222 |
| 176 | 3300046531 | Ga0495665_0036639 | Ga0495665_0036639_544_1215 | 222 |
| 177 | 3300046533 | Ga0495640_0067498 | Ga0495640_0067498_490_1161 | 222 |
| 178 | 3300046535 | Ga0495586_0047412 | Ga0495586_0047412_464_1135 | 222 |
| 179 | 3300046536 | Ga0495587_0036651 | Ga0495587_0036651_580_1251 | 222 |
| 180 | 3300046616 | Ga0495668_0012004 | Ga0495668_0012004_1156_1854 | 222 |
| 181 | 3300046642 | Ga0495634_0045399 | Ga0495634_0045399_1806_2477 | 222 |
| 182 | 3300046663 | Ga0495635_0048412 | Ga0495635_0048412_323_994 | 222 |
| 183 | 3300046665 | Ga0495661_0026481 | Ga0495661_0026481_2532_3203 | 222 |
| 184 | 3300046674 | Ga0495588_0126974 | Ga0495588_0126974_209_880 | 222 |
| 185 | 3300046678 | Ga0495599_0020830 | Ga0495599_0020830_2985_3656 | 222 |
| 186 | 3300046690 | Ga0495624_0006092 | Ga0495624_0006092_583_1254 | 222 |
| 187 | 3300046694 | Ga0495649_0000205 | Ga0495649_0000205_16003_16701 | 222 |
| 188 | 3300046809 | Ga0495600_0191635 | Ga0495600_0191635_323_994 | 222 |
| 189 | 3300047315 | Ga0495581_0048251 | Ga0495581_0048251_1465_2136 | 222 |
| 190 | 3300047317 | Ga0495604_0048411 | Ga0495604_0048411_2119_2790 | 222 |
| 191 | 3300047319 | Ga0495674_0115527 | Ga0495674_0115527_416_1087 | 222 |
| 192 | 3300047322 | Ga0495680_0017125 | Ga0495680_0017125_420_1091 | 222 |
| 193 | 3300047446 | Ga0495679_001766 | Ga0495679_001766_10639_11310 | 222 |
| 194 | 3300047673 | Ga0495593_0020673 | Ga0495593_0020673_514_1185 | 222 |
| 195 | 3300048088 | Ga0495602_0034419 | Ga0495602_0034419_538_1209 | 222 |
| 196 | 3300048920 | Ga0496117_0118547 | Ga0496117_0118547_59_742 | 222 |
| 197 | 3300048921 | Ga0496118_0036828 | Ga0496118_0036828_2660_3343 | 222 |
| 198 | 3300048924 | Ga0496121_0110830 | Ga0496121_0110830_1209_1892 | 222 |
| 199 | 3300053079 | Ga0500610_0017782 | Ga0500610_0017782_1931_2614 | 222 |
| 200 | 3300053122 | Ga0500608_002755 | Ga0500608_002755_2727_3410 | 222 |
| 201 | 2124908027 | MRS2a_Contig_5562 | MRS2a_00436800 | 223 |
| 202 | 2162886007 | SwRhRL2b_contig_554480 | SwRhRL2b_0389.00006610 | 223 |
| 203 | 3300002737 | JGI25162J39368_1000197 | JGI25162J39368_100019723 | 223 |
| 204 | 3300002771 | JGI25163J39215_1000326 | JGI25163J39215_10003269 | 223 |
| 205 | 3300002772 | JGI25164J39214_1000309 | JGI25164J39214_10003094 | 223 |
| 206 | 3300003214 | JGI25165J46597_1000293 | JGI25165J46597_100029340 | 223 |
| 207 | 3300003577 | Ga0007416J51690_1043430 | Ga0007416J51690_10434303 | 223 |
| 208 | 3300003781 | Ga0055536_1000014 | Ga0055536_1000014105 | 223 |
| 209 | 3300003781 | Ga0055536_1000125 | Ga0055536_100012550 | 223 |
| 210 | 3300003781 | Ga0055536_1000185 | Ga0055536_100018510 | 223 |
| 211 | 3300003791 | Ga0055530_10000009 | Ga0055530_10000009105 | 223 |
| 212 | 3300003791 | Ga0055530_10000130 | Ga0055530_1000013021 | 223 |
| 213 | 3300003792 | Ga0055540_1000222 | Ga0055540_100022211 | 223 |
| 214 | 3300003792 | Ga0055540_1000560 | Ga0055540_100056021 | 223 |
| 215 | 3300003792 | Ga0055540_1000865 | Ga0055540_100086511 | 223 |
| 216 | 3300003794 | Ga0055531_10000215 | Ga0055531_1000021533 | 223 |
| 217 | 3300005288 | Ga0065714_10003912 | Ga0065714_100039123 | 223 |
| 218 | 3300005289 | Ga0065704_10031668 | Ga0065704_100316682 | 223 |
| 219 | 3300005289 | Ga0065704_10121549 | Ga0065704_101215492 | 223 |
| 220 | 3300005290 | Ga0065712_10075586 | Ga0065712_100755863 | 223 |
| 221 | 3300005331 | Ga0070670_100000310 | Ga0070670_1000003106 | 223 |
| 222 | 3300005344 | Ga0070661_100000109 | Ga0070661_10000010926 | 223 |
| 223 | 3300005353 | Ga0070669_100000452 | Ga0070669_10000045212 | 223 |
| 224 | 3300005355 | Ga0070671_100340563 | Ga0070671_1003405632 | 223 |
| 225 | 3300005440 | Ga0070705_100231301 | Ga0070705_1002313011 | 223 |
| 226 | 3300005457 | Ga0070662_100002689 | Ga0070662_1000026897 | 223 |
| 227 | 3300005530 | Ga0070679_100001343 | Ga0070679_1000013438 | 223 |
| 228 | 3300005539 | Ga0068853_100000003 | Ga0068853_10000000330 | 223 |
| 229 | 3300005539 | Ga0068853_100069863 | Ga0068853_1000698632 | 223 |
| 230 | 3300005548 | Ga0070665_100038852 | Ga0070665_1000388524 | 223 |
| 231 | 3300005548 | Ga0070665_100063377 | Ga0070665_1000633774 | 223 |
| 232 | 3300005564 | Ga0070664_100000086 | Ga0070664_10000008619 | 223 |
| 233 | 3300005578 | Ga0068854_100028651 | Ga0068854_1000286513 | 223 |
| 234 | 3300005834 | Ga0068851_10000021 | Ga0068851_1000002123 | 223 |
| 235 | 3300005937 | Ga0081455_10034885 | Ga0081455_100348853 | 223 |
| 236 | 3300005985 | Ga0081539_10018963 | Ga0081539_100189632 | 223 |
| 237 | 3300005985 | Ga0081539_10031372 | Ga0081539_100313722 | 223 |
| 238 | 3300006028 | Ga0070717_10034168 | Ga0070717_100341683 | 223 |
| 239 | 3300006051 | Ga0075364_10032691 | Ga0075364_100326913 | 223 |
| 240 | 3300006058 | Ga0075432_10003812 | Ga0075432_100038123 | 223 |
| 241 | 3300006058 | Ga0075432_10011338 | Ga0075432_100113381 | 223 |
| 242 | 3300006177 | Ga0075362_10086375 | Ga0075362_100863751 | 223 |
| 243 | 3300006946 | Ga0079104_1000239 | Ga0079104_100023954 | 223 |
| 244 | 3300006946 | Ga0079104_1002227 | Ga0079104_10022277 | 223 |
| 245 | 3300007265 | Ga0099794_10278996 | Ga0099794_102789961 | 223 |
| 246 | 3300009011 | Ga0105251_10001070 | Ga0105251_1000107011 | 223 |
| 247 | 3300009011 | Ga0105251_10001398 | Ga0105251_100013988 | 223 |
| 248 | 3300009011 | Ga0105251_10007350 | Ga0105251_100073502 | 223 |
| 249 | 3300009011 | Ga0105251_10008119 | Ga0105251_100081191 | 223 |
| 250 | 3300009011 | Ga0105251_10055141 | Ga0105251_100551411 | 223 |
| 251 | 3300009036 | Ga0105244_10006535 | Ga0105244_100065358 | 223 |
| 252 | 3300009036 | Ga0105244_10013404 | Ga0105244_100134043 | 223 |
| 253 | 3300009036 | Ga0105244_10038671 | Ga0105244_100386713 | 223 |
| 254 | 3300009036 | Ga0105244_10088915 | Ga0105244_100889151 | 223 |
| 255 | 3300009036 | Ga0105244_10124415 | Ga0105244_101244151 | 223 |
| 256 | 3300009036 | Ga0105244_10315355 | Ga0105244_103153551 | 223 |
| 257 | 3300009092 | Ga0105250_10000120 | Ga0105250_1000012021 | 223 |
| 258 | 3300009092 | Ga0105250_10001119 | Ga0105250_100011193 | 223 |
| 259 | 3300009092 | Ga0105250_10010602 | Ga0105250_100106022 | 223 |
| 260 | 3300009092 | Ga0105250_10022042 | Ga0105250_100220422 | 223 |
| 261 | 3300009094 | Ga0111539_10063881 | Ga0111539_100638812 | 223 |
| 262 | 3300009147 | Ga0114129_10174704 | Ga0114129_101747043 | 223 |
| 263 | 3300009148 | Ga0105243_10000135 | Ga0105243_1000013557 | 223 |
| 264 | 3300009148 | Ga0105243_10000587 | Ga0105243_1000058721 | 223 |
| 265 | 3300009148 | Ga0105243_10122002 | Ga0105243_101220021 | 223 |
| 266 | 3300009176 | Ga0105242_10000314 | Ga0105242_1000031410 | 223 |
| 267 | 3300009176 | Ga0105242_10328341 | Ga0105242_103283412 | 223 |
| 268 | 3300009177 | Ga0105248_10086220 | Ga0105248_100862203 | 223 |
| 269 | 3300009545 | Ga0105237_10000391 | Ga0105237_1000039125 | 223 |
| 270 | 3300009553 | Ga0105249_10032513 | Ga0105249_100325132 | 223 |
| 271 | 3300011119 | Ga0105246_10000239 | Ga0105246_100002399 | 223 |
| 272 | 3300011119 | Ga0105246_10043926 | Ga0105246_100439262 | 223 |
| 273 | 3300012498 | Ga0157345_1000249 | Ga0157345_10002495 | 223 |
| 274 | 3300013100 | Ga0157373_10001617 | Ga0157373_1000161711 | 223 |
| 275 | 3300013100 | Ga0157373_10005283 | Ga0157373_1000528310 | 223 |
| 276 | 3300013100 | Ga0157373_10008815 | Ga0157373_100088154 | 223 |
| 277 | 3300013102 | Ga0157371_10003122 | Ga0157371_1000312210 | 223 |
| 278 | 3300013102 | Ga0157371_10212306 | Ga0157371_102123061 | 223 |
| 279 | 3300013104 | Ga0157370_10030390 | Ga0157370_100303903 | 223 |
| 280 | 3300013104 | Ga0157370_10104320 | Ga0157370_101043202 | 223 |
| 281 | 3300013105 | Ga0157369_10009720 | Ga0157369_100097204 | 223 |
| 282 | 3300013105 | Ga0157369_10010109 | Ga0157369_1001010911 | 223 |
| 283 | 3300013105 | Ga0157369_10049351 | Ga0157369_100493514 | 223 |
| 284 | 3300013306 | Ga0163162_10003597 | Ga0163162_100035973 | 223 |
| 285 | 3300013306 | Ga0163162_10067695 | Ga0163162_100676952 | 223 |
| 286 | 3300013306 | Ga0163162_10098762 | Ga0163162_100987622 | 223 |
| 287 | 3300013306 | Ga0163162_10393868 | Ga0163162_103938682 | 223 |
| 288 | 3300013307 | Ga0157372_10004984 | Ga0157372_1000498412 | 223 |
| 289 | 3300013308 | Ga0157375_10002219 | Ga0157375_100022195 | 223 |
| 290 | 3300013308 | Ga0157375_10426513 | Ga0157375_104265132 | 223 |
| 291 | 3300014326 | Ga0157380_10084066 | Ga0157380_100840662 | 223 |
| 292 | 3300014497 | Ga0182008_10000092 | Ga0182008_1000009249 | 223 |
| 293 | 3300014497 | Ga0182008_10004811 | Ga0182008_100048114 | 223 |
| 294 | 3300014497 | Ga0182008_10005922 | Ga0182008_100059221 | 223 |
| 295 | 3300014497 | Ga0182008_10029786 | Ga0182008_100297862 | 223 |
| 296 | 3300015261 | Ga0182006_1000920 | Ga0182006_100092010 | 223 |
| 297 | 3300015261 | Ga0182006_1002031 | Ga0182006_10020318 | 223 |
| 298 | 3300015261 | Ga0182006_1006929 | Ga0182006_10069293 | 223 |
| 299 | 3300015262 | Ga0182007_10000477 | Ga0182007_100004774 | 223 |
| 300 | 3300015262 | Ga0182007_10000786 | Ga0182007_1000078611 | 223 |
| 301 | 3300015265 | Ga0182005_1000604 | Ga0182005_10006043 | 223 |
| 302 | 3300015265 | Ga0182005_1001126 | Ga0182005_100112611 | 223 |
| 303 | 3300015265 | Ga0182005_1027100 | Ga0182005_10271002 | 223 |
| 304 | 3300015265 | Ga0182005_1027101 | Ga0182005_10271012 | 223 |
| 305 | 3300017792 | Ga0163161_10006936 | Ga0163161_100069364 | 223 |
| 306 | 3300017792 | Ga0163161_10064610 | Ga0163161_100646102 | 223 |
| 307 | 3300021384 | Ga0213876_10009936 | Ga0213876_100099363 | 223 |
| 308 | 3300025207 | Ga0209760_100108 | Ga0209760_10010819 | 223 |
| 309 | 3300025230 | Ga0209563_100826 | Ga0209563_1008267 | 223 |
| 310 | 3300025231 | Ga0207427_100007 | Ga0207427_100007706 | 223 |
| 311 | 3300025233 | Ga0209437_100006 | Ga0209437_100006972 | 223 |
| 312 | 3300025261 | Ga0209233_1000059 | Ga0209233_100005923 | 223 |
| 313 | 3300025291 | Ga0209675_1003084 | Ga0209675_10030849 | 223 |
| 314 | 3300025292 | Ga0209676_1000002 | Ga0209676_1000002313 | 223 |
| 315 | 3300025292 | Ga0209676_1000003 | Ga0209676_1000003797 | 223 |
| 316 | 3300025292 | Ga0209676_1000006 | Ga0209676_1000006981 | 223 |
| 317 | 3300025298 | Ga0209050_1000004 | Ga0209050_1000004779 | 223 |
| 318 | 3300025298 | Ga0209050_1000242 | Ga0209050_100024283 | 223 |
| 319 | 3300025298 | Ga0209050_1000317 | Ga0209050_100031722 | 223 |
| 320 | 3300025303 | Ga0209051_1000001 | Ga0209051_1000001313 | 223 |
| 321 | 3300025303 | Ga0209051_1000006 | Ga0209051_1000006196 | 223 |
| 322 | 3300025303 | Ga0209051_1000218 | Ga0209051_100021876 | 223 |
| 323 | 3300025304 | Ga0209257_1000167 | Ga0209257_1000167141 | 223 |
| 324 | 3300025321 | Ga0207656_10000020 | Ga0207656_1000002095 | 223 |
| 325 | 3300025711 | Ga0207696_1000052 | Ga0207696_100005223 | 223 |
| 326 | 3300025711 | Ga0207696_1000147 | Ga0207696_100014785 | 223 |
| 327 | 3300025711 | Ga0207696_1002556 | Ga0207696_10025564 | 223 |
| 328 | 3300025711 | Ga0207696_1003391 | Ga0207696_10033913 | 223 |
| 329 | 3300025728 | Ga0207655_1000333 | Ga0207655_100033340 | 223 |
| 330 | 3300025728 | Ga0207655_1000409 | Ga0207655_100040929 | 223 |
| 331 | 3300025728 | Ga0207655_1003745 | Ga0207655_10037456 | 223 |
| 332 | 3300025728 | Ga0207655_1004101 | Ga0207655_10041015 | 223 |
| 333 | 3300025728 | Ga0207655_1009742 | Ga0207655_10097424 | 223 |
| 334 | 3300025728 | Ga0207655_1032993 | Ga0207655_10329932 | 223 |
| 335 | 3300025735 | Ga0207713_1000453 | Ga0207713_100045310 | 223 |
| 336 | 3300025735 | Ga0207713_1001189 | Ga0207713_100118922 | 223 |
| 337 | 3300025735 | Ga0207713_1001663 | Ga0207713_100166312 | 223 |
| 338 | 3300025735 | Ga0207713_1002292 | Ga0207713_10022924 | 223 |
| 339 | 3300025735 | Ga0207713_1002467 | Ga0207713_10024678 | 223 |
| 340 | 3300025735 | Ga0207713_1007482 | Ga0207713_10074824 | 223 |
| 341 | 3300025735 | Ga0207713_1024048 | Ga0207713_10240482 | 223 |
| 342 | 3300025914 | Ga0207671_10000356 | Ga0207671_1000035626 | 223 |
| 343 | 3300025920 | Ga0207649_10000020 | Ga0207649_1000002026 | 223 |
| 344 | 3300025921 | Ga0207652_10059071 | Ga0207652_100590713 | 223 |
| 345 | 3300025923 | Ga0207681_10000119 | Ga0207681_1000011931 | 223 |
| 346 | 3300025925 | Ga0207650_10000225 | Ga0207650_1000022534 | 223 |
| 347 | 3300025929 | Ga0207664_10104985 | Ga0207664_101049852 | 223 |
| 348 | 3300025933 | Ga0207706_10000855 | Ga0207706_1000085519 | 223 |
| 349 | 3300025934 | Ga0207686_10000917 | Ga0207686_100009177 | 223 |
| 350 | 3300025934 | Ga0207686_10233565 | Ga0207686_102335652 | 223 |
| 351 | 3300025935 | Ga0207709_10000014 | Ga0207709_10000014389 | 223 |
| 352 | 3300025935 | Ga0207709_10000251 | Ga0207709_1000025148 | 223 |
| 353 | 3300025935 | Ga0207709_10016757 | Ga0207709_100167572 | 223 |
| 354 | 3300025945 | Ga0207679_10000023 | Ga0207679_1000002326 | 223 |
| 355 | 3300025961 | Ga0207712_10017913 | Ga0207712_100179134 | 223 |
| 356 | 3300025981 | Ga0207640_10008460 | Ga0207640_100084603 | 223 |
| 357 | 3300026041 | Ga0207639_10000002 | Ga0207639_10000002398 | 223 |
| 358 | 3300026041 | Ga0207639_10052357 | Ga0207639_100523572 | 223 |
| 359 | 3300027111 | Ga0209281_1000368 | Ga0209281_100036854 | 223 |
| 360 | 3300027111 | Ga0209281_1031951 | Ga0209281_10319512 | 223 |
| 361 | 3300027907 | Ga0207428_10019494 | Ga0207428_100194942 | 223 |
| 362 | 3300028379 | Ga0268266_10012761 | Ga0268266_100127614 | 223 |
| 363 | 3300028379 | Ga0268266_10129392 | Ga0268266_101293922 | 223 |
| 364 | 3300028794 | Ga0307515_10059818 | Ga0307515_100598185 | 223 |
| 365 | 3300030521 | Ga0307511_10164558 | Ga0307511_101645581 | 223 |
| 366 | 3300031456 | Ga0307513_10000667 | Ga0307513_1000066717 | 223 |
| 367 | 3300031456 | Ga0307513_10012235 | Ga0307513_1001223510 | 223 |
| 368 | 3300031548 | Ga0307408_100000265 | Ga0307408_10000026516 | 223 |
| 369 | 3300031730 | Ga0307516_10261193 | Ga0307516_102611931 | 223 |
| 370 | 3300031731 | Ga0307405_10000084 | Ga0307405_100000848 | 223 |
| 371 | 3300031731 | Ga0307405_10000126 | Ga0307405_1000012612 | 223 |
| 372 | 3300031731 | Ga0307405_10001787 | Ga0307405_100017871 | 223 |
| 373 | 3300031911 | Ga0307412_10000132 | Ga0307412_1000013234 | 223 |
| 374 | 3300031911 | Ga0307412_10011956 | Ga0307412_100119565 | 223 |
| 375 | 3300031911 | Ga0307412_10154643 | Ga0307412_101546432 | 223 |
| 376 | 3300033180 | Ga0307510_10017621 | Ga0307510_100176212 | 223 |
| 377 | 3300035116 | Ga0373945_0110523 | Ga0373945_0110523_376_1050 | 223 |
| 378 | 3300035170 | Ga0373943_0041918 | Ga0373943_0041918_1056_1730 | 223 |
| 379 | 3300035172 | Ga0373955_0010297 | Ga0373955_0010297_2967_3641 | 223 |
| 380 | 3300036401 | Ga0373937_0381928 | Ga0373937_0381928_515_1189 | 223 |
| 381 | 3300037068 | Ga0373925_0764102 | Ga0373925_0764102_30_704 | 223 |
| 382 | 3300038705 | Ga0237819_02360 | Ga0237819_02360_1388_2062 | 223 |
| 383 | 3300039437 | Ga0436365_0605876 | Ga0436365_0605876_5521_6264 | 223 |
| 384 | 3300041404 | Ga0439436_0000257 | Ga0439436_0000257_3992_4666 | 223 |
| 385 | 3300041405 | Ga0439438_002827 | Ga0439438_002827_449_1123 | 223 |
| 386 | 3300041407 | Ga0439447_009963 | Ga0439447_009963_635_1309 | 223 |
| 387 | 3300041411 | Ga0439466_0000026 | Ga0439466_0000026_60186_60860 | 223 |
| 388 | 3300041411 | Ga0439466_0000405 | Ga0439466_0000405_14008_14682 | 223 |
| 389 | 3300042006 | Ga0439432_000831 | Ga0439432_000831_155_829 | 223 |
| 390 | 3300042009 | Ga0439451_000030 | Ga0439451_000030_11233_11907 | 223 |
| 391 | 3300042010 | Ga0439452_000482 | Ga0439452_000482_14642_15316 | 223 |
| 392 | 3300042013 | Ga0439456_020561 | Ga0439456_020561_681_1355 | 223 |
| 393 | 3300042016 | Ga0439463_000073 | Ga0439463_000073_15560_16234 | 223 |
| 394 | 3300042016 | Ga0439463_000457 | Ga0439463_000457_7174_7848 | 223 |
| 395 | 3300042125 | Ga0450923_021625 | Ga0450923_021625_97_771 | 223 |
| 396 | 3300042156 | Ga0439446_0004554 | Ga0439446_0004554_2342_3016 | 223 |
| 397 | 3300042435 | Ga0439434_0000133 | Ga0439434_0000133_4601_5275 | 223 |
| 398 | 3300042876 | Ga0451577_0162781 | Ga0451577_0162781_1186_1860 | 223 |
| 399 | 3300042876 | Ga0451577_0297749 | Ga0451577_0297749_58_729 | 223 |
| 400 | 3300042876 | Ga0451577_0298616 | Ga0451577_0298616_320_991 | 223 |
| 401 | 3300042876 | Ga0451577_0346900 | Ga0451577_0346900_274_948 | 223 |
| 402 | 3300042876 | Ga0451577_0407886 | Ga0451577_0407886_238_912 | 223 |
| 403 | 3300042876 | Ga0451577_0414124 | Ga0451577_0414124_309_980 | 223 |
| 404 | 3300042993 | Ga0439440_0004516 | Ga0439440_0004516_695_1369 | 223 |
| 405 | 3300044673 | Ga0453683_0000114 | Ga0453683_0000114_17790_18464 | 223 |
| 406 | 3300044712 | Ga0453684_0007772 | Ga0453684_0007772_11097_11771 | 223 |
| 407 | 3300044712 | Ga0453684_0293268 | Ga0453684_0293268_370_1041 | 223 |
| 408 | 3300045051 | Ga0451576_0000151 | Ga0451576_0000151_146933_147607 | 223 |
| 409 | 3300045051 | Ga0451576_0004207 | Ga0451576_0004207_4614_5288 | 223 |
| 410 | 3300046452 | Ga0495617_006624 | Ga0495617_006624_1764_2438 | 223 |
| 411 | 3300046452 | Ga0495617_022351 | Ga0495617_022351_1241_1915 | 223 |
| 412 | 3300046452 | Ga0495617_054409 | Ga0495617_054409_634_1308 | 223 |
| 413 | 3300046453 | Ga0495627_000010 | Ga0495627_000010_343741_344559 | 223 |
| 414 | 3300046453 | Ga0495627_000137 | Ga0495627_000137_42163_42837 | 223 |
| 415 | 3300046453 | Ga0495627_001498 | Ga0495627_001498_1604_2278 | 223 |
| 416 | 3300046453 | Ga0495627_004025 | Ga0495627_004025_3173_3847 | 223 |
| 417 | 3300046453 | Ga0495627_004564 | Ga0495627_004564_1467_2141 | 223 |
| 418 | 3300046453 | Ga0495627_006204 | Ga0495627_006204_1378_2052 | 223 |
| 419 | 3300046454 | Ga0495592_0187357 | Ga0495592_0187357_94_768 | 223 |
| 420 | 3300046455 | Ga0495603_0016844 | Ga0495603_0016844_3721_4395 | 223 |
| 421 | 3300046458 | Ga0495591_000163 | Ga0495591_000163_56129_56803 | 223 |
| 422 | 3300046458 | Ga0495591_000975 | Ga0495591_000975_14910_15584 | 223 |
| 423 | 3300046458 | Ga0495591_001553 | Ga0495591_001553_714_1388 | 223 |
| 424 | 3300046458 | Ga0495591_001986 | Ga0495591_001986_9294_9968 | 223 |
| 425 | 3300046458 | Ga0495591_002129 | Ga0495591_002129_8022_8696 | 223 |
| 426 | 3300046458 | Ga0495591_007858 | Ga0495591_007858_2012_2686 | 223 |
| 427 | 3300046458 | Ga0495591_017563 | Ga0495591_017563_345_1019 | 223 |
| 428 | 3300046460 | Ga0495638_0001429 | Ga0495638_0001429_2644_3318 | 223 |
| 429 | 3300046460 | Ga0495638_0003116 | Ga0495638_0003116_2768_3442 | 223 |
| 430 | 3300046460 | Ga0495638_0014481 | Ga0495638_0014481_3111_3785 | 223 |
| 431 | 3300046460 | Ga0495638_0029181 | Ga0495638_0029181_2634_3308 | 223 |
| 432 | 3300046463 | Ga0495653_0000110 | Ga0495653_0000110_55160_55834 | 223 |
| 433 | 3300046463 | Ga0495653_0268167 | Ga0495653_0268167_34_708 | 223 |
| 434 | 3300046471 | Ga0495650_0005492 | Ga0495650_0005492_3275_3949 | 223 |
| 435 | 3300046471 | Ga0495650_0017624 | Ga0495650_0017624_1409_2083 | 223 |
| 436 | 3300046471 | Ga0495650_0070269 | Ga0495650_0070269_583_1257 | 223 |
| 437 | 3300046474 | Ga0495605_0000001 | Ga0495605_0000001_258904_259578 | 223 |
| 438 | 3300046474 | Ga0495605_0000324 | Ga0495605_0000324_36259_36933 | 223 |
| 439 | 3300046474 | Ga0495605_0007188 | Ga0495605_0007188_2120_2794 | 223 |
| 440 | 3300046474 | Ga0495605_0022426 | Ga0495605_0022426_1633_2307 | 223 |
| 441 | 3300046475 | Ga0495639_0001252 | Ga0495639_0001252_6317_6991 | 223 |
| 442 | 3300046475 | Ga0495639_0111950 | Ga0495639_0111950_32_706 | 223 |
| 443 | 3300046477 | Ga0495664_0305090 | Ga0495664_0305090_196_870 | 223 |
| 444 | 3300046491 | Ga0495584_0001304 | Ga0495584_0001304_12695_13369 | 223 |
| 445 | 3300046491 | Ga0495584_0072103 | Ga0495584_0072103_889_1563 | 223 |
| 446 | 3300046492 | Ga0495585_0000283 | Ga0495585_0000283_33584_34258 | 223 |
| 447 | 3300046492 | Ga0495585_0006867 | Ga0495585_0006867_3238_3912 | 223 |
| 448 | 3300046492 | Ga0495585_0011854 | Ga0495585_0011854_2430_3104 | 223 |
| 449 | 3300046492 | Ga0495585_0057474 | Ga0495585_0057474_175_849 | 223 |
| 450 | 3300046500 | Ga0495596_0022516 | Ga0495596_0022516_863_1537 | 223 |
| 451 | 3300046501 | Ga0495607_0000094 | Ga0495607_0000094_76935_77609 | 223 |
| 452 | 3300046501 | Ga0495607_0000391 | Ga0495607_0000391_33644_34318 | 223 |
| 453 | 3300046501 | Ga0495607_0001397 | Ga0495607_0001397_13265_13939 | 223 |
| 454 | 3300046501 | Ga0495607_0001852 | Ga0495607_0001852_13821_14495 | 223 |
| 455 | 3300046501 | Ga0495607_0009143 | Ga0495607_0009143_2639_3313 | 223 |
| 456 | 3300046501 | Ga0495607_0013393 | Ga0495607_0013393_4412_5086 | 223 |
| 457 | 3300046501 | Ga0495607_0014374 | Ga0495607_0014374_2897_3571 | 223 |
| 458 | 3300046501 | Ga0495607_0016645 | Ga0495607_0016645_1619_2293 | 223 |
| 459 | 3300046501 | Ga0495607_0018619 | Ga0495607_0018619_1597_2271 | 223 |
| 460 | 3300046501 | Ga0495607_0039552 | Ga0495607_0039552_229_903 | 223 |
| 461 | 3300046501 | Ga0495607_0072518 | Ga0495607_0072518_722_1396 | 223 |
| 462 | 3300046501 | Ga0495607_0296405 | Ga0495607_0296405_78_752 | 223 |
| 463 | 3300046506 | Ga0495583_0000611 | Ga0495583_0000611_7328_8002 | 223 |
| 464 | 3300046506 | Ga0495583_0000778 | Ga0495583_0000778_30231_30905 | 223 |
| 465 | 3300046507 | Ga0495606_0000421 | Ga0495606_0000421_55523_56197 | 223 |
| 466 | 3300046507 | Ga0495606_0005295 | Ga0495606_0005295_8459_9133 | 223 |
| 467 | 3300046507 | Ga0495606_0006865 | Ga0495606_0006865_6337_7011 | 223 |
| 468 | 3300046507 | Ga0495606_0015567 | Ga0495606_0015567_3094_3768 | 223 |
| 469 | 3300046507 | Ga0495606_0019528 | Ga0495606_0019528_2552_3226 | 223 |
| 470 | 3300046507 | Ga0495606_0026643 | Ga0495606_0026643_1885_2559 | 223 |
| 471 | 3300046507 | Ga0495606_0028625 | Ga0495606_0028625_1937_2611 | 223 |
| 472 | 3300046507 | Ga0495606_0081415 | Ga0495606_0081415_902_1576 | 223 |
| 473 | 3300046512 | Ga0495610_0000644 | Ga0495610_0000644_11765_12439 | 223 |
| 474 | 3300046512 | Ga0495610_0002650 | Ga0495610_0002650_10180_10854 | 223 |
| 475 | 3300046512 | Ga0495610_0038069 | Ga0495610_0038069_1588_2262 | 223 |
| 476 | 3300046512 | Ga0495610_0047155 | Ga0495610_0047155_1205_1879 | 223 |
| 477 | 3300046512 | Ga0495610_0059027 | Ga0495610_0059027_39_713 | 223 |
| 478 | 3300046513 | Ga0495616_0004820 | Ga0495616_0004820_4344_5018 | 223 |
| 479 | 3300046513 | Ga0495616_0004858 | Ga0495616_0004858_4376_5050 | 223 |
| 480 | 3300046513 | Ga0495616_0008984 | Ga0495616_0008984_3223_3897 | 223 |
| 481 | 3300046513 | Ga0495616_0010017 | Ga0495616_0010017_3360_4034 | 223 |
| 482 | 3300046513 | Ga0495616_0017609 | Ga0495616_0017609_1964_2638 | 223 |
| 483 | 3300046514 | Ga0495618_0018455 | Ga0495618_0018455_2291_2965 | 223 |
| 484 | 3300046515 | Ga0495620_0000242 | Ga0495620_0000242_37200_37874 | 223 |
| 485 | 3300046515 | Ga0495620_0016449 | Ga0495620_0016449_2520_3194 | 223 |
| 486 | 3300046515 | Ga0495620_0019057 | Ga0495620_0019057_2048_2722 | 223 |
| 487 | 3300046515 | Ga0495620_0030056 | Ga0495620_0030056_1634_2308 | 223 |
| 488 | 3300046516 | Ga0495628_0022294 | Ga0495628_0022294_1317_1991 | 223 |
| 489 | 3300046518 | Ga0495631_0003453 | Ga0495631_0003453_3270_3944 | 223 |
| 490 | 3300046518 | Ga0495631_0003954 | Ga0495631_0003954_3386_4060 | 223 |
| 491 | 3300046518 | Ga0495631_0005013 | Ga0495631_0005013_3433_4107 | 223 |
| 492 | 3300046519 | Ga0495632_0002747 | Ga0495632_0002747_2269_2943 | 223 |
| 493 | 3300046519 | Ga0495632_0008701 | Ga0495632_0008701_3148_3822 | 223 |
| 494 | 3300046519 | Ga0495632_0018143 | Ga0495632_0018143_1834_2508 | 223 |
| 495 | 3300046519 | Ga0495632_0058262 | Ga0495632_0058262_562_1236 | 223 |
| 496 | 3300046520 | Ga0495637_0001790 | Ga0495637_0001790_8453_9127 | 223 |
| 497 | 3300046520 | Ga0495637_0002035 | Ga0495637_0002035_3868_4542 | 223 |
| 498 | 3300046520 | Ga0495637_0010237 | Ga0495637_0010237_1069_1743 | 223 |
| 499 | 3300046520 | Ga0495637_0013928 | Ga0495637_0013928_2561_3235 | 223 |
| 500 | 3300046520 | Ga0495637_0050087 | Ga0495637_0050087_475_1149 | 223 |
| 501 | 3300046520 | Ga0495637_0056271 | Ga0495637_0056271_418_1092 | 223 |
| 502 | 3300046522 | Ga0495643_0011083 | Ga0495643_0011083_2392_3066 | 223 |
| 503 | 3300046522 | Ga0495643_0067390 | Ga0495643_0067390_94_768 | 223 |
| 504 | 3300046523 | Ga0495644_0004529 | Ga0495644_0004529_1627_2301 | 223 |
| 505 | 3300046524 | Ga0495648_0006976 | Ga0495648_0006976_4151_4825 | 223 |
| 506 | 3300046524 | Ga0495648_0013697 | Ga0495648_0013697_2195_2869 | 223 |
| 507 | 3300046524 | Ga0495648_0036764 | Ga0495648_0036764_1837_2511 | 223 |
| 508 | 3300046524 | Ga0495648_0109968 | Ga0495648_0109968_799_1473 | 223 |
| 509 | 3300046530 | Ga0495654_0000137 | Ga0495654_0000137_17898_18572 | 223 |
| 510 | 3300046530 | Ga0495654_0001197 | Ga0495654_0001197_3426_4100 | 223 |
| 511 | 3300046530 | Ga0495654_0003840 | Ga0495654_0003840_4851_5525 | 223 |
| 512 | 3300046530 | Ga0495654_0007592 | Ga0495654_0007592_4315_4989 | 223 |
| 513 | 3300046530 | Ga0495654_0014855 | Ga0495654_0014855_1856_2530 | 223 |
| 514 | 3300046530 | Ga0495654_0026131 | Ga0495654_0026131_713_1387 | 223 |
| 515 | 3300046530 | Ga0495654_0035730 | Ga0495654_0035730_1007_1681 | 223 |
| 516 | 3300046530 | Ga0495654_0050606 | Ga0495654_0050606_1212_1886 | 223 |
| 517 | 3300046530 | Ga0495654_0128661 | Ga0495654_0128661_287_961 | 223 |
| 518 | 3300046538 | Ga0495609_0007641 | Ga0495609_0007641_303_977 | 223 |
| 519 | 3300046538 | Ga0495609_0007717 | Ga0495609_0007717_1640_2314 | 223 |
| 520 | 3300046538 | Ga0495609_0013695 | Ga0495609_0013695_164_838 | 223 |
| 521 | 3300046538 | Ga0495609_0030273 | Ga0495609_0030273_15_689 | 223 |
| 522 | 3300046538 | Ga0495609_0107756 | Ga0495609_0107756_423_1097 | 223 |
| 523 | 3300046542 | Ga0495597_0000008 | Ga0495597_0000008_14407_15081 | 223 |
| 524 | 3300046557 | Ga0495622_0002337 | Ga0495622_0002337_8455_9129 | 223 |
| 525 | 3300046557 | Ga0495622_0126077 | Ga0495622_0126077_313_987 | 223 |
| 526 | 3300046558 | Ga0495633_0013961 | Ga0495633_0013961_1990_2664 | 223 |
| 527 | 3300046616 | Ga0495668_0007713 | Ga0495668_0007713_3041_3715 | 223 |
| 528 | 3300046648 | Ga0495611_0001236 | Ga0495611_0001236_2011_2685 | 223 |
| 529 | 3300046648 | Ga0495611_0201691 | Ga0495611_0201691_186_860 | 223 |
| 530 | 3300046660 | Ga0495625_0009513 | Ga0495625_0009513_3119_3793 | 223 |
| 531 | 3300046660 | Ga0495625_0025532 | Ga0495625_0025532_2889_3563 | 223 |
| 532 | 3300046660 | Ga0495625_0026892 | Ga0495625_0026892_3593_4267 | 223 |
| 533 | 3300046660 | Ga0495625_0094194 | Ga0495625_0094194_610_1485 | 223 |
| 534 | 3300046663 | Ga0495635_0112572 | Ga0495635_0112572_737_1411 | 223 |
| 535 | 3300046665 | Ga0495661_0000013 | Ga0495661_0000013_195415_196089 | 223 |
| 536 | 3300046665 | Ga0495661_0000503 | Ga0495661_0000503_7855_8529 | 223 |
| 537 | 3300046665 | Ga0495661_0000977 | Ga0495661_0000977_12435_13109 | 223 |
| 538 | 3300046665 | Ga0495661_0021526 | Ga0495661_0021526_1993_2667 | 223 |
| 539 | 3300046689 | Ga0495613_0126184 | Ga0495613_0126184_170_844 | 223 |
| 540 | 3300046690 | Ga0495624_0001949 | Ga0495624_0001949_11110_11784 | 223 |
| 541 | 3300046691 | Ga0495670_0002982 | Ga0495670_0002982_3467_4141 | 223 |
| 542 | 3300046692 | Ga0495671_0001003 | Ga0495671_0001003_11082_11756 | 223 |
| 543 | 3300046692 | Ga0495671_0011250 | Ga0495671_0011250_1037_1717 | 223 |
| 544 | 3300046692 | Ga0495671_0017339 | Ga0495671_0017339_1351_2025 | 223 |
| 545 | 3300046692 | Ga0495671_0024305 | Ga0495671_0024305_1989_2663 | 223 |
| 546 | 3300046692 | Ga0495671_0027335 | Ga0495671_0027335_355_1029 | 223 |
| 547 | 3300046692 | Ga0495671_0064665 | Ga0495671_0064665_197_871 | 223 |
| 548 | 3300046694 | Ga0495649_0001249 | Ga0495649_0001249_15981_16655 | 223 |
| 549 | 3300046694 | Ga0495649_0011541 | Ga0495649_0011541_3045_3719 | 223 |
| 550 | 3300046694 | Ga0495649_0027832 | Ga0495649_0027832_844_1518 | 223 |
| 551 | 3300046694 | Ga0495649_0062763 | Ga0495649_0062763_352_1026 | 223 |
| 552 | 3300046794 | Ga0495589_0000318 | Ga0495589_0000318_35105_35779 | 223 |
| 553 | 3300046794 | Ga0495589_0010769 | Ga0495589_0010769_1508_2182 | 223 |
| 554 | 3300046794 | Ga0495589_0025458 | Ga0495589_0025458_1972_2646 | 223 |
| 555 | 3300046794 | Ga0495589_0044039 | Ga0495589_0044039_120_794 | 223 |
| 556 | 3300046794 | Ga0495589_0127724 | Ga0495589_0127724_532_1206 | 223 |
| 557 | 3300046810 | Ga0495660_0000142 | Ga0495660_0000142_54771_55445 | 223 |
| 558 | 3300046810 | Ga0495660_0000528 | Ga0495660_0000528_28217_28891 | 223 |
| 559 | 3300046810 | Ga0495660_0001037 | Ga0495660_0001037_5856_6530 | 223 |
| 560 | 3300046810 | Ga0495660_0019958 | Ga0495660_0019958_494_1168 | 223 |
| 561 | 3300046810 | Ga0495660_0024615 | Ga0495660_0024615_2305_2979 | 223 |
| 562 | 3300046810 | Ga0495660_0052402 | Ga0495660_0052402_1079_1753 | 223 |
| 563 | 3300047320 | Ga0495672_0002987 | Ga0495672_0002987_3252_3926 | 223 |
| 564 | 3300047320 | Ga0495672_0004835 | Ga0495672_0004835_4270_4944 | 223 |
| 565 | 3300047320 | Ga0495672_0011316 | Ga0495672_0011316_1881_2555 | 223 |
| 566 | 3300047320 | Ga0495672_0014008 | Ga0495672_0014008_506_1180 | 223 |
| 567 | 3300047320 | Ga0495672_0041233 | Ga0495672_0041233_509_1183 | 223 |
| 568 | 3300047320 | Ga0495672_0047982 | Ga0495672_0047982_647_1321 | 223 |
| 569 | 3300047320 | Ga0495672_0261835 | Ga0495672_0261835_68_742 | 223 |
| 570 | 3300047321 | Ga0495676_0003671 | Ga0495676_0003671_7390_8064 | 223 |
| 571 | 3300047321 | Ga0495676_0014550 | Ga0495676_0014550_3090_3764 | 223 |
| 572 | 3300047322 | Ga0495680_0041178 | Ga0495680_0041178_2762_3436 | 223 |
| 573 | 3300047322 | Ga0495680_0098278 | Ga0495680_0098278_378_1052 | 223 |
| 574 | 3300047323 | Ga0495683_0005772 | Ga0495683_0005772_4105_4779 | 223 |
| 575 | 3300047323 | Ga0495683_0016186 | Ga0495683_0016186_1198_1872 | 223 |
| 576 | 3300047443 | Ga0495687_010472 | Ga0495687_010472_4145_4819 | 223 |
| 577 | 3300047446 | Ga0495679_000372 | Ga0495679_000372_4478_5152 | 223 |
| 578 | 3300047446 | Ga0495679_004120 | Ga0495679_004120_1840_2514 | 223 |
| 579 | 3300047446 | Ga0495679_013938 | Ga0495679_013938_282_956 | 223 |
| 580 | 3300047446 | Ga0495679_015872 | Ga0495679_015872_320_994 | 223 |
| 581 | 3300047469 | Ga0495673_0005503 | Ga0495673_0005503_2464_3138 | 223 |
| 582 | 3300047469 | Ga0495673_0006518 | Ga0495673_0006518_4135_4809 | 223 |
| 583 | 3300047469 | Ga0495673_0011071 | Ga0495673_0011071_1486_2160 | 223 |
| 584 | 3300047469 | Ga0495673_0184386 | Ga0495673_0184386_62_736 | 223 |
| 585 | 3300047470 | Ga0495681_0000329 | Ga0495681_0000329_15620_16294 | 223 |
| 586 | 3300047470 | Ga0495681_0003223 | Ga0495681_0003223_7538_8212 | 223 |
| 587 | 3300047470 | Ga0495681_0005528 | Ga0495681_0005528_3385_4059 | 223 |
| 588 | 3300047470 | Ga0495681_0008962 | Ga0495681_0008962_3161_3835 | 223 |
| 589 | 3300047470 | Ga0495681_0011670 | Ga0495681_0011670_3173_3847 | 223 |
| 590 | 3300047470 | Ga0495681_0013305 | Ga0495681_0013305_2505_3179 | 223 |
| 591 | 3300047470 | Ga0495681_0023485 | Ga0495681_0023485_826_1500 | 223 |
| 592 | 3300047470 | Ga0495681_0092780 | Ga0495681_0092780_122_796 | 223 |
| 593 | 3300047472 | Ga0495686_0010032 | Ga0495686_0010032_4415_5089 | 223 |
| 594 | 3300047673 | Ga0495593_0001599 | Ga0495593_0001599_10896_11570 | 223 |
| 595 | 3300048091 | Ga0495626_0004692 | Ga0495626_0004692_3432_4106 | 223 |
| 596 | 3300048091 | Ga0495626_0007255 | Ga0495626_0007255_3879_4553 | 223 |
| 597 | 3300048091 | Ga0495626_0022508 | Ga0495626_0022508_186_860 | 223 |
| 598 | 3300048919 | Ga0496116_0000318 | Ga0496116_0000318_22959_23633 | 223 |
| 599 | 3300048919 | Ga0496116_0003624 | Ga0496116_0003624_10679_11353 | 223 |
| 600 | 3300048919 | Ga0496116_0011989 | Ga0496116_0011989_3355_4029 | 223 |
| 601 | 3300048919 | Ga0496116_0014741 | Ga0496116_0014741_1021_1695 | 223 |
| 602 | 3300048920 | Ga0496117_0000838 | Ga0496117_0000838_28715_29389 | 223 |
| 603 | 3300048920 | Ga0496117_0000838 | Ga0496117_0000838_36622_37296 | 223 |
| 604 | 3300048920 | Ga0496117_0000981 | Ga0496117_0000981_15269_15943 | 223 |
| 605 | 3300048920 | Ga0496117_0020784 | Ga0496117_0020784_2278_2952 | 223 |
| 606 | 3300048921 | Ga0496118_0010399 | Ga0496118_0010399_3390_4064 | 223 |
| 607 | 3300048921 | Ga0496118_0042581 | Ga0496118_0042581_937_1611 | 223 |
| 608 | 3300048921 | Ga0496118_0042951 | Ga0496118_0042951_750_1424 | 223 |
| 609 | 3300048921 | Ga0496118_0058872 | Ga0496118_0058872_874_1548 | 223 |
| 610 | 3300048921 | Ga0496118_0278520 | Ga0496118_0278520_18_692 | 223 |
| 611 | 3300048922 | Ga0496119_0018764 | Ga0496119_0018764_4071_4745 | 223 |
| 612 | 3300048922 | Ga0496119_0047252 | Ga0496119_0047252_234_908 | 223 |
| 613 | 3300048923 | Ga0496120_0015063 | Ga0496120_0015063_888_1562 | 223 |
| 614 | 3300048923 | Ga0496120_0075948 | Ga0496120_0075948_816_1490 | 223 |
| 615 | 3300048924 | Ga0496121_0000463 | Ga0496121_0000463_56025_56699 | 223 |
| 616 | 3300048924 | Ga0496121_0026911 | Ga0496121_0026911_2777_3451 | 223 |
| 617 | 3300048924 | Ga0496121_0096575 | Ga0496121_0096575_281_955 | 223 |
| 618 | 3300048925 | Ga0496122_0012229 | Ga0496122_0012229_1599_2273 | 223 |
| 619 | 3300048925 | Ga0496122_0055546 | Ga0496122_0055546_1605_2279 | 223 |
| 620 | 3300048925 | Ga0496122_0218830 | Ga0496122_0218830_65_739 | 223 |
| 621 | 3300048926 | Ga0496123_0002822 | Ga0496123_0002822_3467_4141 | 223 |
| 622 | 3300048926 | Ga0496123_0029837 | Ga0496123_0029837_580_1254 | 223 |
| 623 | 3300048926 | Ga0496123_0045582 | Ga0496123_0045582_926_1600 | 223 |
| 624 | 3300048926 | Ga0496123_0085236 | Ga0496123_0085236_580_1254 | 223 |
| 625 | 3300048927 | Ga0496124_0001258 | Ga0496124_0001258_19514_20188 | 223 |
| 626 | 3300048927 | Ga0496124_0001258 | Ga0496124_0001258_27422_28096 | 223 |
| 627 | 3300048927 | Ga0496124_0017104 | Ga0496124_0017104_2198_2872 | 223 |
| 628 | 3300048927 | Ga0496124_0029852 | Ga0496124_0029852_1651_2325 | 223 |
| 629 | 3300048927 | Ga0496124_0091167 | Ga0496124_0091167_1439_2113 | 223 |
| 630 | 3300048927 | Ga0496124_0170579 | Ga0496124_0170579_402_1076 | 223 |
| 631 | 3300048928 | Ga0496125_0001178 | Ga0496125_0001178_31174_31848 | 223 |
| 632 | 3300048928 | Ga0496125_0004482 | Ga0496125_0004482_12782_13456 | 223 |
| 633 | 3300048928 | Ga0496125_0042987 | Ga0496125_0042987_1582_2256 | 223 |
| 634 | 3300048928 | Ga0496125_0056206 | Ga0496125_0056206_528_1202 | 223 |
| 635 | 3300048928 | Ga0496125_0061733 | Ga0496125_0061733_1671_2345 | 223 |
| 636 | 3300048928 | Ga0496125_0065148 | Ga0496125_0065148_700_1374 | 223 |
| 637 | 3300048928 | Ga0496125_0073480 | Ga0496125_0073480_1490_2164 | 223 |
| 638 | 3300048928 | Ga0496125_0120158 | Ga0496125_0120158_1180_1854 | 223 |
| 639 | 3300048929 | Ga0496126_0001092 | Ga0496126_0001092_41732_42406 | 223 |
| 640 | 3300048929 | Ga0496126_0041933 | Ga0496126_0041933_1426_2100 | 223 |
| 641 | 3300048929 | Ga0496126_0054646 | Ga0496126_0054646_323_997 | 223 |
| 642 | 3300049459 | Ga0495678_002022 | Ga0495678_002022_10620_11294 | 223 |
| 643 | 3300049459 | Ga0495678_005389 | Ga0495678_005389_3699_4373 | 223 |
| 644 | 3300049459 | Ga0495678_005852 | Ga0495678_005852_2949_3623 | 223 |
| 645 | 3300049459 | Ga0495678_006693 | Ga0495678_006693_1424_2098 | 223 |
| 646 | 3300049459 | Ga0495678_041662 | Ga0495678_041662_553_1227 | 223 |
| 647 | 3300049460 | Ga0495682_0001091 | Ga0495682_0001091_3062_3736 | 223 |
| 648 | 3300049568 | Ga0501031_0120135 | Ga0501031_0120135_615_1289 | 223 |
| 649 | 3300049571 | Ga0501034_0043921 | Ga0501034_0043921_2164_2838 | 223 |
| 650 | 3300049574 | Ga0501038_0099730 | Ga0501038_0099730_1608_2282 | 223 |
| 651 | 3300049741 | Ga0501079_0456844 | Ga0501079_0456844_309_986 | 223 |
| 652 | 3300049743 | Ga0501081_0448005 | Ga0501081_0448005_33_710 | 223 |
| 653 | 3300049822 | Ga0501035_0353621 | Ga0501035_0353621_31_705 | 223 |
| 654 | 3300050511 | nmdc:mga08y16_50221_c1 | nmdc:mga08y16_50221_c1_482_1156 | 223 |
| 655 | 3300053078 | Ga0495612_0063528 | Ga0495612_0063528_686_1360 | 223 |
| 656 | 3300053133 | Ga0500655_023484 | Ga0500655_023484_135_806 | 223 |
| 657 | 3300053140 | Ga0500573_0002848 | Ga0500573_0002848_7822_8496 | 223 |
| 658 | 3300053142 | Ga0500577_0138633 | Ga0500577_0138633_270_944 | 223 |
| 659 | 3300053161 | Ga0500634_0000099 | Ga0500634_0000099_917_1591 | 223 |
| 660 | 3300053178 | Ga0500637_0194736 | Ga0500637_0194736_117_788 | 223 |
| 661 | iso_pu_bacteria | 2844665904 | 2844666305 | 223 |
| 662 | iso_pu_bacteria | 2885211737 | 2885215108 | 223 |
| 663 | iso_pu_bacteria | 640427133 | 640489363 | 223 |
| 664 | 2010549000 | RicEn_FSXC39451_b1 | RicEn_382160 | 224 |
| 665 | 3300005338 | Ga0068868_100466895 | Ga0068868_1004668952 | 224 |
| 666 | 3300006944 | Ga0099823_1000791 | Ga0099823_100079115 | 224 |
| 667 | 3300009148 | Ga0105243_10092697 | Ga0105243_100926973 | 224 |
| 668 | 3300025935 | Ga0207709_10036347 | Ga0207709_100363472 | 224 |
| 669 | 3300027296 | Ga0209389_1000114 | Ga0209389_100011432 | 224 |
| 670 | 3300027312 | Ga0209371_1000023 | Ga0209371_1000023262 | 224 |
| 671 | 3300028800 | Ga0265338_10008353 | Ga0265338_100083534 | 224 |
| 672 | 3300030500 | Ga0268256_1000023 | Ga0268256_1000023178 | 224 |
| 673 | 3300031691 | Ga0316579_10001052 | Ga0316579_100010524 | 224 |
| 674 | 3300031727 | Ga0316576_10024632 | Ga0316576_100246324 | 224 |
| 675 | 3300031727 | Ga0316576_10186480 | Ga0316576_101864802 | 224 |
| 676 | 3300031728 | Ga0316578_10012455 | Ga0316578_100124551 | 224 |
| 677 | 3300031731 | Ga0307405_10000151 | Ga0307405_1000015116 | 224 |
| 678 | 3300031733 | Ga0316577_10180111 | Ga0316577_101801112 | 224 |
| 679 | 3300031911 | Ga0307412_10400298 | Ga0307412_104002981 | 224 |
| 680 | 3300035398 | Ga0316574_0032201 | Ga0316574_0032201_764_1444 | 224 |
| 681 | 3300036647 | Ga0316582_0064155 | Ga0316582_0064155_430_1110 | 224 |
| 682 | 3300036712 | Ga0316584_0016160 | Ga0316584_0016160_1021_1701 | 224 |
| 683 | 3300036712 | Ga0316584_0026596 | Ga0316584_0026596_2631_3311 | 224 |
| 684 | 3300036712 | Ga0316584_0371008 | Ga0316584_0371008_160_870 | 224 |
| 685 | 3300037471 | Ga0395905_0000075 | Ga0395905_0000075_29923_30609 | 224 |
| 686 | 3300039447 | Ga0436361_0601543 | Ga0436361_0601543_128_820 | 224 |
| 687 | 3300041407 | Ga0439447_015270 | Ga0439447_015270_808_1482 | 224 |
| 688 | 3300041407 | Ga0439447_031136 | Ga0439447_031136_83_757 | 224 |
| 689 | 3300042006 | Ga0439432_000024 | Ga0439432_000024_40156_40830 | 224 |
| 690 | 3300042006 | Ga0439432_000067 | Ga0439432_000067_19328_20002 | 224 |
| 691 | 3300046501 | Ga0495607_0000066 | Ga0495607_0000066_67870_68553 | 224 |
| 692 | 3300047472 | Ga0495686_0056916 | Ga0495686_0056916_838_1530 | 224 |
| 693 | 3300047472 | Ga0495686_0269347 | Ga0495686_0269347_159_851 | 224 |
| 694 | 3300048926 | Ga0496123_0021112 | Ga0496123_0021112_2464_3162 | 224 |
| 695 | 3300049523 | Ga0501300_012846 | Ga0501300_012846_182_892 | 224 |
| 696 | 3300049571 | Ga0501034_0000164 | Ga0501034_0000164_8179_8853 | 224 |
| 697 | 3300049571 | Ga0501034_0000430 | Ga0501034_0000430_38205_38882 | 224 |
| 698 | 3300049776 | Ga0501280_000259 | Ga0501280_000259_3314_4024 | 224 |
| 699 | 3300049778 | Ga0501282_000766 | Ga0501282_000766_2319_3029 | 224 |
| 700 | 3300053154 | Ga0500619_000105 | Ga0500619_000105_7656_8348 | 224 |
| 701 | 3300055283 | Ga0500661_021735 | Ga0500661_021735_249_941 | 224 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6is2-assembly1.cif.gz_A | crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg | 0.9824 | 1 | 118 |
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9811 | 1 | 120 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9758 | 1 | 118 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9748 | 1 | 118 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9729 | 2 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.994 | 1 | 80 | 3.40.50.2300 |
| af_P52076_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9856 | 1 | 80 | 3.40.50.2300 |
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9815 | 2 | 120 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9797 | 1 | 82 | 3.40.50.2300 |
| af_P30843_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9785 | 1 | 80 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849ZME1-F1-model_v4 | Response regulator | 0.801 | 1 | 150 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2V9X674-F1-model_v4 | Response regulatory domain-containing protein | 0.7992 | 1 | 152 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2V6FEF3-F1-model_v4 | Response regulatory domain-containing protein | 0.7979 | 1 | 153 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A849ZME1-F1-model_v4 | Response regulator | 0.7957 | 1 | 150 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-G6FW36-F1-model_v4 | Response regulator receiver protein | 0.7909 | 1 | 152 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar