F476146

General Info

Members Datasets Scaffolds Average Seq Length
701 277 1402 260

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100070795|Ga0070707_1000707953
Length 296
Sequence MPATSGGGLSPSRGPGGALPRRCPTYRTTHLGPVRVAAASKTSRLWLALEPVRGLPAAALREEVWAAMSAARVARFPGAAGRIPNFTGAEAAAERLRGLPEWRRAGTLKVNPDLPQLPVRQRALEDGKTVYMAVPRLAEAEPFFALDPDHLSEPPRKAASISGAARSAHRVSLAELTPVDLVVMGSVAVGEDGARLGKGGGFADLEFALAGAAGLIGPGTVTATTVHELQVRPAGMVPLTAHDVPVDLVITPDRVIDCRGRRGERPAPGIRWPELTEEKIAAIPLLASQRARQHRP

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
268 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
275 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
276 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
277 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.99
Rhizosphere 91.16
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100070795 3300005468 Bacteria 3359
2 Ga0070658_10028698 3300005327 Bacteria 4468
3 Ga0070658_10148611 3300005327 Bacteria 1960
4 Ga0070658_10297550 3300005327 Bacteria 1376
5 Ga0070676_10045989 3300005328 Bacteria 2544
6 Ga0070683_100705017 3300005329 Bacteria 967
7 Ga0068869_100102955 3300005334 Bacteria 2162
8 Ga0070666_10013496 3300005335 Bacteria 5185
9 Ga0070682_100055823 3300005337 Bacteria 2482
10 Ga0070682_100139376 3300005337 Bacteria 1651
11 Ga0068868_100332339 3300005338 Bacteria 1297
12 Ga0068868_100402525 3300005338 Bacteria 1181
13 Ga0068868_100419029 3300005338 Bacteria 1159
14 Ga0070660_100016154 3300005339 Bacteria 5412
15 Ga0070660_100075767 3300005339 Bacteria 2634
16 Ga0070689_100100305 3300005340 Bacteria 2291
17 Ga0070689_100359635 3300005340 Bacteria 1223
18 Ga0070691_10011830 3300005341 Bacteria 3992
19 Ga0070661_100013725 3300005344 Bacteria 5691
20 Ga0070661_100180560 3300005344 Bacteria 1605
21 Ga0070692_10114383 3300005345 Bacteria 1496
22 Ga0070668_100101961 3300005347 Bacteria 2275
23 Ga0070675_100367325 3300005354 Bacteria 1279
24 Ga0070671_100001775 3300005355 Bacteria 16387
25 Ga0070673_100076707 3300005364 Bacteria 2700
26 Ga0070659_100013587 3300005366 Bacteria 6064
27 Ga0070667_100056432 3300005367 Bacteria 3318
28 Ga0070709_10000363 3300005434 Bacteria 28041
29 Ga0070709_10000585 3300005434 Bacteria 21344
30 Ga0070709_10058627 3300005434 Bacteria 2442
31 Ga0070709_10120152 3300005434 Bacteria 1780
32 Ga0070709_10133480 3300005434 Bacteria 1697
33 Ga0070714_100000182 3300005435 Bacteria 50060
34 Ga0070714_100000833 3300005435 Bacteria 21830
35 Ga0070714_100001457 3300005435 Bacteria 17233
36 Ga0070714_100013642 3300005435 Bacteria 6515
37 Ga0070714_100047606 3300005435 Bacteria 3644
38 Ga0070714_100092410 3300005435 Bacteria 2652
39 Ga0070714_100096113 3300005435 Bacteria 2602
40 Ga0070714_100133498 3300005435 Bacteria 2220
41 Ga0070714_100362290 3300005435 Bacteria 1363
42 Ga0070714_100449563 3300005435 Bacteria 1224
43 Ga0070714_100641981 3300005435 Bacteria 1021
44 Ga0070713_100003768 3300005436 Bacteria 10039
45 Ga0070713_100035144 3300005436 Bacteria 4032
46 Ga0070713_100076899 3300005436 Bacteria 2836
47 Ga0070713_100203650 3300005436 Bacteria 1788
48 Ga0070713_100209335 3300005436 Bacteria 1765
49 Ga0070713_100353668 3300005436 Bacteria 1363
50 Ga0070710_10000226 3300005437 Bacteria 26288
51 Ga0070710_10001848 3300005437 Bacteria 9985
52 Ga0070710_10004208 3300005437 Bacteria 6821
53 Ga0070710_10004868 3300005437 Bacteria 6351
54 Ga0070710_10028972 3300005437 Bacteria 2966
55 Ga0070710_10211155 3300005437 Bacteria 1230
56 Ga0070710_10293147 3300005437 Bacteria 1059
57 Ga0070711_100001128 3300005439 Bacteria 14280
58 Ga0070711_100120542 3300005439 Bacteria 1939
59 Ga0070711_100131971 3300005439 Bacteria 1861
60 Ga0070711_100358796 3300005439 Bacteria 1173
61 Ga0070711_100462662 3300005439 Bacteria 1040
62 Ga0070711_100655479 3300005439 Bacteria 880
63 Ga0070700_100019819 3300005441 Bacteria 3887
64 Ga0070708_100045869 3300005445 Bacteria 3853
65 Ga0070708_100100821 3300005445 Bacteria 2643
66 Ga0070663_100021738 3300005455 Bacteria 4273
67 Ga0070663_100025363 3300005455 Bacteria 4001
68 Ga0070678_100310074 3300005456 Bacteria 1344
69 Ga0070678_100609821 3300005456 Bacteria 975
70 Ga0070681_10055516 3300005458 Bacteria 3943
71 Ga0068867_100196441 3300005459 Bacteria 1613
72 Ga0068867_100443643 3300005459 Bacteria 1104
73 Ga0070685_10048341 3300005466 Bacteria 2450
74 Ga0070685_10063314 3300005466 Bacteria 2171
75 Ga0070706_100013580 3300005467 Bacteria 7529
76 Ga0070706_100014081 3300005467 Bacteria 7390
77 Ga0070707_100095913 3300005468 Bacteria 2872
78 Ga0070707_100134026 3300005468 Bacteria 2410
79 Ga0070707_100391567 3300005468 Bacteria 1349
80 Ga0070707_100529942 3300005468 Bacteria 1140
81 Ga0070698_100001107 3300005471 Bacteria 29722
82 Ga0070698_100003164 3300005471 Bacteria 18145
83 Ga0070698_100003648 3300005471 Bacteria 16903
84 Ga0070698_100009913 3300005471 Bacteria 10184
85 Ga0070698_100030512 3300005471 Bacteria 5588
86 Ga0070698_100073907 3300005471 Bacteria 3414
87 Ga0070699_100001249 3300005518 Bacteria 23432
88 Ga0070699_100103431 3300005518 Bacteria 2497
89 Ga0070699_100119703 3300005518 Bacteria 2314
90 Ga0070699_100348327 3300005518 Unclassified 1334
91 Ga0070679_100070070 3300005530 Bacteria 3498
92 Ga0070679_100381758 3300005530 Bacteria 1356
93 Ga0070684_100088868 3300005535 Bacteria 2745
94 Ga0070697_100004900 3300005536 Bacteria 10275
95 Ga0070697_100036519 3300005536 Bacteria 3970
96 Ga0070686_100023801 3300005544 Bacteria 3666
97 Ga0070695_100100497 3300005545 Bacteria 1947
98 Ga0070696_100158357 3300005546 Bacteria 1667
99 Ga0070665_100006412 3300005548 Bacteria 11975
100 Ga0070665_100202311 3300005548 Bacteria 1986
101 Ga0070704_100158722 3300005549 Bacteria 1786
102 Ga0070704_100375947 3300005549 Bacteria 1206
103 Ga0070664_100003415 3300005564 Bacteria 12825
104 Ga0070664_100257912 3300005564 Bacteria 1568
105 Ga0068857_100069866 3300005577 Bacteria 3127
106 Ga0068854_100035058 3300005578 Bacteria 3510
107 Ga0068856_100444334 3300005614 Bacteria 1317
108 Ga0068856_100536644 3300005614 Bacteria 1191
109 Ga0068856_100712976 3300005614 Bacteria 1023
110 Ga0070702_100018872 3300005615 Bacteria 3585
111 Ga0070702_100232318 3300005615 Bacteria 1240
112 Ga0068859_100137226 3300005617 Bacteria 2519
113 Ga0068859_100499453 3300005617 Bacteria 1312
114 Ga0068864_100146318 3300005618 Bacteria 2136
115 Ga0068861_100038623 3300005719 Bacteria 3558
116 Ga0068863_100002321 3300005841 Bacteria 18912
117 Ga0068863_100094902 3300005841 Bacteria 2831
118 Ga0068863_100254468 3300005841 Bacteria 1697
119 Ga0068858_100238799 3300005842 Bacteria 1724
120 Ga0068860_100040813 3300005843 Bacteria 4434
121 Ga0068862_100080290 3300005844 Bacteria 2828
122 Ga0081455_10079911 3300005937 Bacteria 2683
123 Ga0081455_10114762 3300005937 Bacteria 2133
124 Ga0081455_10162345 3300005937 Bacteria 1711
125 Ga0081540_1000176 3300005983 Bacteria 67057
126 Ga0070717_10002481 3300006028 Bacteria 13029
127 Ga0070717_10006048 3300006028 Bacteria 8872
128 Ga0070717_10015178 3300006028 Bacteria 5943
129 Ga0070717_10063100 3300006028 Bacteria 3074
130 Ga0070717_10489853 3300006028 Bacteria 1110
131 Ga0075432_10062238 3300006058 Bacteria 1330
132 Ga0070715_10004571 3300006163 Bacteria 4558
133 Ga0070715_10012528 3300006163 Bacteria 3090
134 Ga0070715_10015550 3300006163 Bacteria 2842
135 Ga0070716_100000149 3300006173 Bacteria 28054
136 Ga0070716_100006815 3300006173 Bacteria 5599
137 Ga0070716_100155849 3300006173 Bacteria 1474
138 Ga0070716_100316696 3300006173 Bacteria 1091
139 Ga0070712_100000413 3300006175 Bacteria 24419
140 Ga0070712_100030533 3300006175 Bacteria 3622
141 Ga0070712_100036961 3300006175 Bacteria 3325
142 Ga0070712_100082033 3300006175 Bacteria 2338
143 Ga0070712_100328493 3300006175 Bacteria 1245
144 Ga0068871_100034413 3300006358 Bacteria 4020
145 Ga0075428_100149454 3300006844 Bacteria 2538
146 Ga0075428_100308620 3300006844 Bacteria 1701
147 Ga0075430_100343751 3300006846 Bacteria 1232
148 Ga0075431_100075896 3300006847 Bacteria 3469
149 Ga0075431_100362667 3300006847 Bacteria 1455
150 Ga0075434_100005739 3300006871 Bacteria 11331
151 Ga0075434_100035993 3300006871 Bacteria 4895
152 Ga0075434_100341159 3300006871 Bacteria 1519
153 Ga0075429_100163853 3300006880 Bacteria 1947
154 Ga0068865_100142996 3300006881 Bacteria 1806
155 Ga0075436_100009118 3300006914 Bacteria 6788
156 Ga0075436_100057718 3300006914 Bacteria 2680
157 Ga0075436_100167573 3300006914 Bacteria 1550
158 Ga0075436_100260537 3300006914 Bacteria 1236
159 Ga0097620_100137230 3300006931 Bacteria 2519
160 Ga0097620_100499408 3300006931 Bacteria 1312
161 Ga0075435_100024703 3300007076 Bacteria 4667
162 Ga0075435_100033602 3300007076 Bacteria 4057
163 Ga0105240_10141184 3300009093 Bacteria 2880
164 Ga0111539_10029949 3300009094 Bacteria 6620
165 Ga0111539_10066836 3300009094 Bacteria 4247
166 Ga0111539_10142780 3300009094 Bacteria 2803
167 Ga0111539_10158938 3300009094 Bacteria 2644
168 Ga0105245_10088620 3300009098 Bacteria 2842
169 Ga0105245_10180539 3300009098 Bacteria 2016
170 Ga0105245_10286218 3300009098 Bacteria 1613
171 Ga0105245_10337268 3300009098 Bacteria 1490
172 Ga0105247_10088938 3300009101 Bacteria 1958
173 Ga0105247_10185751 3300009101 Bacteria 1390
174 Ga0114129_10012826 3300009147 Bacteria 11927
175 Ga0114129_10642058 3300009147 Bacteria 1371
176 Ga0105242_10117020 3300009176 Bacteria 2281
177 Ga0105248_10064973 3300009177 Bacteria 4096
178 Ga0105237_10882636 3300009545 Bacteria 901
179 Ga0105238_10786575 3300009551 Bacteria 967
180 Ga0105249_10114500 3300009553 Bacteria 2553
181 Ga0105035_102819 3300009988 Bacteria 1302
182 Ga0099796_10083017 3300010159 Bacteria 1178
183 Ga0105239_10467364 3300010375 Bacteria 1432
184 Ga0105239_10837407 3300010375 Bacteria 1055
185 Ga0157338_1001985 3300012515 Bacteria 1552
186 Ga0157371_10009139 3300013102 Bacteria 7828
187 Ga0157371_10254058 3300013102 Bacteria 1266
188 Ga0157370_10064893 3300013104 Bacteria 3455
189 Ga0157370_10278585 3300013104 Bacteria 1545
190 Ga0157369_10178181 3300013105 Bacteria 2237
191 Ga0157369_10493907 3300013105 Bacteria 1266
192 Ga0157374_10111115 3300013296 Bacteria 2636
193 Ga0163162_10315891 3300013306 Bacteria 1695
194 Ga0157515_114685 3300013875 Bacteria 1135
195 Ga0163163_10004189 3300014325 Bacteria 12288
196 Ga0163163_10128431 3300014325 Bacteria 2574
197 Ga0157380_10031456 3300014326 Bacteria 4074
198 Ga0157380_10147293 3300014326 Bacteria 2030
199 Ga0182008_10133107 3300014497 Bacteria 1241
200 Ga0157377_10274807 3300014745 Bacteria 1102
201 Ga0157379_10001027 3300014968 Bacteria 22681
202 Ga0157379_10180558 3300014968 Bacteria 1907
203 Ga0157376_10173091 3300014969 Bacteria 1967
204 Ga0157376_10284048 3300014969 Bacteria 1560
205 Ga0163161_10058380 3300017792 Bacteria 2805
206 Ga0206356_10358345 3300020070 Bacteria 2611
207 Ga0206349_1773716 3300020075 Bacteria 1063
208 Ga0206350_10291945 3300020080 Bacteria 1621
209 Ga0206354_10773791 3300020081 Bacteria 2510
210 Ga0206353_10390560 3300020082 Bacteria 2153
211 Ga0213876_10084979 3300021384 Bacteria 1674
212 Ga0213875_10212341 3300021388 Bacteria 911
213 Ga0213875_10221833 3300021388 Bacteria 890
214 Ga0224712_10117714 3300022467 Bacteria 1147
215 Ga0224712_10194979 3300022467 Bacteria 919
216 Ga0207653_10012464 3300025885 Bacteria 2654
217 Ga0207692_10000966 3300025898 Bacteria 10455
218 Ga0207692_10013096 3300025898 Bacteria 3588
219 Ga0207692_10064931 3300025898 Bacteria 1902
220 Ga0207692_10121479 3300025898 Bacteria 1463
221 Ga0207642_10223115 3300025899 Bacteria 1054
222 Ga0207688_10024382 3300025901 Bacteria 3317
223 Ga0207685_10024334 3300025905 Bacteria 2075
224 Ga0207699_10000366 3300025906 Bacteria 23940
225 Ga0207699_10001959 3300025906 Bacteria 9717
226 Ga0207699_10003408 3300025906 Bacteria 7581
227 Ga0207699_10003884 3300025906 Bacteria 7137
228 Ga0207699_10014731 3300025906 Bacteria 4041
229 Ga0207699_10051348 3300025906 Bacteria 2436
230 Ga0207643_10009448 3300025908 Bacteria 5238
231 Ga0207643_10122304 3300025908 Bacteria 1543
232 Ga0207684_10008826 3300025910 Bacteria 8948
233 Ga0207684_10019245 3300025910 Bacteria 5841
234 Ga0207684_10279629 3300025910 Bacteria 1439
235 Ga0207684_10456986 3300025910 Bacteria 1096
236 Ga0207654_10173292 3300025911 Bacteria 1403
237 Ga0207707_10028349 3300025912 Bacteria 4894
238 Ga0207693_10002752 3300025915 Bacteria 15229
239 Ga0207693_10072516 3300025915 Bacteria 2696
240 Ga0207693_10171365 3300025915 Bacteria 1709
241 Ga0207663_10001895 3300025916 Bacteria 9892
242 Ga0207663_10056739 3300025916 Bacteria 2465
243 Ga0207663_10085205 3300025916 Bacteria 2080
244 Ga0207663_10343798 3300025916 Bacteria 1127
245 Ga0207662_10001081 3300025918 Bacteria 12802
246 Ga0207657_10002955 3300025919 Bacteria 18244
247 Ga0207657_10081085 3300025919 Bacteria 2726
248 Ga0207649_10086544 3300025920 Bacteria 2042
249 Ga0207652_10249027 3300025921 Bacteria 1602
250 Ga0207646_10018866 3300025922 Bacteria 6423
251 Ga0207646_10023168 3300025922 Bacteria 5707
252 Ga0207646_10047523 3300025922 Bacteria 3849
253 Ga0207646_10134237 3300025922 Bacteria 2228
254 Ga0207646_10177223 3300025922 Bacteria 1925
255 Ga0207646_10364447 3300025922 Bacteria 1305
256 Ga0207646_10427159 3300025922 Bacteria 1196
257 Ga0207694_10097141 3300025924 Bacteria 2330
258 Ga0207659_10028288 3300025926 Bacteria 3808
259 Ga0207659_10275152 3300025926 Bacteria 1374
260 Ga0207687_10082915 3300025927 Bacteria 2320
261 Ga0207700_10000437 3300025928 Bacteria 24528
262 Ga0207700_10001974 3300025928 Bacteria 11686
263 Ga0207700_10003241 3300025928 Bacteria 9404
264 Ga0207700_10009420 3300025928 Bacteria 6099
265 Ga0207700_10040574 3300025928 Bacteria 3398
266 Ga0207700_10114516 3300025928 Bacteria 2176
267 Ga0207700_10122315 3300025928 Bacteria 2112
268 Ga0207700_10250378 3300025928 Bacteria 1513
269 Ga0207700_10271814 3300025928 Bacteria 1455
270 Ga0207700_10327701 3300025928 Bacteria 1328
271 Ga0207700_10396860 3300025928 Bacteria 1208
272 Ga0207664_10000185 3300025929 Bacteria 47364
273 Ga0207664_10000416 3300025929 Bacteria 30401
274 Ga0207664_10001256 3300025929 Bacteria 16725
275 Ga0207664_10015007 3300025929 Bacteria 5611
276 Ga0207664_10041260 3300025929 Bacteria 3594
277 Ga0207664_10073327 3300025929 Bacteria 2762
278 Ga0207664_10073790 3300025929 Bacteria 2754
279 Ga0207664_10097020 3300025929 Bacteria 2427
280 Ga0207664_10177388 3300025929 Bacteria 1827
281 Ga0207664_10629049 3300025929 Bacteria 964
282 Ga0207644_10011115 3300025931 Bacteria 5947
283 Ga0207644_10051620 3300025931 Bacteria 2952
284 Ga0207706_10060654 3300025933 Bacteria 3331
285 Ga0207670_10107011 3300025936 Bacteria 2007
286 Ga0207670_10269834 3300025936 Bacteria 1322
287 Ga0207704_10420004 3300025938 Bacteria 1060
288 Ga0207665_10000097 3300025939 Bacteria 56851
289 Ga0207665_10000234 3300025939 Bacteria 37889
290 Ga0207665_10000457 3300025939 Bacteria 28144
291 Ga0207665_10008379 3300025939 Bacteria 6821
292 Ga0207665_10032338 3300025939 Bacteria 3463
293 Ga0207665_10065615 3300025939 Bacteria 2469
294 Ga0207665_10105099 3300025939 Bacteria 1977
295 Ga0207691_10151020 3300025940 Bacteria 2042
296 Ga0207691_10309583 3300025940 Bacteria 1356
297 Ga0207711_10018133 3300025941 Bacteria 5852
298 Ga0207689_10008280 3300025942 Bacteria 9064
299 Ga0207689_10008343 3300025942 Bacteria 9024
300 Ga0207661_10032444 3300025944 Bacteria 4046
301 Ga0207661_10173294 3300025944 Bacteria 1879
302 Ga0207651_10471580 3300025960 Bacteria 1080
303 Ga0207668_10052741 3300025972 Bacteria 2815
304 Ga0207668_10192258 3300025972 Bacteria 1618
305 Ga0207668_10277076 3300025972 Bacteria 1374
306 Ga0207640_10092925 3300025981 Bacteria 2094
307 Ga0207658_10057901 3300025986 Bacteria 2882
308 Ga0207677_10086289 3300026023 Bacteria 2268
309 Ga0207639_10297947 3300026041 Bacteria 1424
310 Ga0207678_10001939 3300026067 Bacteria 18882
311 Ga0207678_10024658 3300026067 Bacteria 5253
312 Ga0207708_10015930 3300026075 Bacteria 5645
313 Ga0207641_10002075 3300026088 Bacteria 18994
314 Ga0207641_10196397 3300026088 Bacteria 1857
315 Ga0207641_10730284 3300026088 Bacteria 977
316 Ga0207648_10225903 3300026089 Bacteria 1665
317 Ga0207676_10237486 3300026095 Bacteria 1633
318 Ga0207674_10003214 3300026116 Bacteria 20123
319 Ga0207674_10037739 3300026116 Bacteria 5021
320 Ga0207674_10148084 3300026116 Bacteria 2305
321 Ga0207675_100006916 3300026118 Bacteria 10733
322 Ga0207675_100009944 3300026118 Bacteria 8905
323 Ga0207675_100146904 3300026118 Bacteria 2242
324 Ga0207683_10002008 3300026121 Bacteria 17994
325 Ga0207683_10021102 3300026121 Bacteria 5575
326 Ga0207698_10906762 3300026142 Bacteria 889
327 Ga0268266_10026104 3300028379 Bacteria 4970
328 Ga0268266_10114238 3300028379 Bacteria 2396
329 Ga0268266_10139553 3300028379 Bacteria 2174
330 Ga0268266_10390284 3300028379 Bacteria 1314
331 Ga0268264_10252966 3300028381 Bacteria 1637
332 Ga0307513_10024279 3300031456 Bacteria 7056
333 Ga0307513_10025672 3300031456 Bacteria 6818
334 Ga0326468_10004221 3300031889 Bacteria 1247
335 Ga0373930_0019525 3300034816 Bacteria 1312
336 Ga0373959_0022735 3300034820 Bacteria 1214
337 Ga0373926_0001698 3300035083 Bacteria 6817
338 Ga0373926_0010380 3300035083 Bacteria 3121
339 Ga0373929_0011163 3300035085 Bacteria 1689
340 Ga0373934_0001661 3300035086 Bacteria 8161
341 Ga0373934_0004188 3300035086 Bacteria 5320
342 Ga0373934_0009807 3300035086 Bacteria 3594
343 Ga0373944_0001250 3300035089 Bacteria 6380
344 Ga0373944_0001307 3300035089 Bacteria 6265
345 Ga0373923_0004241 3300035111 Bacteria 4734
346 Ga0373923_0010967 3300035111 Bacteria 3313
347 Ga0373923_0173599 3300035111 Bacteria 988
348 Ga0373936_0000136 3300035113 Bacteria 25252
349 Ga0373936_0000255 3300035113 Bacteria 17429
350 Ga0373936_0007607 3300035113 Bacteria 4071
351 Ga0373936_0011190 3300035113 Bacteria 3391
352 Ga0373936_0083346 3300035113 Bacteria 1333
353 Ga0373945_0001442 3300035116 Bacteria 7246
354 Ga0373945_0150424 3300035116 Bacteria 943
355 Ga0373953_0015662 3300035117 Bacteria 2754
356 Ga0373953_0031801 3300035117 Bacteria 2054
357 Ga0373953_0052488 3300035117 Bacteria 1650
358 Ga0373953_0052960 3300035117 Bacteria 1643
359 Ga0373954_0004028 3300035118 Bacteria 6283
360 Ga0373954_0010013 3300035118 Bacteria 4176
361 Ga0373956_0002417 3300035119 Bacteria 7620
362 Ga0373956_0007704 3300035119 Bacteria 4341
363 Ga0373957_0006945 3300035120 Bacteria 3595
364 Ga0373957_0035415 3300035120 Bacteria 1855
365 Ga0373957_0056268 3300035120 Bacteria 1514
366 Ga0373957_0105883 3300035120 Bacteria 1129
367 Ga0373943_0001010 3300035170 Bacteria 12507
368 Ga0373943_0001481 3300035170 Bacteria 10634
369 Ga0373943_0075886 3300035170 Bacteria 1713
370 Ga0373943_0120500 3300035170 Bacteria 1394
371 Ga0373946_0000042 3300035171 Bacteria 32829
372 Ga0373946_0003285 3300035171 Bacteria 5744
373 Ga0373946_0041537 3300035171 Bacteria 1887
374 Ga0373946_0061767 3300035171 Bacteria 1596
375 Ga0373955_0004973 3300035172 Bacteria 5932
376 Ga0373955_0007890 3300035172 Bacteria 4914
377 Ga0373955_0024632 3300035172 Bacteria 3079
378 Ga0373955_0173934 3300035172 Bacteria 1275
379 Ga0373942_0022497 3300035207 Bacteria 1600
380 Ga0373962_0005290 3300035242 Bacteria 3123
381 Ga0373924_0000234 3300035410 Bacteria 16830
382 Ga0373924_0018690 3300035410 Bacteria 2675
383 Ga0373931_0074858 3300035691 Bacteria 1855
384 Ga0373935_0003363 3300035692 Bacteria 9271
385 Ga0373935_0006528 3300035692 Bacteria 6967
386 Ga0373935_0040943 3300035692 Bacteria 2909
387 Ga0373935_0348175 3300035692 Bacteria 1056
388 Ga0373927_0002474 3300035695 Bacteria 13480
389 Ga0373927_0013633 3300035695 Bacteria 5396
390 Ga0373927_0093925 3300035695 Bacteria 1949
391 Ga0373933_0003456 3300035724 Bacteria 8793
392 Ga0373933_0107612 3300035724 Bacteria 1736
393 Ga0373933_0120694 3300035724 Bacteria 1641
394 Ga0373933_0247967 3300035724 Bacteria 1146
395 Ga0373947_0000944 3300035725 Bacteria 17672
396 Ga0373947_0011829 3300035725 Bacteria 5000
397 Ga0373947_0038014 3300035725 Bacteria 2857
398 Ga0373947_0058874 3300035725 Bacteria 2328
399 Ga0373937_0002615 3300036401 Bacteria 15008
400 Ga0373937_0020697 3300036401 Bacteria 5900
401 Ga0373937_0034645 3300036401 Bacteria 4592
402 Ga0373937_0054896 3300036401 Bacteria 3656
403 Ga0373937_0059021 3300036401 Bacteria 3525
404 Ga0373937_0112423 3300036401 Bacteria 2533
405 Ga0373937_0304263 3300036401 Bacteria 1507
406 Ga0373937_0324184 3300036401 Bacteria 1457
407 Ga0373925_0002998 3300037068 Bacteria 13282
408 Ga0373925_0003140 3300037068 Bacteria 12968
409 Ga0373925_0017297 3300037068 Bacteria 5224
410 Ga0373925_0044869 3300037068 Bacteria 3282
411 Ga0373925_0047888 3300037068 Bacteria 3183
412 Ga0373925_0059929 3300037068 Bacteria 2856
413 Ga0373925_0271195 3300037068 Bacteria 1365
414 Ga0436364_0072739 3300037853 Bacteria 3075
415 Ga0436364_0188744 3300037853 Bacteria 2446
416 Ga0436364_0287407 3300037853 Bacteria 132611
417 Ga0436364_0385753 3300037853 Bacteria 2439
418 Ga0436364_0585527 3300037853 Bacteria 3005
419 Ga0436364_0884066 3300037853 Bacteria 3333
420 Ga0436365_0051225 3300039437 Bacteria 3563
421 Ga0436365_0074233 3300039437 Bacteria 1219
422 Ga0436363_0875728 3300039450 Bacteria 1410
423 Ga0466972_0086840 3300044658 Bacteria 1486
424 Ga0466965_0002074 3300044683 Bacteria 8394
425 Ga0466963_0066389 3300044694 Bacteria 2420
426 Ga0466964_0055903 3300044706 Bacteria 1631
427 Ga0466960_0001569 3300044901 Bacteria 8364
428 Ga0466960_0134846 3300044901 Bacteria 1307
429 Ga0466958_0166048 3300045836 Bacteria 1396
430 Ga0466967_0015291 3300045976 Bacteria 6012
431 Ga0466967_0033416 3300045976 Bacteria 4354
432 Ga0466967_0057155 3300045976 Bacteria 3443
433 Ga0466967_0165512 3300045976 Bacteria 2078
434 Ga0466967_0347151 3300045976 Bacteria 1436
435 Ga0495592_0081446 3300046454 Bacteria 2340
436 Ga0495603_0002385 3300046455 Bacteria 11046
437 Ga0495603_0070329 3300046455 Bacteria 2057
438 Ga0495629_0004467 3300046459 Bacteria 10484
439 Ga0495629_0006588 3300046459 Bacteria 8602
440 Ga0495641_0002810 3300046461 Bacteria 13468
441 Ga0495641_0009329 3300046461 Bacteria 5839
442 Ga0495641_0020029 3300046461 Bacteria 3404
443 Ga0495641_0032725 3300046461 Bacteria 2473
444 Ga0495651_0002945 3300046462 Bacteria 13164
445 Ga0495651_0010074 3300046462 Bacteria 7262
446 Ga0495651_0020289 3300046462 Bacteria 5158
447 Ga0495651_0021994 3300046462 Bacteria 4959
448 Ga0495651_0088131 3300046462 Bacteria 2332
449 Ga0495653_0008158 3300046463 Bacteria 8576
450 Ga0495653_0012670 3300046463 Bacteria 6886
451 Ga0495653_0013722 3300046463 Bacteria 6603
452 Ga0495653_0087584 3300046463 Bacteria 2286
453 Ga0495653_0103928 3300046463 Bacteria 2053
454 Ga0495653_0307754 3300046463 Bacteria 1031
455 Ga0495580_0004049 3300046472 Bacteria 12364
456 Ga0495582_0001282 3300046473 Bacteria 14108
457 Ga0495582_0004976 3300046473 Bacteria 7443
458 Ga0495582_0007862 3300046473 Bacteria 5891
459 Ga0495582_0090119 3300046473 Bacteria 1709
460 Ga0495639_0001660 3300046475 Bacteria 9894
461 Ga0495639_0091992 3300046475 Bacteria 1424
462 Ga0495662_0000892 3300046476 Bacteria 14586
463 Ga0495662_0004957 3300046476 Bacteria 6663
464 Ga0495662_0025885 3300046476 Bacteria 2834
465 Ga0495662_0078803 3300046476 Bacteria 1601
466 Ga0495664_0000213 3300046477 Bacteria 27782
467 Ga0495664_0006935 3300046477 Bacteria 6270
468 Ga0495664_0052365 3300046477 Bacteria 2425
469 Ga0495664_0055177 3300046477 Bacteria 2364
470 Ga0495664_0058691 3300046477 Bacteria 2289
471 Ga0495664_0072111 3300046477 Bacteria 2063
472 Ga0495664_0136594 3300046477 Bacteria 1485
473 Ga0495594_0008852 3300046499 Bacteria 5190
474 Ga0495594_0119109 3300046499 Bacteria 1492
475 Ga0495608_0000952 3300046511 Bacteria 20388
476 Ga0495608_0003331 3300046511 Bacteria 11488
477 Ga0495608_0004543 3300046511 Bacteria 9918
478 Ga0495608_0018759 3300046511 Bacteria 4767
479 Ga0495608_0026980 3300046511 Bacteria 3911
480 Ga0495608_0045203 3300046511 Bacteria 2936
481 Ga0495608_0121425 3300046511 Bacteria 1675
482 Ga0495608_0256323 3300046511 Bacteria 1090
483 Ga0495618_0027153 3300046514 Bacteria 3564
484 Ga0495618_0028946 3300046514 Bacteria 3454
485 Ga0495618_0037936 3300046514 Bacteria 3027
486 Ga0495618_0054622 3300046514 Bacteria 2528
487 Ga0495618_0076446 3300046514 Bacteria 2133
488 Ga0495628_0016513 3300046516 Bacteria 6156
489 Ga0495628_0045841 3300046516 Bacteria 3474
490 Ga0495628_0119101 3300046516 Bacteria 2026
491 Ga0495628_0228382 3300046516 Bacteria 1396
492 Ga0495628_0263891 3300046516 Bacteria 1283
493 Ga0495628_0484819 3300046516 Bacteria 894
494 Ga0495630_0010206 3300046517 Bacteria 6774
495 Ga0495630_0015019 3300046517 Bacteria 5651
496 Ga0495630_0042047 3300046517 Bacteria 3413
497 Ga0495630_0051322 3300046517 Bacteria 3087
498 Ga0495630_0179597 3300046517 Bacteria 1613
499 Ga0495666_0013237 3300046526 Bacteria 4114
500 Ga0495666_0019694 3300046526 Bacteria 3346
501 Ga0495652_0002162 3300046529 Bacteria 20674
502 Ga0495652_0029506 3300046529 Bacteria 4818
503 Ga0495652_0050258 3300046529 Bacteria 3565
504 Ga0495652_0116976 3300046529 Bacteria 2133
505 Ga0495652_0174575 3300046529 Bacteria 1655
506 Ga0495665_0002247 3300046531 Bacteria 10454
507 Ga0495665_0009248 3300046531 Bacteria 5339
508 Ga0495665_0042625 3300046531 Bacteria 2415
509 Ga0495665_0281043 3300046531 Bacteria 854
510 Ga0495640_0008632 3300046533 Bacteria 7985
511 Ga0495640_0018285 3300046533 Bacteria 5202
512 Ga0495640_0029732 3300046533 Bacteria 3919
513 Ga0495640_0033947 3300046533 Bacteria 3623
514 Ga0495640_0041596 3300046533 Bacteria 3211
515 Ga0495640_0084442 3300046533 Bacteria 2106
516 Ga0495586_0031246 3300046535 Bacteria 2851
517 Ga0495586_0054388 3300046535 Bacteria 2169
518 Ga0495587_0010351 3300046536 Bacteria 5942
519 Ga0495587_0031794 3300046536 Bacteria 3193
520 Ga0495587_0045779 3300046536 Bacteria 2599
521 Ga0495587_0048334 3300046536 Bacteria 2519
522 Ga0495587_0087314 3300046536 Bacteria 1805
523 Ga0495587_0185792 3300046536 Bacteria 1177
524 Ga0495645_0012581 3300046543 Bacteria 5965
525 Ga0495645_0024380 3300046543 Bacteria 4389
526 Ga0495645_0026811 3300046543 Bacteria 4184
527 Ga0495645_0050339 3300046543 Bacteria 3033
528 Ga0495645_0074303 3300046543 Bacteria 2448
529 Ga0495645_0209202 3300046543 Bacteria 1318
530 Ga0495645_0274414 3300046543 Bacteria 1111
531 Ga0495667_0000438 3300046559 Bacteria 26630
532 Ga0495667_0164265 3300046559 Bacteria 1427
533 Ga0495667_0190956 3300046559 Bacteria 1312
534 Ga0495634_0006453 3300046642 Bacteria 8911
535 Ga0495634_0009841 3300046642 Bacteria 7033
536 Ga0495634_0020244 3300046642 Bacteria 4720
537 Ga0495634_0053029 3300046642 Bacteria 2717
538 Ga0495634_0075217 3300046642 Bacteria 2218
539 Ga0495635_0001642 3300046663 Bacteria 15081
540 Ga0495635_0002077 3300046663 Bacteria 13591
541 Ga0495635_0031047 3300046663 Bacteria 3711
542 Ga0495635_0055235 3300046663 Bacteria 2735
543 Ga0495635_0121645 3300046663 Bacteria 1780
544 Ga0495635_0244621 3300046663 Bacteria 1210
545 Ga0495588_0064334 3300046674 Bacteria 1903
546 Ga0495657_0002319 3300046675 Bacteria 16029
547 Ga0495657_0013744 3300046675 Bacteria 5960
548 Ga0495657_0025078 3300046675 Bacteria 4236
549 Ga0495657_0075475 3300046675 Bacteria 2191
550 Ga0495599_0014013 3300046678 Bacteria 4963
551 Ga0495599_0018982 3300046678 Bacteria 4286
552 Ga0495599_0073599 3300046678 Bacteria 2132
553 Ga0495623_0041847 3300046679 Bacteria 2920
554 Ga0495623_0060948 3300046679 Bacteria 2366
555 Ga0495623_0099273 3300046679 Bacteria 1776
556 Ga0495646_0020465 3300046680 Bacteria 4186
557 Ga0495646_0037660 3300046680 Bacteria 2990
558 Ga0495646_0255144 3300046680 Bacteria 938
559 Ga0495658_0001562 3300046683 Bacteria 11970
560 Ga0495658_0007166 3300046683 Bacteria 5508
561 Ga0495658_0008099 3300046683 Bacteria 5204
562 Ga0495658_0077030 3300046683 Bacteria 1950
563 Ga0495613_0006214 3300046689 Bacteria 8931
564 Ga0495613_0007771 3300046689 Bacteria 7978
565 Ga0495613_0100322 3300046689 Bacteria 2091
566 Ga0495624_0005078 3300046690 Bacteria 9514
567 Ga0495624_0025549 3300046690 Bacteria 3876
568 Ga0495600_0023502 3300046809 Bacteria 3965
569 Ga0495581_0000334 3300047315 Bacteria 23424
570 Ga0495581_0004575 3300047315 Bacteria 7991
571 Ga0495581_0068982 3300047315 Bacteria 2044
572 Ga0495604_0064587 3300047317 Bacteria 2789
573 Ga0495604_0077100 3300047317 Bacteria 2506
574 Ga0495604_0103741 3300047317 Bacteria 2085
575 Ga0495604_0273797 3300047317 Bacteria 1143
576 Ga0495674_0004016 3300047319 Bacteria 14248
577 Ga0495674_0008546 3300047319 Bacteria 9746
578 Ga0495674_0026448 3300047319 Bacteria 5309
579 Ga0495674_0041158 3300047319 Bacteria 4129
580 Ga0495674_0041840 3300047319 Bacteria 4090
581 Ga0495674_0065963 3300047319 Bacteria 3142
582 Ga0495674_0077932 3300047319 Bacteria 2848
583 Ga0495674_0150239 3300047319 Bacteria 1953
584 Ga0495674_0249824 3300047319 Unclassified 1460
585 Ga0495676_0010356 3300047321 Bacteria 8456
586 Ga0495676_0024775 3300047321 Bacteria 5186
587 Ga0495676_0198986 3300047321 Bacteria 1393
588 Ga0495680_0002773 3300047322 Bacteria 17675
589 Ga0495680_0006600 3300047322 Bacteria 10765
590 Ga0495680_0007541 3300047322 Bacteria 9951
591 Ga0495680_0008563 3300047322 Bacteria 9288
592 Ga0495680_0014491 3300047322 Bacteria 6824
593 Ga0495680_0015329 3300047322 Bacteria 6613
594 Ga0495680_0016495 3300047322 Bacteria 6342
595 Ga0495680_0051648 3300047322 Bacteria 3208
596 Ga0495675_0018562 3300047444 Bacteria 4416
597 Ga0495675_0024694 3300047444 Bacteria 3832
598 Ga0495675_0046706 3300047444 Bacteria 2756
599 Ga0495675_0090539 3300047444 Bacteria 1920
600 Ga0495675_0091433 3300047444 Bacteria 1910
601 Ga0495675_0131819 3300047444 Bacteria 1553
602 Ga0495684_0004012 3300047471 Bacteria 11481
603 Ga0495684_0013377 3300047471 Bacteria 6316
604 Ga0495684_0037457 3300047471 Bacteria 3719
605 Ga0495684_0125125 3300047471 Bacteria 1934
606 Ga0495684_0157875 3300047471 Bacteria 1693
607 Ga0495593_0002306 3300047673 Bacteria 11448
608 Ga0495593_0003796 3300047673 Bacteria 9024
609 Ga0495593_0020997 3300047673 Bacteria 3650
610 Ga0495602_0014410 3300048088 Bacteria 8026
611 Ga0495602_0021713 3300048088 Bacteria 6308
612 Ga0495602_0034829 3300048088 Bacteria 4703
613 Ga0495602_0034999 3300048088 Bacteria 4688
614 Ga0495602_0061304 3300048088 Bacteria 3272
615 Ga0495602_0088577 3300048088 Bacteria 2576
616 Ga0495602_0160970 3300048088 Bacteria 1752
617 Ga0495614_0045660 3300048089 Bacteria 1878
618 Ga0495614_0091164 3300048089 Bacteria 1326
619 Ga0496100_0031189 3300048903 Bacteria 3311
620 Ga0496101_0007606 3300048904 Bacteria 7037
621 Ga0496101_0016465 3300048904 Bacteria 4995
622 Ga0496102_0000018 3300048905 Bacteria 266847
623 Ga0496102_0140548 3300048905 Bacteria 2263
624 Ga0496102_0664112 3300048905 Bacteria 965
625 Ga0496103_0000188 3300048906 Bacteria 62595
626 Ga0496104_0028278 3300048907 Bacteria 5196
627 Ga0496104_0144388 3300048907 Bacteria 2285
628 Ga0496105_0020504 3300048908 Bacteria 5342
629 Ga0496105_0042345 3300048908 Bacteria 3753
630 Ga0496105_0093344 3300048908 Bacteria 2485
631 Ga0496105_0179762 3300048908 Bacteria 1732
632 Ga0496106_0308996 3300048909 Bacteria 1268
633 Ga0496107_0022214 3300048910 Bacteria 4483
634 Ga0496108_0119530 3300048911 Bacteria 2259
635 Ga0496108_0191796 3300048911 Bacteria 1771
636 Ga0496108_0416353 3300048911 Bacteria 1173
637 Ga0496109_0106637 3300048912 Bacteria 2602
638 Ga0496109_0210671 3300048912 Bacteria 1828
639 Ga0496110_0696170 3300048913 Bacteria 917
640 Ga0496111_0468449 3300048914 Bacteria 929
641 Ga0496112_0056240 3300048915 Bacteria 3871
642 Ga0496112_0058641 3300048915 Bacteria 3791
643 Ga0496112_0160611 3300048915 Bacteria 2214
644 Ga0496112_0266267 3300048915 Bacteria 1663
645 Ga0496113_0077699 3300048916 Bacteria 2538
646 Ga0496113_0495839 3300048916 Bacteria 981
647 Ga0496114_0011592 3300048917 Bacteria 7046
648 Ga0496114_0245261 3300048917 Bacteria 1576
649 Ga0496114_0319059 3300048917 Bacteria 1373
650 Ga0496115_0016167 3300048918 Bacteria 5675
651 Ga0496115_0048077 3300048918 Bacteria 3412
652 Ga0496115_0067682 3300048918 Bacteria 2889
653 Ga0496115_0328224 3300048918 Bacteria 1250
654 Ga0496116_0002538 3300048919 Bacteria 19116
655 Ga0496117_0000528 3300048920 Bacteria 62814
656 Ga0496118_0000136 3300048921 Bacteria 130016
657 Ga0496119_0001749 3300048922 Bacteria 25328
658 Ga0496121_0008808 3300048924 Bacteria 11753
659 Ga0496124_0001945 3300048927 Bacteria 28244
660 Ga0496125_0008449 3300048928 Bacteria 10775
661 Ga0496126_0000585 3300048929 Bacteria 68897
662 Ga0496126_0018077 3300048929 Bacteria 7001
663 Ga0496126_0464803 3300048929 Bacteria 1016
664 nmdc:mga05p37_145562_c1 3300050507 Bacteria 2902
665 nmdc:mga05p37_495152_c1 3300050507 Bacteria 1404
666 nmdc:mga05p37_9965_c1 3300050507 Bacteria 11286
667 nmdc:mga09592_109738_c1 3300050508 Bacteria 2367
668 nmdc:mga09592_486060_c1 3300050508 Bacteria 1063
669 nmdc:mga0qj67_338492_c1 3300050509 Bacteria 1217
670 nmdc:mga08y16_114293_c1 3300050511 Bacteria 2810
671 nmdc:mga0n895_141179_c1 3300050512 Bacteria 2437
672 nmdc:mga0n895_245636_c1 3300050512 Bacteria 1816
673 nmdc:mga0n895_572754_c1 3300050512 Bacteria 1134
674 nmdc:mga0n895_7305_c1 3300050512 Bacteria 9470
675 nmdc:mga0n895_89729_c1 3300050512 Bacteria 3075
676 nmdc:mga0rr50_16552_c1 3300050513 Bacteria 4902
677 nmdc:mga0rr50_210728_c1 3300050513 Bacteria 1601
678 nmdc:mga0rr50_28794_c1 3300050513 Bacteria 3909
679 nmdc:mga08x19_268877_c1 3300050514 Bacteria 1179
680 nmdc:mga08x19_319923_c1 3300050514 Bacteria 1080
681 nmdc:mga08x19_495006_c1 3300050514 Bacteria 863
682 nmdc:mga0a205_148780_c1 3300050515 Bacteria 2242
683 Ga0495601_0028268 3300053077 Bacteria 3472
684 Ga0495601_0033637 3300053077 Bacteria 3194
685 Ga0495601_0066734 3300053077 Bacteria 2291
686 Ga0495601_0073089 3300053077 Bacteria 2192
687 Ga0495601_0094995 3300053077 Bacteria 1922
688 Ga0495601_0095828 3300053077 Bacteria 1913
689 Ga0495612_0001691 3300053078 Bacteria 9077
690 Ga0495612_0017788 3300053078 Bacteria 2845
691 Ga0495612_0037837 3300053078 Bacteria 1960
692 Ga0495595_0011106 3300053084 Bacteria 3759
693 Ga0495595_0011200 3300053084 Bacteria 3746
694 Ga0495619_0003740 3300053085 Bacteria 9804
695 Ga0495619_0018879 3300053085 Bacteria 4377
696 Ga0495619_0049253 3300053085 Bacteria 2778
697 Ga0495619_0177984 3300053085 Bacteria 1471
698 2558913602 2558860112 Bacteria 9931328
699 2816510635 2816332139 Bacteria 9138787
700 2915360376 2915358134 Bacteria 6050864
701 8054478099 8054472261 Bacteria 7464355
702 Ga0070707_100070795
703 Ga0070658_10028698
704 Ga0070658_10148611
705 Ga0070658_10297550
706 Ga0070676_10045989
707 Ga0070683_100705017
708 Ga0068869_100102955
709 Ga0070666_10013496
710 Ga0070682_100055823
711 Ga0070682_100139376
712 Ga0068868_100332339
713 Ga0068868_100402525
714 Ga0068868_100419029
715 Ga0070660_100016154
716 Ga0070660_100075767
717 Ga0070689_100100305
718 Ga0070689_100359635
719 Ga0070691_10011830
720 Ga0070661_100013725
721 Ga0070661_100180560
722 Ga0070692_10114383
723 Ga0070668_100101961
724 Ga0070675_100367325
725 Ga0070671_100001775
726 Ga0070673_100076707
727 Ga0070659_100013587
728 Ga0070667_100056432
729 Ga0070709_10000363
730 Ga0070709_10000585
731 Ga0070709_10058627
732 Ga0070709_10120152
733 Ga0070709_10133480
734 Ga0070714_100000182
735 Ga0070714_100000833
736 Ga0070714_100001457
737 Ga0070714_100013642
738 Ga0070714_100047606
739 Ga0070714_100092410
740 Ga0070714_100096113
741 Ga0070714_100133498
742 Ga0070714_100362290
743 Ga0070714_100449563
744 Ga0070714_100641981
745 Ga0070713_100003768
746 Ga0070713_100035144
747 Ga0070713_100076899
748 Ga0070713_100203650
749 Ga0070713_100209335
750 Ga0070713_100353668
751 Ga0070710_10000226
752 Ga0070710_10001848
753 Ga0070710_10004208
754 Ga0070710_10004868
755 Ga0070710_10028972
756 Ga0070710_10211155
757 Ga0070710_10293147
758 Ga0070711_100001128
759 Ga0070711_100120542
760 Ga0070711_100131971
761 Ga0070711_100358796
762 Ga0070711_100462662
763 Ga0070711_100655479
764 Ga0070700_100019819
765 Ga0070708_100045869
766 Ga0070708_100100821
767 Ga0070663_100021738
768 Ga0070663_100025363
769 Ga0070678_100310074
770 Ga0070678_100609821
771 Ga0070681_10055516
772 Ga0068867_100196441
773 Ga0068867_100443643
774 Ga0070685_10048341
775 Ga0070685_10063314
776 Ga0070706_100013580
777 Ga0070706_100014081
778 Ga0070707_100095913
779 Ga0070707_100134026
780 Ga0070707_100391567
781 Ga0070707_100529942
782 Ga0070698_100001107
783 Ga0070698_100003164
784 Ga0070698_100003648
785 Ga0070698_100009913
786 Ga0070698_100030512
787 Ga0070698_100073907
788 Ga0070699_100001249
789 Ga0070699_100103431
790 Ga0070699_100119703
791 Ga0070699_100348327
792 Ga0070679_100070070
793 Ga0070679_100381758
794 Ga0070684_100088868
795 Ga0070697_100004900
796 Ga0070697_100036519
797 Ga0070686_100023801
798 Ga0070695_100100497
799 Ga0070696_100158357
800 Ga0070665_100006412
801 Ga0070665_100202311
802 Ga0070704_100158722
803 Ga0070704_100375947
804 Ga0070664_100003415
805 Ga0070664_100257912
806 Ga0068857_100069866
807 Ga0068854_100035058
808 Ga0068856_100444334
809 Ga0068856_100536644
810 Ga0068856_100712976
811 Ga0070702_100018872
812 Ga0070702_100232318
813 Ga0068859_100137226
814 Ga0068859_100499453
815 Ga0068864_100146318
816 Ga0068861_100038623
817 Ga0068863_100002321
818 Ga0068863_100094902
819 Ga0068863_100254468
820 Ga0068858_100238799
821 Ga0068860_100040813
822 Ga0068862_100080290
823 Ga0081455_10079911
824 Ga0081455_10114762
825 Ga0081455_10162345
826 Ga0081540_1000176
827 Ga0070717_10002481
828 Ga0070717_10006048
829 Ga0070717_10015178
830 Ga0070717_10063100
831 Ga0070717_10489853
832 Ga0075432_10062238
833 Ga0070715_10004571
834 Ga0070715_10012528
835 Ga0070715_10015550
836 Ga0070716_100000149
837 Ga0070716_100006815
838 Ga0070716_100155849
839 Ga0070716_100316696
840 Ga0070712_100000413
841 Ga0070712_100030533
842 Ga0070712_100036961
843 Ga0070712_100082033
844 Ga0070712_100328493
845 Ga0068871_100034413
846 Ga0075428_100149454
847 Ga0075428_100308620
848 Ga0075430_100343751
849 Ga0075431_100075896
850 Ga0075431_100362667
851 Ga0075434_100005739
852 Ga0075434_100035993
853 Ga0075434_100341159
854 Ga0075429_100163853
855 Ga0068865_100142996
856 Ga0075436_100009118
857 Ga0075436_100057718
858 Ga0075436_100167573
859 Ga0075436_100260537
860 Ga0097620_100137230
861 Ga0097620_100499408
862 Ga0075435_100024703
863 Ga0075435_100033602
864 Ga0105240_10141184
865 Ga0111539_10029949
866 Ga0111539_10066836
867 Ga0111539_10142780
868 Ga0111539_10158938
869 Ga0105245_10088620
870 Ga0105245_10180539
871 Ga0105245_10286218
872 Ga0105245_10337268
873 Ga0105247_10088938
874 Ga0105247_10185751
875 Ga0114129_10012826
876 Ga0114129_10642058
877 Ga0105242_10117020
878 Ga0105248_10064973
879 Ga0105237_10882636
880 Ga0105238_10786575
881 Ga0105249_10114500
882 Ga0105035_102819
883 Ga0099796_10083017
884 Ga0105239_10467364
885 Ga0105239_10837407
886 Ga0157338_1001985
887 Ga0157371_10009139
888 Ga0157371_10254058
889 Ga0157370_10064893
890 Ga0157370_10278585
891 Ga0157369_10178181
892 Ga0157369_10493907
893 Ga0157374_10111115
894 Ga0163162_10315891
895 Ga0157515_114685
896 Ga0163163_10004189
897 Ga0163163_10128431
898 Ga0157380_10031456
899 Ga0157380_10147293
900 Ga0182008_10133107
901 Ga0157377_10274807
902 Ga0157379_10001027
903 Ga0157379_10180558
904 Ga0157376_10173091
905 Ga0157376_10284048
906 Ga0163161_10058380
907 Ga0206356_10358345
908 Ga0206349_1773716
909 Ga0206350_10291945
910 Ga0206354_10773791
911 Ga0206353_10390560
912 Ga0213876_10084979
913 Ga0213875_10212341
914 Ga0213875_10221833
915 Ga0224712_10117714
916 Ga0224712_10194979
917 Ga0207653_10012464
918 Ga0207692_10000966
919 Ga0207692_10013096
920 Ga0207692_10064931
921 Ga0207692_10121479
922 Ga0207642_10223115
923 Ga0207688_10024382
924 Ga0207685_10024334
925 Ga0207699_10000366
926 Ga0207699_10001959
927 Ga0207699_10003408
928 Ga0207699_10003884
929 Ga0207699_10014731
930 Ga0207699_10051348
931 Ga0207643_10009448
932 Ga0207643_10122304
933 Ga0207684_10008826
934 Ga0207684_10019245
935 Ga0207684_10279629
936 Ga0207684_10456986
937 Ga0207654_10173292
938 Ga0207707_10028349
939 Ga0207693_10002752
940 Ga0207693_10072516
941 Ga0207693_10171365
942 Ga0207663_10001895
943 Ga0207663_10056739
944 Ga0207663_10085205
945 Ga0207663_10343798
946 Ga0207662_10001081
947 Ga0207657_10002955
948 Ga0207657_10081085
949 Ga0207649_10086544
950 Ga0207652_10249027
951 Ga0207646_10018866
952 Ga0207646_10023168
953 Ga0207646_10047523
954 Ga0207646_10134237
955 Ga0207646_10177223
956 Ga0207646_10364447
957 Ga0207646_10427159
958 Ga0207694_10097141
959 Ga0207659_10028288
960 Ga0207659_10275152
961 Ga0207687_10082915
962 Ga0207700_10000437
963 Ga0207700_10001974
964 Ga0207700_10003241
965 Ga0207700_10009420
966 Ga0207700_10040574
967 Ga0207700_10114516
968 Ga0207700_10122315
969 Ga0207700_10250378
970 Ga0207700_10271814
971 Ga0207700_10327701
972 Ga0207700_10396860
973 Ga0207664_10000185
974 Ga0207664_10000416
975 Ga0207664_10001256
976 Ga0207664_10015007
977 Ga0207664_10041260
978 Ga0207664_10073327
979 Ga0207664_10073790
980 Ga0207664_10097020
981 Ga0207664_10177388
982 Ga0207664_10629049
983 Ga0207644_10011115
984 Ga0207644_10051620
985 Ga0207706_10060654
986 Ga0207670_10107011
987 Ga0207670_10269834
988 Ga0207704_10420004
989 Ga0207665_10000097
990 Ga0207665_10000234
991 Ga0207665_10000457
992 Ga0207665_10008379
993 Ga0207665_10032338
994 Ga0207665_10065615
995 Ga0207665_10105099
996 Ga0207691_10151020
997 Ga0207691_10309583
998 Ga0207711_10018133
999 Ga0207689_10008280
1000 Ga0207689_10008343
1001 Ga0207661_10032444
1002 Ga0207661_10173294
1003 Ga0207651_10471580
1004 Ga0207668_10052741
1005 Ga0207668_10192258
1006 Ga0207668_10277076
1007 Ga0207640_10092925
1008 Ga0207658_10057901
1009 Ga0207677_10086289
1010 Ga0207639_10297947
1011 Ga0207678_10001939
1012 Ga0207678_10024658
1013 Ga0207708_10015930
1014 Ga0207641_10002075
1015 Ga0207641_10196397
1016 Ga0207641_10730284
1017 Ga0207648_10225903
1018 Ga0207676_10237486
1019 Ga0207674_10003214
1020 Ga0207674_10037739
1021 Ga0207674_10148084
1022 Ga0207675_100006916
1023 Ga0207675_100009944
1024 Ga0207675_100146904
1025 Ga0207683_10002008
1026 Ga0207683_10021102
1027 Ga0207698_10906762
1028 Ga0268266_10026104
1029 Ga0268266_10114238
1030 Ga0268266_10139553
1031 Ga0268266_10390284
1032 Ga0268264_10252966
1033 Ga0307513_10024279
1034 Ga0307513_10025672
1035 Ga0326468_10004221
1036 Ga0373930_0019525
1037 Ga0373959_0022735
1038 Ga0373926_0001698
1039 Ga0373926_0010380
1040 Ga0373929_0011163
1041 Ga0373934_0001661
1042 Ga0373934_0004188
1043 Ga0373934_0009807
1044 Ga0373944_0001250
1045 Ga0373944_0001307
1046 Ga0373923_0004241
1047 Ga0373923_0010967
1048 Ga0373923_0173599
1049 Ga0373936_0000136
1050 Ga0373936_0000255
1051 Ga0373936_0007607
1052 Ga0373936_0011190
1053 Ga0373936_0083346
1054 Ga0373945_0001442
1055 Ga0373945_0150424
1056 Ga0373953_0015662
1057 Ga0373953_0031801
1058 Ga0373953_0052488
1059 Ga0373953_0052960
1060 Ga0373954_0004028
1061 Ga0373954_0010013
1062 Ga0373956_0002417
1063 Ga0373956_0007704
1064 Ga0373957_0006945
1065 Ga0373957_0035415
1066 Ga0373957_0056268
1067 Ga0373957_0105883
1068 Ga0373943_0001010
1069 Ga0373943_0001481
1070 Ga0373943_0075886
1071 Ga0373943_0120500
1072 Ga0373946_0000042
1073 Ga0373946_0003285
1074 Ga0373946_0041537
1075 Ga0373946_0061767
1076 Ga0373955_0004973
1077 Ga0373955_0007890
1078 Ga0373955_0024632
1079 Ga0373955_0173934
1080 Ga0373942_0022497
1081 Ga0373962_0005290
1082 Ga0373924_0000234
1083 Ga0373924_0018690
1084 Ga0373931_0074858
1085 Ga0373935_0003363
1086 Ga0373935_0006528
1087 Ga0373935_0040943
1088 Ga0373935_0348175
1089 Ga0373927_0002474
1090 Ga0373927_0013633
1091 Ga0373927_0093925
1092 Ga0373933_0003456
1093 Ga0373933_0107612
1094 Ga0373933_0120694
1095 Ga0373933_0247967
1096 Ga0373947_0000944
1097 Ga0373947_0011829
1098 Ga0373947_0038014
1099 Ga0373947_0058874
1100 Ga0373937_0002615
1101 Ga0373937_0020697
1102 Ga0373937_0034645
1103 Ga0373937_0054896
1104 Ga0373937_0059021
1105 Ga0373937_0112423
1106 Ga0373937_0304263
1107 Ga0373937_0324184
1108 Ga0373925_0002998
1109 Ga0373925_0003140
1110 Ga0373925_0017297
1111 Ga0373925_0044869
1112 Ga0373925_0047888
1113 Ga0373925_0059929
1114 Ga0373925_0271195
1115 Ga0436364_0072739
1116 Ga0436364_0188744
1117 Ga0436364_0287407
1118 Ga0436364_0385753
1119 Ga0436364_0585527
1120 Ga0436364_0884066
1121 Ga0436365_0051225
1122 Ga0436365_0074233
1123 Ga0436363_0875728
1124 Ga0466972_0086840
1125 Ga0466965_0002074
1126 Ga0466963_0066389
1127 Ga0466964_0055903
1128 Ga0466960_0001569
1129 Ga0466960_0134846
1130 Ga0466958_0166048
1131 Ga0466967_0015291
1132 Ga0466967_0033416
1133 Ga0466967_0057155
1134 Ga0466967_0165512
1135 Ga0466967_0347151
1136 Ga0495592_0081446
1137 Ga0495603_0002385
1138 Ga0495603_0070329
1139 Ga0495629_0004467
1140 Ga0495629_0006588
1141 Ga0495641_0002810
1142 Ga0495641_0009329
1143 Ga0495641_0020029
1144 Ga0495641_0032725
1145 Ga0495651_0002945
1146 Ga0495651_0010074
1147 Ga0495651_0020289
1148 Ga0495651_0021994
1149 Ga0495651_0088131
1150 Ga0495653_0008158
1151 Ga0495653_0012670
1152 Ga0495653_0013722
1153 Ga0495653_0087584
1154 Ga0495653_0103928
1155 Ga0495653_0307754
1156 Ga0495580_0004049
1157 Ga0495582_0001282
1158 Ga0495582_0004976
1159 Ga0495582_0007862
1160 Ga0495582_0090119
1161 Ga0495639_0001660
1162 Ga0495639_0091992
1163 Ga0495662_0000892
1164 Ga0495662_0004957
1165 Ga0495662_0025885
1166 Ga0495662_0078803
1167 Ga0495664_0000213
1168 Ga0495664_0006935
1169 Ga0495664_0052365
1170 Ga0495664_0055177
1171 Ga0495664_0058691
1172 Ga0495664_0072111
1173 Ga0495664_0136594
1174 Ga0495594_0008852
1175 Ga0495594_0119109
1176 Ga0495608_0000952
1177 Ga0495608_0003331
1178 Ga0495608_0004543
1179 Ga0495608_0018759
1180 Ga0495608_0026980
1181 Ga0495608_0045203
1182 Ga0495608_0121425
1183 Ga0495608_0256323
1184 Ga0495618_0027153
1185 Ga0495618_0028946
1186 Ga0495618_0037936
1187 Ga0495618_0054622
1188 Ga0495618_0076446
1189 Ga0495628_0016513
1190 Ga0495628_0045841
1191 Ga0495628_0119101
1192 Ga0495628_0228382
1193 Ga0495628_0263891
1194 Ga0495628_0484819
1195 Ga0495630_0010206
1196 Ga0495630_0015019
1197 Ga0495630_0042047
1198 Ga0495630_0051322
1199 Ga0495630_0179597
1200 Ga0495666_0013237
1201 Ga0495666_0019694
1202 Ga0495652_0002162
1203 Ga0495652_0029506
1204 Ga0495652_0050258
1205 Ga0495652_0116976
1206 Ga0495652_0174575
1207 Ga0495665_0002247
1208 Ga0495665_0009248
1209 Ga0495665_0042625
1210 Ga0495665_0281043
1211 Ga0495640_0008632
1212 Ga0495640_0018285
1213 Ga0495640_0029732
1214 Ga0495640_0033947
1215 Ga0495640_0041596
1216 Ga0495640_0084442
1217 Ga0495586_0031246
1218 Ga0495586_0054388
1219 Ga0495587_0010351
1220 Ga0495587_0031794
1221 Ga0495587_0045779
1222 Ga0495587_0048334
1223 Ga0495587_0087314
1224 Ga0495587_0185792
1225 Ga0495645_0012581
1226 Ga0495645_0024380
1227 Ga0495645_0026811
1228 Ga0495645_0050339
1229 Ga0495645_0074303
1230 Ga0495645_0209202
1231 Ga0495645_0274414
1232 Ga0495667_0000438
1233 Ga0495667_0164265
1234 Ga0495667_0190956
1235 Ga0495634_0006453
1236 Ga0495634_0009841
1237 Ga0495634_0020244
1238 Ga0495634_0053029
1239 Ga0495634_0075217
1240 Ga0495635_0001642
1241 Ga0495635_0002077
1242 Ga0495635_0031047
1243 Ga0495635_0055235
1244 Ga0495635_0121645
1245 Ga0495635_0244621
1246 Ga0495588_0064334
1247 Ga0495657_0002319
1248 Ga0495657_0013744
1249 Ga0495657_0025078
1250 Ga0495657_0075475
1251 Ga0495599_0014013
1252 Ga0495599_0018982
1253 Ga0495599_0073599
1254 Ga0495623_0041847
1255 Ga0495623_0060948
1256 Ga0495623_0099273
1257 Ga0495646_0020465
1258 Ga0495646_0037660
1259 Ga0495646_0255144
1260 Ga0495658_0001562
1261 Ga0495658_0007166
1262 Ga0495658_0008099
1263 Ga0495658_0077030
1264 Ga0495613_0006214
1265 Ga0495613_0007771
1266 Ga0495613_0100322
1267 Ga0495624_0005078
1268 Ga0495624_0025549
1269 Ga0495600_0023502
1270 Ga0495581_0000334
1271 Ga0495581_0004575
1272 Ga0495581_0068982
1273 Ga0495604_0064587
1274 Ga0495604_0077100
1275 Ga0495604_0103741
1276 Ga0495604_0273797
1277 Ga0495674_0004016
1278 Ga0495674_0008546
1279 Ga0495674_0026448
1280 Ga0495674_0041158
1281 Ga0495674_0041840
1282 Ga0495674_0065963
1283 Ga0495674_0077932
1284 Ga0495674_0150239
1285 Ga0495674_0249824
1286 Ga0495676_0010356
1287 Ga0495676_0024775
1288 Ga0495676_0198986
1289 Ga0495680_0002773
1290 Ga0495680_0006600
1291 Ga0495680_0007541
1292 Ga0495680_0008563
1293 Ga0495680_0014491
1294 Ga0495680_0015329
1295 Ga0495680_0016495
1296 Ga0495680_0051648
1297 Ga0495675_0018562
1298 Ga0495675_0024694
1299 Ga0495675_0046706
1300 Ga0495675_0090539
1301 Ga0495675_0091433
1302 Ga0495675_0131819
1303 Ga0495684_0004012
1304 Ga0495684_0013377
1305 Ga0495684_0037457
1306 Ga0495684_0125125
1307 Ga0495684_0157875
1308 Ga0495593_0002306
1309 Ga0495593_0003796
1310 Ga0495593_0020997
1311 Ga0495602_0014410
1312 Ga0495602_0021713
1313 Ga0495602_0034829
1314 Ga0495602_0034999
1315 Ga0495602_0061304
1316 Ga0495602_0088577
1317 Ga0495602_0160970
1318 Ga0495614_0045660
1319 Ga0495614_0091164
1320 Ga0496100_0031189
1321 Ga0496101_0007606
1322 Ga0496101_0016465
1323 Ga0496102_0000018
1324 Ga0496102_0140548
1325 Ga0496102_0664112
1326 Ga0496103_0000188
1327 Ga0496104_0028278
1328 Ga0496104_0144388
1329 Ga0496105_0020504
1330 Ga0496105_0042345
1331 Ga0496105_0093344
1332 Ga0496105_0179762
1333 Ga0496106_0308996
1334 Ga0496107_0022214
1335 Ga0496108_0119530
1336 Ga0496108_0191796
1337 Ga0496108_0416353
1338 Ga0496109_0106637
1339 Ga0496109_0210671
1340 Ga0496110_0696170
1341 Ga0496111_0468449
1342 Ga0496112_0056240
1343 Ga0496112_0058641
1344 Ga0496112_0160611
1345 Ga0496112_0266267
1346 Ga0496113_0077699
1347 Ga0496113_0495839
1348 Ga0496114_0011592
1349 Ga0496114_0245261
1350 Ga0496114_0319059
1351 Ga0496115_0016167
1352 Ga0496115_0048077
1353 Ga0496115_0067682
1354 Ga0496115_0328224
1355 Ga0496116_0002538
1356 Ga0496117_0000528
1357 Ga0496118_0000136
1358 Ga0496119_0001749
1359 Ga0496121_0008808
1360 Ga0496124_0001945
1361 Ga0496125_0008449
1362 Ga0496126_0000585
1363 Ga0496126_0018077
1364 Ga0496126_0464803
1365 nmdc:mga05p37_145562_c1
1366 nmdc:mga05p37_495152_c1
1367 nmdc:mga05p37_9965_c1
1368 nmdc:mga09592_109738_c1
1369 nmdc:mga09592_486060_c1
1370 nmdc:mga0qj67_338492_c1
1371 nmdc:mga08y16_114293_c1
1372 nmdc:mga0n895_141179_c1
1373 nmdc:mga0n895_245636_c1
1374 nmdc:mga0n895_572754_c1
1375 nmdc:mga0n895_7305_c1
1376 nmdc:mga0n895_89729_c1
1377 nmdc:mga0rr50_16552_c1
1378 nmdc:mga0rr50_210728_c1
1379 nmdc:mga0rr50_28794_c1
1380 nmdc:mga08x19_268877_c1
1381 nmdc:mga08x19_319923_c1
1382 nmdc:mga08x19_495006_c1
1383 nmdc:mga0a205_148780_c1
1384 Ga0495601_0028268
1385 Ga0495601_0033637
1386 Ga0495601_0066734
1387 Ga0495601_0073089
1388 Ga0495601_0094995
1389 Ga0495601_0095828
1390 Ga0495612_0001691
1391 Ga0495612_0017788
1392 Ga0495612_0037837
1393 Ga0495595_0011106
1394 Ga0495595_0011200
1395 Ga0495619_0003740
1396 Ga0495619_0018879
1397 Ga0495619_0049253
1398 Ga0495619_0177984
1399 2558913602
1400 2816510635
1401 2915360376
1402 8054478099

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01812

5-FTHF_cyc-lig

5-formyltetrahydrofolate cyclo-ligase family

58

252

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3zig-assembly2.cif.gz_B sepf-like protein from pyrococcus furiosus 0.7458 72 99
1ydm-assembly1.cif.gz_A x-ray structure of northeast structural genomics target sr44 0.7333 25 223
1ydm-assembly1.cif.gz_A x-ray structure of northeast structural genomics target sr44 0.7222 25 223
1ydm-assembly1.cif.gz_B x-ray structure of northeast structural genomics target sr44 0.7164 25 223
1wkc-assembly1.cif.gz_A crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from thermus thermophilus hb8 0.7119 22 227
ID Description Score Start End Superfamily
af_K7K717_81_247_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9102 54 222 3.40.50.10420
af_Q0P464_46_270_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9014 55 256 3.40.50.10420
af_Q3URQ7_10_217_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8983 24 227 3.40.50.10420
af_K7K717_81_247_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8947 54 222 3.40.50.10420
af_Q2M296_43_218_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8943 55 227 3.40.50.10420
ID Description Score Start End GO Terms
AF-A0A534X374-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase 0.9624 22 160 GO:0005737
AF-A0A1I5ATK4-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase 0.9585 14 154 GO:0005737
GO:0016874
AF-A0A411YAR1-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase 0.9562 7 258 GO:0005737
GO:0016874
AF-A0A6H1WS78-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase 0.9561 15 228 GO:0005737
GO:0016874
AF-A0A151FC49-F1-model_v4 Probable RNA 2'-phosphotransferase (EC 2.7.1.-) 0.953 18 223 GO:0003950
GO:0005737
GO:0006388
GO:0016772

Map