F476146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 701 | 277 | 1402 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300005468|Ga0070707_100070795|Ga0070707_1000707953 |
| Length | 296 |
| Sequence | MPATSGGGLSPSRGPGGALPRRCPTYRTTHLGPVRVAAASKTSRLWLALEPVRGLPAAALREEVWAAMSAARVARFPGAAGRIPNFTGAEAAAERLRGLPEWRRAGTLKVNPDLPQLPVRQRALEDGKTVYMAVPRLAEAEPFFALDPDHLSEPPRKAASISGAARSAHRVSLAELTPVDLVVMGSVAVGEDGARLGKGGGFADLEFALAGAAGLIGPGTVTATTVHELQVRPAGMVPLTAHDVPVDLVITPDRVIDCRGRRGERPAPGIRWPELTEEKIAAIPLLASQRARQHRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 68 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 83 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 105 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 106 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 156 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 157 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 161 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 176 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 187 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 190 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 275 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 276 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 277 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.43 |
| Metatranscriptomes | 1 |
| Isolates | 0.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.99 |
| Rhizosphere | 91.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070707_100070795 | 3300005468 | Bacteria | 3359 |
| 2 | Ga0070658_10028698 | 3300005327 | Bacteria | 4468 |
| 3 | Ga0070658_10148611 | 3300005327 | Bacteria | 1960 |
| 4 | Ga0070658_10297550 | 3300005327 | Bacteria | 1376 |
| 5 | Ga0070676_10045989 | 3300005328 | Bacteria | 2544 |
| 6 | Ga0070683_100705017 | 3300005329 | Bacteria | 967 |
| 7 | Ga0068869_100102955 | 3300005334 | Bacteria | 2162 |
| 8 | Ga0070666_10013496 | 3300005335 | Bacteria | 5185 |
| 9 | Ga0070682_100055823 | 3300005337 | Bacteria | 2482 |
| 10 | Ga0070682_100139376 | 3300005337 | Bacteria | 1651 |
| 11 | Ga0068868_100332339 | 3300005338 | Bacteria | 1297 |
| 12 | Ga0068868_100402525 | 3300005338 | Bacteria | 1181 |
| 13 | Ga0068868_100419029 | 3300005338 | Bacteria | 1159 |
| 14 | Ga0070660_100016154 | 3300005339 | Bacteria | 5412 |
| 15 | Ga0070660_100075767 | 3300005339 | Bacteria | 2634 |
| 16 | Ga0070689_100100305 | 3300005340 | Bacteria | 2291 |
| 17 | Ga0070689_100359635 | 3300005340 | Bacteria | 1223 |
| 18 | Ga0070691_10011830 | 3300005341 | Bacteria | 3992 |
| 19 | Ga0070661_100013725 | 3300005344 | Bacteria | 5691 |
| 20 | Ga0070661_100180560 | 3300005344 | Bacteria | 1605 |
| 21 | Ga0070692_10114383 | 3300005345 | Bacteria | 1496 |
| 22 | Ga0070668_100101961 | 3300005347 | Bacteria | 2275 |
| 23 | Ga0070675_100367325 | 3300005354 | Bacteria | 1279 |
| 24 | Ga0070671_100001775 | 3300005355 | Bacteria | 16387 |
| 25 | Ga0070673_100076707 | 3300005364 | Bacteria | 2700 |
| 26 | Ga0070659_100013587 | 3300005366 | Bacteria | 6064 |
| 27 | Ga0070667_100056432 | 3300005367 | Bacteria | 3318 |
| 28 | Ga0070709_10000363 | 3300005434 | Bacteria | 28041 |
| 29 | Ga0070709_10000585 | 3300005434 | Bacteria | 21344 |
| 30 | Ga0070709_10058627 | 3300005434 | Bacteria | 2442 |
| 31 | Ga0070709_10120152 | 3300005434 | Bacteria | 1780 |
| 32 | Ga0070709_10133480 | 3300005434 | Bacteria | 1697 |
| 33 | Ga0070714_100000182 | 3300005435 | Bacteria | 50060 |
| 34 | Ga0070714_100000833 | 3300005435 | Bacteria | 21830 |
| 35 | Ga0070714_100001457 | 3300005435 | Bacteria | 17233 |
| 36 | Ga0070714_100013642 | 3300005435 | Bacteria | 6515 |
| 37 | Ga0070714_100047606 | 3300005435 | Bacteria | 3644 |
| 38 | Ga0070714_100092410 | 3300005435 | Bacteria | 2652 |
| 39 | Ga0070714_100096113 | 3300005435 | Bacteria | 2602 |
| 40 | Ga0070714_100133498 | 3300005435 | Bacteria | 2220 |
| 41 | Ga0070714_100362290 | 3300005435 | Bacteria | 1363 |
| 42 | Ga0070714_100449563 | 3300005435 | Bacteria | 1224 |
| 43 | Ga0070714_100641981 | 3300005435 | Bacteria | 1021 |
| 44 | Ga0070713_100003768 | 3300005436 | Bacteria | 10039 |
| 45 | Ga0070713_100035144 | 3300005436 | Bacteria | 4032 |
| 46 | Ga0070713_100076899 | 3300005436 | Bacteria | 2836 |
| 47 | Ga0070713_100203650 | 3300005436 | Bacteria | 1788 |
| 48 | Ga0070713_100209335 | 3300005436 | Bacteria | 1765 |
| 49 | Ga0070713_100353668 | 3300005436 | Bacteria | 1363 |
| 50 | Ga0070710_10000226 | 3300005437 | Bacteria | 26288 |
| 51 | Ga0070710_10001848 | 3300005437 | Bacteria | 9985 |
| 52 | Ga0070710_10004208 | 3300005437 | Bacteria | 6821 |
| 53 | Ga0070710_10004868 | 3300005437 | Bacteria | 6351 |
| 54 | Ga0070710_10028972 | 3300005437 | Bacteria | 2966 |
| 55 | Ga0070710_10211155 | 3300005437 | Bacteria | 1230 |
| 56 | Ga0070710_10293147 | 3300005437 | Bacteria | 1059 |
| 57 | Ga0070711_100001128 | 3300005439 | Bacteria | 14280 |
| 58 | Ga0070711_100120542 | 3300005439 | Bacteria | 1939 |
| 59 | Ga0070711_100131971 | 3300005439 | Bacteria | 1861 |
| 60 | Ga0070711_100358796 | 3300005439 | Bacteria | 1173 |
| 61 | Ga0070711_100462662 | 3300005439 | Bacteria | 1040 |
| 62 | Ga0070711_100655479 | 3300005439 | Bacteria | 880 |
| 63 | Ga0070700_100019819 | 3300005441 | Bacteria | 3887 |
| 64 | Ga0070708_100045869 | 3300005445 | Bacteria | 3853 |
| 65 | Ga0070708_100100821 | 3300005445 | Bacteria | 2643 |
| 66 | Ga0070663_100021738 | 3300005455 | Bacteria | 4273 |
| 67 | Ga0070663_100025363 | 3300005455 | Bacteria | 4001 |
| 68 | Ga0070678_100310074 | 3300005456 | Bacteria | 1344 |
| 69 | Ga0070678_100609821 | 3300005456 | Bacteria | 975 |
| 70 | Ga0070681_10055516 | 3300005458 | Bacteria | 3943 |
| 71 | Ga0068867_100196441 | 3300005459 | Bacteria | 1613 |
| 72 | Ga0068867_100443643 | 3300005459 | Bacteria | 1104 |
| 73 | Ga0070685_10048341 | 3300005466 | Bacteria | 2450 |
| 74 | Ga0070685_10063314 | 3300005466 | Bacteria | 2171 |
| 75 | Ga0070706_100013580 | 3300005467 | Bacteria | 7529 |
| 76 | Ga0070706_100014081 | 3300005467 | Bacteria | 7390 |
| 77 | Ga0070707_100095913 | 3300005468 | Bacteria | 2872 |
| 78 | Ga0070707_100134026 | 3300005468 | Bacteria | 2410 |
| 79 | Ga0070707_100391567 | 3300005468 | Bacteria | 1349 |
| 80 | Ga0070707_100529942 | 3300005468 | Bacteria | 1140 |
| 81 | Ga0070698_100001107 | 3300005471 | Bacteria | 29722 |
| 82 | Ga0070698_100003164 | 3300005471 | Bacteria | 18145 |
| 83 | Ga0070698_100003648 | 3300005471 | Bacteria | 16903 |
| 84 | Ga0070698_100009913 | 3300005471 | Bacteria | 10184 |
| 85 | Ga0070698_100030512 | 3300005471 | Bacteria | 5588 |
| 86 | Ga0070698_100073907 | 3300005471 | Bacteria | 3414 |
| 87 | Ga0070699_100001249 | 3300005518 | Bacteria | 23432 |
| 88 | Ga0070699_100103431 | 3300005518 | Bacteria | 2497 |
| 89 | Ga0070699_100119703 | 3300005518 | Bacteria | 2314 |
| 90 | Ga0070699_100348327 | 3300005518 | Unclassified | 1334 |
| 91 | Ga0070679_100070070 | 3300005530 | Bacteria | 3498 |
| 92 | Ga0070679_100381758 | 3300005530 | Bacteria | 1356 |
| 93 | Ga0070684_100088868 | 3300005535 | Bacteria | 2745 |
| 94 | Ga0070697_100004900 | 3300005536 | Bacteria | 10275 |
| 95 | Ga0070697_100036519 | 3300005536 | Bacteria | 3970 |
| 96 | Ga0070686_100023801 | 3300005544 | Bacteria | 3666 |
| 97 | Ga0070695_100100497 | 3300005545 | Bacteria | 1947 |
| 98 | Ga0070696_100158357 | 3300005546 | Bacteria | 1667 |
| 99 | Ga0070665_100006412 | 3300005548 | Bacteria | 11975 |
| 100 | Ga0070665_100202311 | 3300005548 | Bacteria | 1986 |
| 101 | Ga0070704_100158722 | 3300005549 | Bacteria | 1786 |
| 102 | Ga0070704_100375947 | 3300005549 | Bacteria | 1206 |
| 103 | Ga0070664_100003415 | 3300005564 | Bacteria | 12825 |
| 104 | Ga0070664_100257912 | 3300005564 | Bacteria | 1568 |
| 105 | Ga0068857_100069866 | 3300005577 | Bacteria | 3127 |
| 106 | Ga0068854_100035058 | 3300005578 | Bacteria | 3510 |
| 107 | Ga0068856_100444334 | 3300005614 | Bacteria | 1317 |
| 108 | Ga0068856_100536644 | 3300005614 | Bacteria | 1191 |
| 109 | Ga0068856_100712976 | 3300005614 | Bacteria | 1023 |
| 110 | Ga0070702_100018872 | 3300005615 | Bacteria | 3585 |
| 111 | Ga0070702_100232318 | 3300005615 | Bacteria | 1240 |
| 112 | Ga0068859_100137226 | 3300005617 | Bacteria | 2519 |
| 113 | Ga0068859_100499453 | 3300005617 | Bacteria | 1312 |
| 114 | Ga0068864_100146318 | 3300005618 | Bacteria | 2136 |
| 115 | Ga0068861_100038623 | 3300005719 | Bacteria | 3558 |
| 116 | Ga0068863_100002321 | 3300005841 | Bacteria | 18912 |
| 117 | Ga0068863_100094902 | 3300005841 | Bacteria | 2831 |
| 118 | Ga0068863_100254468 | 3300005841 | Bacteria | 1697 |
| 119 | Ga0068858_100238799 | 3300005842 | Bacteria | 1724 |
| 120 | Ga0068860_100040813 | 3300005843 | Bacteria | 4434 |
| 121 | Ga0068862_100080290 | 3300005844 | Bacteria | 2828 |
| 122 | Ga0081455_10079911 | 3300005937 | Bacteria | 2683 |
| 123 | Ga0081455_10114762 | 3300005937 | Bacteria | 2133 |
| 124 | Ga0081455_10162345 | 3300005937 | Bacteria | 1711 |
| 125 | Ga0081540_1000176 | 3300005983 | Bacteria | 67057 |
| 126 | Ga0070717_10002481 | 3300006028 | Bacteria | 13029 |
| 127 | Ga0070717_10006048 | 3300006028 | Bacteria | 8872 |
| 128 | Ga0070717_10015178 | 3300006028 | Bacteria | 5943 |
| 129 | Ga0070717_10063100 | 3300006028 | Bacteria | 3074 |
| 130 | Ga0070717_10489853 | 3300006028 | Bacteria | 1110 |
| 131 | Ga0075432_10062238 | 3300006058 | Bacteria | 1330 |
| 132 | Ga0070715_10004571 | 3300006163 | Bacteria | 4558 |
| 133 | Ga0070715_10012528 | 3300006163 | Bacteria | 3090 |
| 134 | Ga0070715_10015550 | 3300006163 | Bacteria | 2842 |
| 135 | Ga0070716_100000149 | 3300006173 | Bacteria | 28054 |
| 136 | Ga0070716_100006815 | 3300006173 | Bacteria | 5599 |
| 137 | Ga0070716_100155849 | 3300006173 | Bacteria | 1474 |
| 138 | Ga0070716_100316696 | 3300006173 | Bacteria | 1091 |
| 139 | Ga0070712_100000413 | 3300006175 | Bacteria | 24419 |
| 140 | Ga0070712_100030533 | 3300006175 | Bacteria | 3622 |
| 141 | Ga0070712_100036961 | 3300006175 | Bacteria | 3325 |
| 142 | Ga0070712_100082033 | 3300006175 | Bacteria | 2338 |
| 143 | Ga0070712_100328493 | 3300006175 | Bacteria | 1245 |
| 144 | Ga0068871_100034413 | 3300006358 | Bacteria | 4020 |
| 145 | Ga0075428_100149454 | 3300006844 | Bacteria | 2538 |
| 146 | Ga0075428_100308620 | 3300006844 | Bacteria | 1701 |
| 147 | Ga0075430_100343751 | 3300006846 | Bacteria | 1232 |
| 148 | Ga0075431_100075896 | 3300006847 | Bacteria | 3469 |
| 149 | Ga0075431_100362667 | 3300006847 | Bacteria | 1455 |
| 150 | Ga0075434_100005739 | 3300006871 | Bacteria | 11331 |
| 151 | Ga0075434_100035993 | 3300006871 | Bacteria | 4895 |
| 152 | Ga0075434_100341159 | 3300006871 | Bacteria | 1519 |
| 153 | Ga0075429_100163853 | 3300006880 | Bacteria | 1947 |
| 154 | Ga0068865_100142996 | 3300006881 | Bacteria | 1806 |
| 155 | Ga0075436_100009118 | 3300006914 | Bacteria | 6788 |
| 156 | Ga0075436_100057718 | 3300006914 | Bacteria | 2680 |
| 157 | Ga0075436_100167573 | 3300006914 | Bacteria | 1550 |
| 158 | Ga0075436_100260537 | 3300006914 | Bacteria | 1236 |
| 159 | Ga0097620_100137230 | 3300006931 | Bacteria | 2519 |
| 160 | Ga0097620_100499408 | 3300006931 | Bacteria | 1312 |
| 161 | Ga0075435_100024703 | 3300007076 | Bacteria | 4667 |
| 162 | Ga0075435_100033602 | 3300007076 | Bacteria | 4057 |
| 163 | Ga0105240_10141184 | 3300009093 | Bacteria | 2880 |
| 164 | Ga0111539_10029949 | 3300009094 | Bacteria | 6620 |
| 165 | Ga0111539_10066836 | 3300009094 | Bacteria | 4247 |
| 166 | Ga0111539_10142780 | 3300009094 | Bacteria | 2803 |
| 167 | Ga0111539_10158938 | 3300009094 | Bacteria | 2644 |
| 168 | Ga0105245_10088620 | 3300009098 | Bacteria | 2842 |
| 169 | Ga0105245_10180539 | 3300009098 | Bacteria | 2016 |
| 170 | Ga0105245_10286218 | 3300009098 | Bacteria | 1613 |
| 171 | Ga0105245_10337268 | 3300009098 | Bacteria | 1490 |
| 172 | Ga0105247_10088938 | 3300009101 | Bacteria | 1958 |
| 173 | Ga0105247_10185751 | 3300009101 | Bacteria | 1390 |
| 174 | Ga0114129_10012826 | 3300009147 | Bacteria | 11927 |
| 175 | Ga0114129_10642058 | 3300009147 | Bacteria | 1371 |
| 176 | Ga0105242_10117020 | 3300009176 | Bacteria | 2281 |
| 177 | Ga0105248_10064973 | 3300009177 | Bacteria | 4096 |
| 178 | Ga0105237_10882636 | 3300009545 | Bacteria | 901 |
| 179 | Ga0105238_10786575 | 3300009551 | Bacteria | 967 |
| 180 | Ga0105249_10114500 | 3300009553 | Bacteria | 2553 |
| 181 | Ga0105035_102819 | 3300009988 | Bacteria | 1302 |
| 182 | Ga0099796_10083017 | 3300010159 | Bacteria | 1178 |
| 183 | Ga0105239_10467364 | 3300010375 | Bacteria | 1432 |
| 184 | Ga0105239_10837407 | 3300010375 | Bacteria | 1055 |
| 185 | Ga0157338_1001985 | 3300012515 | Bacteria | 1552 |
| 186 | Ga0157371_10009139 | 3300013102 | Bacteria | 7828 |
| 187 | Ga0157371_10254058 | 3300013102 | Bacteria | 1266 |
| 188 | Ga0157370_10064893 | 3300013104 | Bacteria | 3455 |
| 189 | Ga0157370_10278585 | 3300013104 | Bacteria | 1545 |
| 190 | Ga0157369_10178181 | 3300013105 | Bacteria | 2237 |
| 191 | Ga0157369_10493907 | 3300013105 | Bacteria | 1266 |
| 192 | Ga0157374_10111115 | 3300013296 | Bacteria | 2636 |
| 193 | Ga0163162_10315891 | 3300013306 | Bacteria | 1695 |
| 194 | Ga0157515_114685 | 3300013875 | Bacteria | 1135 |
| 195 | Ga0163163_10004189 | 3300014325 | Bacteria | 12288 |
| 196 | Ga0163163_10128431 | 3300014325 | Bacteria | 2574 |
| 197 | Ga0157380_10031456 | 3300014326 | Bacteria | 4074 |
| 198 | Ga0157380_10147293 | 3300014326 | Bacteria | 2030 |
| 199 | Ga0182008_10133107 | 3300014497 | Bacteria | 1241 |
| 200 | Ga0157377_10274807 | 3300014745 | Bacteria | 1102 |
| 201 | Ga0157379_10001027 | 3300014968 | Bacteria | 22681 |
| 202 | Ga0157379_10180558 | 3300014968 | Bacteria | 1907 |
| 203 | Ga0157376_10173091 | 3300014969 | Bacteria | 1967 |
| 204 | Ga0157376_10284048 | 3300014969 | Bacteria | 1560 |
| 205 | Ga0163161_10058380 | 3300017792 | Bacteria | 2805 |
| 206 | Ga0206356_10358345 | 3300020070 | Bacteria | 2611 |
| 207 | Ga0206349_1773716 | 3300020075 | Bacteria | 1063 |
| 208 | Ga0206350_10291945 | 3300020080 | Bacteria | 1621 |
| 209 | Ga0206354_10773791 | 3300020081 | Bacteria | 2510 |
| 210 | Ga0206353_10390560 | 3300020082 | Bacteria | 2153 |
| 211 | Ga0213876_10084979 | 3300021384 | Bacteria | 1674 |
| 212 | Ga0213875_10212341 | 3300021388 | Bacteria | 911 |
| 213 | Ga0213875_10221833 | 3300021388 | Bacteria | 890 |
| 214 | Ga0224712_10117714 | 3300022467 | Bacteria | 1147 |
| 215 | Ga0224712_10194979 | 3300022467 | Bacteria | 919 |
| 216 | Ga0207653_10012464 | 3300025885 | Bacteria | 2654 |
| 217 | Ga0207692_10000966 | 3300025898 | Bacteria | 10455 |
| 218 | Ga0207692_10013096 | 3300025898 | Bacteria | 3588 |
| 219 | Ga0207692_10064931 | 3300025898 | Bacteria | 1902 |
| 220 | Ga0207692_10121479 | 3300025898 | Bacteria | 1463 |
| 221 | Ga0207642_10223115 | 3300025899 | Bacteria | 1054 |
| 222 | Ga0207688_10024382 | 3300025901 | Bacteria | 3317 |
| 223 | Ga0207685_10024334 | 3300025905 | Bacteria | 2075 |
| 224 | Ga0207699_10000366 | 3300025906 | Bacteria | 23940 |
| 225 | Ga0207699_10001959 | 3300025906 | Bacteria | 9717 |
| 226 | Ga0207699_10003408 | 3300025906 | Bacteria | 7581 |
| 227 | Ga0207699_10003884 | 3300025906 | Bacteria | 7137 |
| 228 | Ga0207699_10014731 | 3300025906 | Bacteria | 4041 |
| 229 | Ga0207699_10051348 | 3300025906 | Bacteria | 2436 |
| 230 | Ga0207643_10009448 | 3300025908 | Bacteria | 5238 |
| 231 | Ga0207643_10122304 | 3300025908 | Bacteria | 1543 |
| 232 | Ga0207684_10008826 | 3300025910 | Bacteria | 8948 |
| 233 | Ga0207684_10019245 | 3300025910 | Bacteria | 5841 |
| 234 | Ga0207684_10279629 | 3300025910 | Bacteria | 1439 |
| 235 | Ga0207684_10456986 | 3300025910 | Bacteria | 1096 |
| 236 | Ga0207654_10173292 | 3300025911 | Bacteria | 1403 |
| 237 | Ga0207707_10028349 | 3300025912 | Bacteria | 4894 |
| 238 | Ga0207693_10002752 | 3300025915 | Bacteria | 15229 |
| 239 | Ga0207693_10072516 | 3300025915 | Bacteria | 2696 |
| 240 | Ga0207693_10171365 | 3300025915 | Bacteria | 1709 |
| 241 | Ga0207663_10001895 | 3300025916 | Bacteria | 9892 |
| 242 | Ga0207663_10056739 | 3300025916 | Bacteria | 2465 |
| 243 | Ga0207663_10085205 | 3300025916 | Bacteria | 2080 |
| 244 | Ga0207663_10343798 | 3300025916 | Bacteria | 1127 |
| 245 | Ga0207662_10001081 | 3300025918 | Bacteria | 12802 |
| 246 | Ga0207657_10002955 | 3300025919 | Bacteria | 18244 |
| 247 | Ga0207657_10081085 | 3300025919 | Bacteria | 2726 |
| 248 | Ga0207649_10086544 | 3300025920 | Bacteria | 2042 |
| 249 | Ga0207652_10249027 | 3300025921 | Bacteria | 1602 |
| 250 | Ga0207646_10018866 | 3300025922 | Bacteria | 6423 |
| 251 | Ga0207646_10023168 | 3300025922 | Bacteria | 5707 |
| 252 | Ga0207646_10047523 | 3300025922 | Bacteria | 3849 |
| 253 | Ga0207646_10134237 | 3300025922 | Bacteria | 2228 |
| 254 | Ga0207646_10177223 | 3300025922 | Bacteria | 1925 |
| 255 | Ga0207646_10364447 | 3300025922 | Bacteria | 1305 |
| 256 | Ga0207646_10427159 | 3300025922 | Bacteria | 1196 |
| 257 | Ga0207694_10097141 | 3300025924 | Bacteria | 2330 |
| 258 | Ga0207659_10028288 | 3300025926 | Bacteria | 3808 |
| 259 | Ga0207659_10275152 | 3300025926 | Bacteria | 1374 |
| 260 | Ga0207687_10082915 | 3300025927 | Bacteria | 2320 |
| 261 | Ga0207700_10000437 | 3300025928 | Bacteria | 24528 |
| 262 | Ga0207700_10001974 | 3300025928 | Bacteria | 11686 |
| 263 | Ga0207700_10003241 | 3300025928 | Bacteria | 9404 |
| 264 | Ga0207700_10009420 | 3300025928 | Bacteria | 6099 |
| 265 | Ga0207700_10040574 | 3300025928 | Bacteria | 3398 |
| 266 | Ga0207700_10114516 | 3300025928 | Bacteria | 2176 |
| 267 | Ga0207700_10122315 | 3300025928 | Bacteria | 2112 |
| 268 | Ga0207700_10250378 | 3300025928 | Bacteria | 1513 |
| 269 | Ga0207700_10271814 | 3300025928 | Bacteria | 1455 |
| 270 | Ga0207700_10327701 | 3300025928 | Bacteria | 1328 |
| 271 | Ga0207700_10396860 | 3300025928 | Bacteria | 1208 |
| 272 | Ga0207664_10000185 | 3300025929 | Bacteria | 47364 |
| 273 | Ga0207664_10000416 | 3300025929 | Bacteria | 30401 |
| 274 | Ga0207664_10001256 | 3300025929 | Bacteria | 16725 |
| 275 | Ga0207664_10015007 | 3300025929 | Bacteria | 5611 |
| 276 | Ga0207664_10041260 | 3300025929 | Bacteria | 3594 |
| 277 | Ga0207664_10073327 | 3300025929 | Bacteria | 2762 |
| 278 | Ga0207664_10073790 | 3300025929 | Bacteria | 2754 |
| 279 | Ga0207664_10097020 | 3300025929 | Bacteria | 2427 |
| 280 | Ga0207664_10177388 | 3300025929 | Bacteria | 1827 |
| 281 | Ga0207664_10629049 | 3300025929 | Bacteria | 964 |
| 282 | Ga0207644_10011115 | 3300025931 | Bacteria | 5947 |
| 283 | Ga0207644_10051620 | 3300025931 | Bacteria | 2952 |
| 284 | Ga0207706_10060654 | 3300025933 | Bacteria | 3331 |
| 285 | Ga0207670_10107011 | 3300025936 | Bacteria | 2007 |
| 286 | Ga0207670_10269834 | 3300025936 | Bacteria | 1322 |
| 287 | Ga0207704_10420004 | 3300025938 | Bacteria | 1060 |
| 288 | Ga0207665_10000097 | 3300025939 | Bacteria | 56851 |
| 289 | Ga0207665_10000234 | 3300025939 | Bacteria | 37889 |
| 290 | Ga0207665_10000457 | 3300025939 | Bacteria | 28144 |
| 291 | Ga0207665_10008379 | 3300025939 | Bacteria | 6821 |
| 292 | Ga0207665_10032338 | 3300025939 | Bacteria | 3463 |
| 293 | Ga0207665_10065615 | 3300025939 | Bacteria | 2469 |
| 294 | Ga0207665_10105099 | 3300025939 | Bacteria | 1977 |
| 295 | Ga0207691_10151020 | 3300025940 | Bacteria | 2042 |
| 296 | Ga0207691_10309583 | 3300025940 | Bacteria | 1356 |
| 297 | Ga0207711_10018133 | 3300025941 | Bacteria | 5852 |
| 298 | Ga0207689_10008280 | 3300025942 | Bacteria | 9064 |
| 299 | Ga0207689_10008343 | 3300025942 | Bacteria | 9024 |
| 300 | Ga0207661_10032444 | 3300025944 | Bacteria | 4046 |
| 301 | Ga0207661_10173294 | 3300025944 | Bacteria | 1879 |
| 302 | Ga0207651_10471580 | 3300025960 | Bacteria | 1080 |
| 303 | Ga0207668_10052741 | 3300025972 | Bacteria | 2815 |
| 304 | Ga0207668_10192258 | 3300025972 | Bacteria | 1618 |
| 305 | Ga0207668_10277076 | 3300025972 | Bacteria | 1374 |
| 306 | Ga0207640_10092925 | 3300025981 | Bacteria | 2094 |
| 307 | Ga0207658_10057901 | 3300025986 | Bacteria | 2882 |
| 308 | Ga0207677_10086289 | 3300026023 | Bacteria | 2268 |
| 309 | Ga0207639_10297947 | 3300026041 | Bacteria | 1424 |
| 310 | Ga0207678_10001939 | 3300026067 | Bacteria | 18882 |
| 311 | Ga0207678_10024658 | 3300026067 | Bacteria | 5253 |
| 312 | Ga0207708_10015930 | 3300026075 | Bacteria | 5645 |
| 313 | Ga0207641_10002075 | 3300026088 | Bacteria | 18994 |
| 314 | Ga0207641_10196397 | 3300026088 | Bacteria | 1857 |
| 315 | Ga0207641_10730284 | 3300026088 | Bacteria | 977 |
| 316 | Ga0207648_10225903 | 3300026089 | Bacteria | 1665 |
| 317 | Ga0207676_10237486 | 3300026095 | Bacteria | 1633 |
| 318 | Ga0207674_10003214 | 3300026116 | Bacteria | 20123 |
| 319 | Ga0207674_10037739 | 3300026116 | Bacteria | 5021 |
| 320 | Ga0207674_10148084 | 3300026116 | Bacteria | 2305 |
| 321 | Ga0207675_100006916 | 3300026118 | Bacteria | 10733 |
| 322 | Ga0207675_100009944 | 3300026118 | Bacteria | 8905 |
| 323 | Ga0207675_100146904 | 3300026118 | Bacteria | 2242 |
| 324 | Ga0207683_10002008 | 3300026121 | Bacteria | 17994 |
| 325 | Ga0207683_10021102 | 3300026121 | Bacteria | 5575 |
| 326 | Ga0207698_10906762 | 3300026142 | Bacteria | 889 |
| 327 | Ga0268266_10026104 | 3300028379 | Bacteria | 4970 |
| 328 | Ga0268266_10114238 | 3300028379 | Bacteria | 2396 |
| 329 | Ga0268266_10139553 | 3300028379 | Bacteria | 2174 |
| 330 | Ga0268266_10390284 | 3300028379 | Bacteria | 1314 |
| 331 | Ga0268264_10252966 | 3300028381 | Bacteria | 1637 |
| 332 | Ga0307513_10024279 | 3300031456 | Bacteria | 7056 |
| 333 | Ga0307513_10025672 | 3300031456 | Bacteria | 6818 |
| 334 | Ga0326468_10004221 | 3300031889 | Bacteria | 1247 |
| 335 | Ga0373930_0019525 | 3300034816 | Bacteria | 1312 |
| 336 | Ga0373959_0022735 | 3300034820 | Bacteria | 1214 |
| 337 | Ga0373926_0001698 | 3300035083 | Bacteria | 6817 |
| 338 | Ga0373926_0010380 | 3300035083 | Bacteria | 3121 |
| 339 | Ga0373929_0011163 | 3300035085 | Bacteria | 1689 |
| 340 | Ga0373934_0001661 | 3300035086 | Bacteria | 8161 |
| 341 | Ga0373934_0004188 | 3300035086 | Bacteria | 5320 |
| 342 | Ga0373934_0009807 | 3300035086 | Bacteria | 3594 |
| 343 | Ga0373944_0001250 | 3300035089 | Bacteria | 6380 |
| 344 | Ga0373944_0001307 | 3300035089 | Bacteria | 6265 |
| 345 | Ga0373923_0004241 | 3300035111 | Bacteria | 4734 |
| 346 | Ga0373923_0010967 | 3300035111 | Bacteria | 3313 |
| 347 | Ga0373923_0173599 | 3300035111 | Bacteria | 988 |
| 348 | Ga0373936_0000136 | 3300035113 | Bacteria | 25252 |
| 349 | Ga0373936_0000255 | 3300035113 | Bacteria | 17429 |
| 350 | Ga0373936_0007607 | 3300035113 | Bacteria | 4071 |
| 351 | Ga0373936_0011190 | 3300035113 | Bacteria | 3391 |
| 352 | Ga0373936_0083346 | 3300035113 | Bacteria | 1333 |
| 353 | Ga0373945_0001442 | 3300035116 | Bacteria | 7246 |
| 354 | Ga0373945_0150424 | 3300035116 | Bacteria | 943 |
| 355 | Ga0373953_0015662 | 3300035117 | Bacteria | 2754 |
| 356 | Ga0373953_0031801 | 3300035117 | Bacteria | 2054 |
| 357 | Ga0373953_0052488 | 3300035117 | Bacteria | 1650 |
| 358 | Ga0373953_0052960 | 3300035117 | Bacteria | 1643 |
| 359 | Ga0373954_0004028 | 3300035118 | Bacteria | 6283 |
| 360 | Ga0373954_0010013 | 3300035118 | Bacteria | 4176 |
| 361 | Ga0373956_0002417 | 3300035119 | Bacteria | 7620 |
| 362 | Ga0373956_0007704 | 3300035119 | Bacteria | 4341 |
| 363 | Ga0373957_0006945 | 3300035120 | Bacteria | 3595 |
| 364 | Ga0373957_0035415 | 3300035120 | Bacteria | 1855 |
| 365 | Ga0373957_0056268 | 3300035120 | Bacteria | 1514 |
| 366 | Ga0373957_0105883 | 3300035120 | Bacteria | 1129 |
| 367 | Ga0373943_0001010 | 3300035170 | Bacteria | 12507 |
| 368 | Ga0373943_0001481 | 3300035170 | Bacteria | 10634 |
| 369 | Ga0373943_0075886 | 3300035170 | Bacteria | 1713 |
| 370 | Ga0373943_0120500 | 3300035170 | Bacteria | 1394 |
| 371 | Ga0373946_0000042 | 3300035171 | Bacteria | 32829 |
| 372 | Ga0373946_0003285 | 3300035171 | Bacteria | 5744 |
| 373 | Ga0373946_0041537 | 3300035171 | Bacteria | 1887 |
| 374 | Ga0373946_0061767 | 3300035171 | Bacteria | 1596 |
| 375 | Ga0373955_0004973 | 3300035172 | Bacteria | 5932 |
| 376 | Ga0373955_0007890 | 3300035172 | Bacteria | 4914 |
| 377 | Ga0373955_0024632 | 3300035172 | Bacteria | 3079 |
| 378 | Ga0373955_0173934 | 3300035172 | Bacteria | 1275 |
| 379 | Ga0373942_0022497 | 3300035207 | Bacteria | 1600 |
| 380 | Ga0373962_0005290 | 3300035242 | Bacteria | 3123 |
| 381 | Ga0373924_0000234 | 3300035410 | Bacteria | 16830 |
| 382 | Ga0373924_0018690 | 3300035410 | Bacteria | 2675 |
| 383 | Ga0373931_0074858 | 3300035691 | Bacteria | 1855 |
| 384 | Ga0373935_0003363 | 3300035692 | Bacteria | 9271 |
| 385 | Ga0373935_0006528 | 3300035692 | Bacteria | 6967 |
| 386 | Ga0373935_0040943 | 3300035692 | Bacteria | 2909 |
| 387 | Ga0373935_0348175 | 3300035692 | Bacteria | 1056 |
| 388 | Ga0373927_0002474 | 3300035695 | Bacteria | 13480 |
| 389 | Ga0373927_0013633 | 3300035695 | Bacteria | 5396 |
| 390 | Ga0373927_0093925 | 3300035695 | Bacteria | 1949 |
| 391 | Ga0373933_0003456 | 3300035724 | Bacteria | 8793 |
| 392 | Ga0373933_0107612 | 3300035724 | Bacteria | 1736 |
| 393 | Ga0373933_0120694 | 3300035724 | Bacteria | 1641 |
| 394 | Ga0373933_0247967 | 3300035724 | Bacteria | 1146 |
| 395 | Ga0373947_0000944 | 3300035725 | Bacteria | 17672 |
| 396 | Ga0373947_0011829 | 3300035725 | Bacteria | 5000 |
| 397 | Ga0373947_0038014 | 3300035725 | Bacteria | 2857 |
| 398 | Ga0373947_0058874 | 3300035725 | Bacteria | 2328 |
| 399 | Ga0373937_0002615 | 3300036401 | Bacteria | 15008 |
| 400 | Ga0373937_0020697 | 3300036401 | Bacteria | 5900 |
| 401 | Ga0373937_0034645 | 3300036401 | Bacteria | 4592 |
| 402 | Ga0373937_0054896 | 3300036401 | Bacteria | 3656 |
| 403 | Ga0373937_0059021 | 3300036401 | Bacteria | 3525 |
| 404 | Ga0373937_0112423 | 3300036401 | Bacteria | 2533 |
| 405 | Ga0373937_0304263 | 3300036401 | Bacteria | 1507 |
| 406 | Ga0373937_0324184 | 3300036401 | Bacteria | 1457 |
| 407 | Ga0373925_0002998 | 3300037068 | Bacteria | 13282 |
| 408 | Ga0373925_0003140 | 3300037068 | Bacteria | 12968 |
| 409 | Ga0373925_0017297 | 3300037068 | Bacteria | 5224 |
| 410 | Ga0373925_0044869 | 3300037068 | Bacteria | 3282 |
| 411 | Ga0373925_0047888 | 3300037068 | Bacteria | 3183 |
| 412 | Ga0373925_0059929 | 3300037068 | Bacteria | 2856 |
| 413 | Ga0373925_0271195 | 3300037068 | Bacteria | 1365 |
| 414 | Ga0436364_0072739 | 3300037853 | Bacteria | 3075 |
| 415 | Ga0436364_0188744 | 3300037853 | Bacteria | 2446 |
| 416 | Ga0436364_0287407 | 3300037853 | Bacteria | 132611 |
| 417 | Ga0436364_0385753 | 3300037853 | Bacteria | 2439 |
| 418 | Ga0436364_0585527 | 3300037853 | Bacteria | 3005 |
| 419 | Ga0436364_0884066 | 3300037853 | Bacteria | 3333 |
| 420 | Ga0436365_0051225 | 3300039437 | Bacteria | 3563 |
| 421 | Ga0436365_0074233 | 3300039437 | Bacteria | 1219 |
| 422 | Ga0436363_0875728 | 3300039450 | Bacteria | 1410 |
| 423 | Ga0466972_0086840 | 3300044658 | Bacteria | 1486 |
| 424 | Ga0466965_0002074 | 3300044683 | Bacteria | 8394 |
| 425 | Ga0466963_0066389 | 3300044694 | Bacteria | 2420 |
| 426 | Ga0466964_0055903 | 3300044706 | Bacteria | 1631 |
| 427 | Ga0466960_0001569 | 3300044901 | Bacteria | 8364 |
| 428 | Ga0466960_0134846 | 3300044901 | Bacteria | 1307 |
| 429 | Ga0466958_0166048 | 3300045836 | Bacteria | 1396 |
| 430 | Ga0466967_0015291 | 3300045976 | Bacteria | 6012 |
| 431 | Ga0466967_0033416 | 3300045976 | Bacteria | 4354 |
| 432 | Ga0466967_0057155 | 3300045976 | Bacteria | 3443 |
| 433 | Ga0466967_0165512 | 3300045976 | Bacteria | 2078 |
| 434 | Ga0466967_0347151 | 3300045976 | Bacteria | 1436 |
| 435 | Ga0495592_0081446 | 3300046454 | Bacteria | 2340 |
| 436 | Ga0495603_0002385 | 3300046455 | Bacteria | 11046 |
| 437 | Ga0495603_0070329 | 3300046455 | Bacteria | 2057 |
| 438 | Ga0495629_0004467 | 3300046459 | Bacteria | 10484 |
| 439 | Ga0495629_0006588 | 3300046459 | Bacteria | 8602 |
| 440 | Ga0495641_0002810 | 3300046461 | Bacteria | 13468 |
| 441 | Ga0495641_0009329 | 3300046461 | Bacteria | 5839 |
| 442 | Ga0495641_0020029 | 3300046461 | Bacteria | 3404 |
| 443 | Ga0495641_0032725 | 3300046461 | Bacteria | 2473 |
| 444 | Ga0495651_0002945 | 3300046462 | Bacteria | 13164 |
| 445 | Ga0495651_0010074 | 3300046462 | Bacteria | 7262 |
| 446 | Ga0495651_0020289 | 3300046462 | Bacteria | 5158 |
| 447 | Ga0495651_0021994 | 3300046462 | Bacteria | 4959 |
| 448 | Ga0495651_0088131 | 3300046462 | Bacteria | 2332 |
| 449 | Ga0495653_0008158 | 3300046463 | Bacteria | 8576 |
| 450 | Ga0495653_0012670 | 3300046463 | Bacteria | 6886 |
| 451 | Ga0495653_0013722 | 3300046463 | Bacteria | 6603 |
| 452 | Ga0495653_0087584 | 3300046463 | Bacteria | 2286 |
| 453 | Ga0495653_0103928 | 3300046463 | Bacteria | 2053 |
| 454 | Ga0495653_0307754 | 3300046463 | Bacteria | 1031 |
| 455 | Ga0495580_0004049 | 3300046472 | Bacteria | 12364 |
| 456 | Ga0495582_0001282 | 3300046473 | Bacteria | 14108 |
| 457 | Ga0495582_0004976 | 3300046473 | Bacteria | 7443 |
| 458 | Ga0495582_0007862 | 3300046473 | Bacteria | 5891 |
| 459 | Ga0495582_0090119 | 3300046473 | Bacteria | 1709 |
| 460 | Ga0495639_0001660 | 3300046475 | Bacteria | 9894 |
| 461 | Ga0495639_0091992 | 3300046475 | Bacteria | 1424 |
| 462 | Ga0495662_0000892 | 3300046476 | Bacteria | 14586 |
| 463 | Ga0495662_0004957 | 3300046476 | Bacteria | 6663 |
| 464 | Ga0495662_0025885 | 3300046476 | Bacteria | 2834 |
| 465 | Ga0495662_0078803 | 3300046476 | Bacteria | 1601 |
| 466 | Ga0495664_0000213 | 3300046477 | Bacteria | 27782 |
| 467 | Ga0495664_0006935 | 3300046477 | Bacteria | 6270 |
| 468 | Ga0495664_0052365 | 3300046477 | Bacteria | 2425 |
| 469 | Ga0495664_0055177 | 3300046477 | Bacteria | 2364 |
| 470 | Ga0495664_0058691 | 3300046477 | Bacteria | 2289 |
| 471 | Ga0495664_0072111 | 3300046477 | Bacteria | 2063 |
| 472 | Ga0495664_0136594 | 3300046477 | Bacteria | 1485 |
| 473 | Ga0495594_0008852 | 3300046499 | Bacteria | 5190 |
| 474 | Ga0495594_0119109 | 3300046499 | Bacteria | 1492 |
| 475 | Ga0495608_0000952 | 3300046511 | Bacteria | 20388 |
| 476 | Ga0495608_0003331 | 3300046511 | Bacteria | 11488 |
| 477 | Ga0495608_0004543 | 3300046511 | Bacteria | 9918 |
| 478 | Ga0495608_0018759 | 3300046511 | Bacteria | 4767 |
| 479 | Ga0495608_0026980 | 3300046511 | Bacteria | 3911 |
| 480 | Ga0495608_0045203 | 3300046511 | Bacteria | 2936 |
| 481 | Ga0495608_0121425 | 3300046511 | Bacteria | 1675 |
| 482 | Ga0495608_0256323 | 3300046511 | Bacteria | 1090 |
| 483 | Ga0495618_0027153 | 3300046514 | Bacteria | 3564 |
| 484 | Ga0495618_0028946 | 3300046514 | Bacteria | 3454 |
| 485 | Ga0495618_0037936 | 3300046514 | Bacteria | 3027 |
| 486 | Ga0495618_0054622 | 3300046514 | Bacteria | 2528 |
| 487 | Ga0495618_0076446 | 3300046514 | Bacteria | 2133 |
| 488 | Ga0495628_0016513 | 3300046516 | Bacteria | 6156 |
| 489 | Ga0495628_0045841 | 3300046516 | Bacteria | 3474 |
| 490 | Ga0495628_0119101 | 3300046516 | Bacteria | 2026 |
| 491 | Ga0495628_0228382 | 3300046516 | Bacteria | 1396 |
| 492 | Ga0495628_0263891 | 3300046516 | Bacteria | 1283 |
| 493 | Ga0495628_0484819 | 3300046516 | Bacteria | 894 |
| 494 | Ga0495630_0010206 | 3300046517 | Bacteria | 6774 |
| 495 | Ga0495630_0015019 | 3300046517 | Bacteria | 5651 |
| 496 | Ga0495630_0042047 | 3300046517 | Bacteria | 3413 |
| 497 | Ga0495630_0051322 | 3300046517 | Bacteria | 3087 |
| 498 | Ga0495630_0179597 | 3300046517 | Bacteria | 1613 |
| 499 | Ga0495666_0013237 | 3300046526 | Bacteria | 4114 |
| 500 | Ga0495666_0019694 | 3300046526 | Bacteria | 3346 |
| 501 | Ga0495652_0002162 | 3300046529 | Bacteria | 20674 |
| 502 | Ga0495652_0029506 | 3300046529 | Bacteria | 4818 |
| 503 | Ga0495652_0050258 | 3300046529 | Bacteria | 3565 |
| 504 | Ga0495652_0116976 | 3300046529 | Bacteria | 2133 |
| 505 | Ga0495652_0174575 | 3300046529 | Bacteria | 1655 |
| 506 | Ga0495665_0002247 | 3300046531 | Bacteria | 10454 |
| 507 | Ga0495665_0009248 | 3300046531 | Bacteria | 5339 |
| 508 | Ga0495665_0042625 | 3300046531 | Bacteria | 2415 |
| 509 | Ga0495665_0281043 | 3300046531 | Bacteria | 854 |
| 510 | Ga0495640_0008632 | 3300046533 | Bacteria | 7985 |
| 511 | Ga0495640_0018285 | 3300046533 | Bacteria | 5202 |
| 512 | Ga0495640_0029732 | 3300046533 | Bacteria | 3919 |
| 513 | Ga0495640_0033947 | 3300046533 | Bacteria | 3623 |
| 514 | Ga0495640_0041596 | 3300046533 | Bacteria | 3211 |
| 515 | Ga0495640_0084442 | 3300046533 | Bacteria | 2106 |
| 516 | Ga0495586_0031246 | 3300046535 | Bacteria | 2851 |
| 517 | Ga0495586_0054388 | 3300046535 | Bacteria | 2169 |
| 518 | Ga0495587_0010351 | 3300046536 | Bacteria | 5942 |
| 519 | Ga0495587_0031794 | 3300046536 | Bacteria | 3193 |
| 520 | Ga0495587_0045779 | 3300046536 | Bacteria | 2599 |
| 521 | Ga0495587_0048334 | 3300046536 | Bacteria | 2519 |
| 522 | Ga0495587_0087314 | 3300046536 | Bacteria | 1805 |
| 523 | Ga0495587_0185792 | 3300046536 | Bacteria | 1177 |
| 524 | Ga0495645_0012581 | 3300046543 | Bacteria | 5965 |
| 525 | Ga0495645_0024380 | 3300046543 | Bacteria | 4389 |
| 526 | Ga0495645_0026811 | 3300046543 | Bacteria | 4184 |
| 527 | Ga0495645_0050339 | 3300046543 | Bacteria | 3033 |
| 528 | Ga0495645_0074303 | 3300046543 | Bacteria | 2448 |
| 529 | Ga0495645_0209202 | 3300046543 | Bacteria | 1318 |
| 530 | Ga0495645_0274414 | 3300046543 | Bacteria | 1111 |
| 531 | Ga0495667_0000438 | 3300046559 | Bacteria | 26630 |
| 532 | Ga0495667_0164265 | 3300046559 | Bacteria | 1427 |
| 533 | Ga0495667_0190956 | 3300046559 | Bacteria | 1312 |
| 534 | Ga0495634_0006453 | 3300046642 | Bacteria | 8911 |
| 535 | Ga0495634_0009841 | 3300046642 | Bacteria | 7033 |
| 536 | Ga0495634_0020244 | 3300046642 | Bacteria | 4720 |
| 537 | Ga0495634_0053029 | 3300046642 | Bacteria | 2717 |
| 538 | Ga0495634_0075217 | 3300046642 | Bacteria | 2218 |
| 539 | Ga0495635_0001642 | 3300046663 | Bacteria | 15081 |
| 540 | Ga0495635_0002077 | 3300046663 | Bacteria | 13591 |
| 541 | Ga0495635_0031047 | 3300046663 | Bacteria | 3711 |
| 542 | Ga0495635_0055235 | 3300046663 | Bacteria | 2735 |
| 543 | Ga0495635_0121645 | 3300046663 | Bacteria | 1780 |
| 544 | Ga0495635_0244621 | 3300046663 | Bacteria | 1210 |
| 545 | Ga0495588_0064334 | 3300046674 | Bacteria | 1903 |
| 546 | Ga0495657_0002319 | 3300046675 | Bacteria | 16029 |
| 547 | Ga0495657_0013744 | 3300046675 | Bacteria | 5960 |
| 548 | Ga0495657_0025078 | 3300046675 | Bacteria | 4236 |
| 549 | Ga0495657_0075475 | 3300046675 | Bacteria | 2191 |
| 550 | Ga0495599_0014013 | 3300046678 | Bacteria | 4963 |
| 551 | Ga0495599_0018982 | 3300046678 | Bacteria | 4286 |
| 552 | Ga0495599_0073599 | 3300046678 | Bacteria | 2132 |
| 553 | Ga0495623_0041847 | 3300046679 | Bacteria | 2920 |
| 554 | Ga0495623_0060948 | 3300046679 | Bacteria | 2366 |
| 555 | Ga0495623_0099273 | 3300046679 | Bacteria | 1776 |
| 556 | Ga0495646_0020465 | 3300046680 | Bacteria | 4186 |
| 557 | Ga0495646_0037660 | 3300046680 | Bacteria | 2990 |
| 558 | Ga0495646_0255144 | 3300046680 | Bacteria | 938 |
| 559 | Ga0495658_0001562 | 3300046683 | Bacteria | 11970 |
| 560 | Ga0495658_0007166 | 3300046683 | Bacteria | 5508 |
| 561 | Ga0495658_0008099 | 3300046683 | Bacteria | 5204 |
| 562 | Ga0495658_0077030 | 3300046683 | Bacteria | 1950 |
| 563 | Ga0495613_0006214 | 3300046689 | Bacteria | 8931 |
| 564 | Ga0495613_0007771 | 3300046689 | Bacteria | 7978 |
| 565 | Ga0495613_0100322 | 3300046689 | Bacteria | 2091 |
| 566 | Ga0495624_0005078 | 3300046690 | Bacteria | 9514 |
| 567 | Ga0495624_0025549 | 3300046690 | Bacteria | 3876 |
| 568 | Ga0495600_0023502 | 3300046809 | Bacteria | 3965 |
| 569 | Ga0495581_0000334 | 3300047315 | Bacteria | 23424 |
| 570 | Ga0495581_0004575 | 3300047315 | Bacteria | 7991 |
| 571 | Ga0495581_0068982 | 3300047315 | Bacteria | 2044 |
| 572 | Ga0495604_0064587 | 3300047317 | Bacteria | 2789 |
| 573 | Ga0495604_0077100 | 3300047317 | Bacteria | 2506 |
| 574 | Ga0495604_0103741 | 3300047317 | Bacteria | 2085 |
| 575 | Ga0495604_0273797 | 3300047317 | Bacteria | 1143 |
| 576 | Ga0495674_0004016 | 3300047319 | Bacteria | 14248 |
| 577 | Ga0495674_0008546 | 3300047319 | Bacteria | 9746 |
| 578 | Ga0495674_0026448 | 3300047319 | Bacteria | 5309 |
| 579 | Ga0495674_0041158 | 3300047319 | Bacteria | 4129 |
| 580 | Ga0495674_0041840 | 3300047319 | Bacteria | 4090 |
| 581 | Ga0495674_0065963 | 3300047319 | Bacteria | 3142 |
| 582 | Ga0495674_0077932 | 3300047319 | Bacteria | 2848 |
| 583 | Ga0495674_0150239 | 3300047319 | Bacteria | 1953 |
| 584 | Ga0495674_0249824 | 3300047319 | Unclassified | 1460 |
| 585 | Ga0495676_0010356 | 3300047321 | Bacteria | 8456 |
| 586 | Ga0495676_0024775 | 3300047321 | Bacteria | 5186 |
| 587 | Ga0495676_0198986 | 3300047321 | Bacteria | 1393 |
| 588 | Ga0495680_0002773 | 3300047322 | Bacteria | 17675 |
| 589 | Ga0495680_0006600 | 3300047322 | Bacteria | 10765 |
| 590 | Ga0495680_0007541 | 3300047322 | Bacteria | 9951 |
| 591 | Ga0495680_0008563 | 3300047322 | Bacteria | 9288 |
| 592 | Ga0495680_0014491 | 3300047322 | Bacteria | 6824 |
| 593 | Ga0495680_0015329 | 3300047322 | Bacteria | 6613 |
| 594 | Ga0495680_0016495 | 3300047322 | Bacteria | 6342 |
| 595 | Ga0495680_0051648 | 3300047322 | Bacteria | 3208 |
| 596 | Ga0495675_0018562 | 3300047444 | Bacteria | 4416 |
| 597 | Ga0495675_0024694 | 3300047444 | Bacteria | 3832 |
| 598 | Ga0495675_0046706 | 3300047444 | Bacteria | 2756 |
| 599 | Ga0495675_0090539 | 3300047444 | Bacteria | 1920 |
| 600 | Ga0495675_0091433 | 3300047444 | Bacteria | 1910 |
| 601 | Ga0495675_0131819 | 3300047444 | Bacteria | 1553 |
| 602 | Ga0495684_0004012 | 3300047471 | Bacteria | 11481 |
| 603 | Ga0495684_0013377 | 3300047471 | Bacteria | 6316 |
| 604 | Ga0495684_0037457 | 3300047471 | Bacteria | 3719 |
| 605 | Ga0495684_0125125 | 3300047471 | Bacteria | 1934 |
| 606 | Ga0495684_0157875 | 3300047471 | Bacteria | 1693 |
| 607 | Ga0495593_0002306 | 3300047673 | Bacteria | 11448 |
| 608 | Ga0495593_0003796 | 3300047673 | Bacteria | 9024 |
| 609 | Ga0495593_0020997 | 3300047673 | Bacteria | 3650 |
| 610 | Ga0495602_0014410 | 3300048088 | Bacteria | 8026 |
| 611 | Ga0495602_0021713 | 3300048088 | Bacteria | 6308 |
| 612 | Ga0495602_0034829 | 3300048088 | Bacteria | 4703 |
| 613 | Ga0495602_0034999 | 3300048088 | Bacteria | 4688 |
| 614 | Ga0495602_0061304 | 3300048088 | Bacteria | 3272 |
| 615 | Ga0495602_0088577 | 3300048088 | Bacteria | 2576 |
| 616 | Ga0495602_0160970 | 3300048088 | Bacteria | 1752 |
| 617 | Ga0495614_0045660 | 3300048089 | Bacteria | 1878 |
| 618 | Ga0495614_0091164 | 3300048089 | Bacteria | 1326 |
| 619 | Ga0496100_0031189 | 3300048903 | Bacteria | 3311 |
| 620 | Ga0496101_0007606 | 3300048904 | Bacteria | 7037 |
| 621 | Ga0496101_0016465 | 3300048904 | Bacteria | 4995 |
| 622 | Ga0496102_0000018 | 3300048905 | Bacteria | 266847 |
| 623 | Ga0496102_0140548 | 3300048905 | Bacteria | 2263 |
| 624 | Ga0496102_0664112 | 3300048905 | Bacteria | 965 |
| 625 | Ga0496103_0000188 | 3300048906 | Bacteria | 62595 |
| 626 | Ga0496104_0028278 | 3300048907 | Bacteria | 5196 |
| 627 | Ga0496104_0144388 | 3300048907 | Bacteria | 2285 |
| 628 | Ga0496105_0020504 | 3300048908 | Bacteria | 5342 |
| 629 | Ga0496105_0042345 | 3300048908 | Bacteria | 3753 |
| 630 | Ga0496105_0093344 | 3300048908 | Bacteria | 2485 |
| 631 | Ga0496105_0179762 | 3300048908 | Bacteria | 1732 |
| 632 | Ga0496106_0308996 | 3300048909 | Bacteria | 1268 |
| 633 | Ga0496107_0022214 | 3300048910 | Bacteria | 4483 |
| 634 | Ga0496108_0119530 | 3300048911 | Bacteria | 2259 |
| 635 | Ga0496108_0191796 | 3300048911 | Bacteria | 1771 |
| 636 | Ga0496108_0416353 | 3300048911 | Bacteria | 1173 |
| 637 | Ga0496109_0106637 | 3300048912 | Bacteria | 2602 |
| 638 | Ga0496109_0210671 | 3300048912 | Bacteria | 1828 |
| 639 | Ga0496110_0696170 | 3300048913 | Bacteria | 917 |
| 640 | Ga0496111_0468449 | 3300048914 | Bacteria | 929 |
| 641 | Ga0496112_0056240 | 3300048915 | Bacteria | 3871 |
| 642 | Ga0496112_0058641 | 3300048915 | Bacteria | 3791 |
| 643 | Ga0496112_0160611 | 3300048915 | Bacteria | 2214 |
| 644 | Ga0496112_0266267 | 3300048915 | Bacteria | 1663 |
| 645 | Ga0496113_0077699 | 3300048916 | Bacteria | 2538 |
| 646 | Ga0496113_0495839 | 3300048916 | Bacteria | 981 |
| 647 | Ga0496114_0011592 | 3300048917 | Bacteria | 7046 |
| 648 | Ga0496114_0245261 | 3300048917 | Bacteria | 1576 |
| 649 | Ga0496114_0319059 | 3300048917 | Bacteria | 1373 |
| 650 | Ga0496115_0016167 | 3300048918 | Bacteria | 5675 |
| 651 | Ga0496115_0048077 | 3300048918 | Bacteria | 3412 |
| 652 | Ga0496115_0067682 | 3300048918 | Bacteria | 2889 |
| 653 | Ga0496115_0328224 | 3300048918 | Bacteria | 1250 |
| 654 | Ga0496116_0002538 | 3300048919 | Bacteria | 19116 |
| 655 | Ga0496117_0000528 | 3300048920 | Bacteria | 62814 |
| 656 | Ga0496118_0000136 | 3300048921 | Bacteria | 130016 |
| 657 | Ga0496119_0001749 | 3300048922 | Bacteria | 25328 |
| 658 | Ga0496121_0008808 | 3300048924 | Bacteria | 11753 |
| 659 | Ga0496124_0001945 | 3300048927 | Bacteria | 28244 |
| 660 | Ga0496125_0008449 | 3300048928 | Bacteria | 10775 |
| 661 | Ga0496126_0000585 | 3300048929 | Bacteria | 68897 |
| 662 | Ga0496126_0018077 | 3300048929 | Bacteria | 7001 |
| 663 | Ga0496126_0464803 | 3300048929 | Bacteria | 1016 |
| 664 | nmdc:mga05p37_145562_c1 | 3300050507 | Bacteria | 2902 |
| 665 | nmdc:mga05p37_495152_c1 | 3300050507 | Bacteria | 1404 |
| 666 | nmdc:mga05p37_9965_c1 | 3300050507 | Bacteria | 11286 |
| 667 | nmdc:mga09592_109738_c1 | 3300050508 | Bacteria | 2367 |
| 668 | nmdc:mga09592_486060_c1 | 3300050508 | Bacteria | 1063 |
| 669 | nmdc:mga0qj67_338492_c1 | 3300050509 | Bacteria | 1217 |
| 670 | nmdc:mga08y16_114293_c1 | 3300050511 | Bacteria | 2810 |
| 671 | nmdc:mga0n895_141179_c1 | 3300050512 | Bacteria | 2437 |
| 672 | nmdc:mga0n895_245636_c1 | 3300050512 | Bacteria | 1816 |
| 673 | nmdc:mga0n895_572754_c1 | 3300050512 | Bacteria | 1134 |
| 674 | nmdc:mga0n895_7305_c1 | 3300050512 | Bacteria | 9470 |
| 675 | nmdc:mga0n895_89729_c1 | 3300050512 | Bacteria | 3075 |
| 676 | nmdc:mga0rr50_16552_c1 | 3300050513 | Bacteria | 4902 |
| 677 | nmdc:mga0rr50_210728_c1 | 3300050513 | Bacteria | 1601 |
| 678 | nmdc:mga0rr50_28794_c1 | 3300050513 | Bacteria | 3909 |
| 679 | nmdc:mga08x19_268877_c1 | 3300050514 | Bacteria | 1179 |
| 680 | nmdc:mga08x19_319923_c1 | 3300050514 | Bacteria | 1080 |
| 681 | nmdc:mga08x19_495006_c1 | 3300050514 | Bacteria | 863 |
| 682 | nmdc:mga0a205_148780_c1 | 3300050515 | Bacteria | 2242 |
| 683 | Ga0495601_0028268 | 3300053077 | Bacteria | 3472 |
| 684 | Ga0495601_0033637 | 3300053077 | Bacteria | 3194 |
| 685 | Ga0495601_0066734 | 3300053077 | Bacteria | 2291 |
| 686 | Ga0495601_0073089 | 3300053077 | Bacteria | 2192 |
| 687 | Ga0495601_0094995 | 3300053077 | Bacteria | 1922 |
| 688 | Ga0495601_0095828 | 3300053077 | Bacteria | 1913 |
| 689 | Ga0495612_0001691 | 3300053078 | Bacteria | 9077 |
| 690 | Ga0495612_0017788 | 3300053078 | Bacteria | 2845 |
| 691 | Ga0495612_0037837 | 3300053078 | Bacteria | 1960 |
| 692 | Ga0495595_0011106 | 3300053084 | Bacteria | 3759 |
| 693 | Ga0495595_0011200 | 3300053084 | Bacteria | 3746 |
| 694 | Ga0495619_0003740 | 3300053085 | Bacteria | 9804 |
| 695 | Ga0495619_0018879 | 3300053085 | Bacteria | 4377 |
| 696 | Ga0495619_0049253 | 3300053085 | Bacteria | 2778 |
| 697 | Ga0495619_0177984 | 3300053085 | Bacteria | 1471 |
| 698 | 2558913602 | 2558860112 | Bacteria | 9931328 |
| 699 | 2816510635 | 2816332139 | Bacteria | 9138787 |
| 700 | 2915360376 | 2915358134 | Bacteria | 6050864 |
| 701 | 8054478099 | 8054472261 | Bacteria | 7464355 |
| 702 | Ga0070707_100070795 | |||
| 703 | Ga0070658_10028698 | |||
| 704 | Ga0070658_10148611 | |||
| 705 | Ga0070658_10297550 | |||
| 706 | Ga0070676_10045989 | |||
| 707 | Ga0070683_100705017 | |||
| 708 | Ga0068869_100102955 | |||
| 709 | Ga0070666_10013496 | |||
| 710 | Ga0070682_100055823 | |||
| 711 | Ga0070682_100139376 | |||
| 712 | Ga0068868_100332339 | |||
| 713 | Ga0068868_100402525 | |||
| 714 | Ga0068868_100419029 | |||
| 715 | Ga0070660_100016154 | |||
| 716 | Ga0070660_100075767 | |||
| 717 | Ga0070689_100100305 | |||
| 718 | Ga0070689_100359635 | |||
| 719 | Ga0070691_10011830 | |||
| 720 | Ga0070661_100013725 | |||
| 721 | Ga0070661_100180560 | |||
| 722 | Ga0070692_10114383 | |||
| 723 | Ga0070668_100101961 | |||
| 724 | Ga0070675_100367325 | |||
| 725 | Ga0070671_100001775 | |||
| 726 | Ga0070673_100076707 | |||
| 727 | Ga0070659_100013587 | |||
| 728 | Ga0070667_100056432 | |||
| 729 | Ga0070709_10000363 | |||
| 730 | Ga0070709_10000585 | |||
| 731 | Ga0070709_10058627 | |||
| 732 | Ga0070709_10120152 | |||
| 733 | Ga0070709_10133480 | |||
| 734 | Ga0070714_100000182 | |||
| 735 | Ga0070714_100000833 | |||
| 736 | Ga0070714_100001457 | |||
| 737 | Ga0070714_100013642 | |||
| 738 | Ga0070714_100047606 | |||
| 739 | Ga0070714_100092410 | |||
| 740 | Ga0070714_100096113 | |||
| 741 | Ga0070714_100133498 | |||
| 742 | Ga0070714_100362290 | |||
| 743 | Ga0070714_100449563 | |||
| 744 | Ga0070714_100641981 | |||
| 745 | Ga0070713_100003768 | |||
| 746 | Ga0070713_100035144 | |||
| 747 | Ga0070713_100076899 | |||
| 748 | Ga0070713_100203650 | |||
| 749 | Ga0070713_100209335 | |||
| 750 | Ga0070713_100353668 | |||
| 751 | Ga0070710_10000226 | |||
| 752 | Ga0070710_10001848 | |||
| 753 | Ga0070710_10004208 | |||
| 754 | Ga0070710_10004868 | |||
| 755 | Ga0070710_10028972 | |||
| 756 | Ga0070710_10211155 | |||
| 757 | Ga0070710_10293147 | |||
| 758 | Ga0070711_100001128 | |||
| 759 | Ga0070711_100120542 | |||
| 760 | Ga0070711_100131971 | |||
| 761 | Ga0070711_100358796 | |||
| 762 | Ga0070711_100462662 | |||
| 763 | Ga0070711_100655479 | |||
| 764 | Ga0070700_100019819 | |||
| 765 | Ga0070708_100045869 | |||
| 766 | Ga0070708_100100821 | |||
| 767 | Ga0070663_100021738 | |||
| 768 | Ga0070663_100025363 | |||
| 769 | Ga0070678_100310074 | |||
| 770 | Ga0070678_100609821 | |||
| 771 | Ga0070681_10055516 | |||
| 772 | Ga0068867_100196441 | |||
| 773 | Ga0068867_100443643 | |||
| 774 | Ga0070685_10048341 | |||
| 775 | Ga0070685_10063314 | |||
| 776 | Ga0070706_100013580 | |||
| 777 | Ga0070706_100014081 | |||
| 778 | Ga0070707_100095913 | |||
| 779 | Ga0070707_100134026 | |||
| 780 | Ga0070707_100391567 | |||
| 781 | Ga0070707_100529942 | |||
| 782 | Ga0070698_100001107 | |||
| 783 | Ga0070698_100003164 | |||
| 784 | Ga0070698_100003648 | |||
| 785 | Ga0070698_100009913 | |||
| 786 | Ga0070698_100030512 | |||
| 787 | Ga0070698_100073907 | |||
| 788 | Ga0070699_100001249 | |||
| 789 | Ga0070699_100103431 | |||
| 790 | Ga0070699_100119703 | |||
| 791 | Ga0070699_100348327 | |||
| 792 | Ga0070679_100070070 | |||
| 793 | Ga0070679_100381758 | |||
| 794 | Ga0070684_100088868 | |||
| 795 | Ga0070697_100004900 | |||
| 796 | Ga0070697_100036519 | |||
| 797 | Ga0070686_100023801 | |||
| 798 | Ga0070695_100100497 | |||
| 799 | Ga0070696_100158357 | |||
| 800 | Ga0070665_100006412 | |||
| 801 | Ga0070665_100202311 | |||
| 802 | Ga0070704_100158722 | |||
| 803 | Ga0070704_100375947 | |||
| 804 | Ga0070664_100003415 | |||
| 805 | Ga0070664_100257912 | |||
| 806 | Ga0068857_100069866 | |||
| 807 | Ga0068854_100035058 | |||
| 808 | Ga0068856_100444334 | |||
| 809 | Ga0068856_100536644 | |||
| 810 | Ga0068856_100712976 | |||
| 811 | Ga0070702_100018872 | |||
| 812 | Ga0070702_100232318 | |||
| 813 | Ga0068859_100137226 | |||
| 814 | Ga0068859_100499453 | |||
| 815 | Ga0068864_100146318 | |||
| 816 | Ga0068861_100038623 | |||
| 817 | Ga0068863_100002321 | |||
| 818 | Ga0068863_100094902 | |||
| 819 | Ga0068863_100254468 | |||
| 820 | Ga0068858_100238799 | |||
| 821 | Ga0068860_100040813 | |||
| 822 | Ga0068862_100080290 | |||
| 823 | Ga0081455_10079911 | |||
| 824 | Ga0081455_10114762 | |||
| 825 | Ga0081455_10162345 | |||
| 826 | Ga0081540_1000176 | |||
| 827 | Ga0070717_10002481 | |||
| 828 | Ga0070717_10006048 | |||
| 829 | Ga0070717_10015178 | |||
| 830 | Ga0070717_10063100 | |||
| 831 | Ga0070717_10489853 | |||
| 832 | Ga0075432_10062238 | |||
| 833 | Ga0070715_10004571 | |||
| 834 | Ga0070715_10012528 | |||
| 835 | Ga0070715_10015550 | |||
| 836 | Ga0070716_100000149 | |||
| 837 | Ga0070716_100006815 | |||
| 838 | Ga0070716_100155849 | |||
| 839 | Ga0070716_100316696 | |||
| 840 | Ga0070712_100000413 | |||
| 841 | Ga0070712_100030533 | |||
| 842 | Ga0070712_100036961 | |||
| 843 | Ga0070712_100082033 | |||
| 844 | Ga0070712_100328493 | |||
| 845 | Ga0068871_100034413 | |||
| 846 | Ga0075428_100149454 | |||
| 847 | Ga0075428_100308620 | |||
| 848 | Ga0075430_100343751 | |||
| 849 | Ga0075431_100075896 | |||
| 850 | Ga0075431_100362667 | |||
| 851 | Ga0075434_100005739 | |||
| 852 | Ga0075434_100035993 | |||
| 853 | Ga0075434_100341159 | |||
| 854 | Ga0075429_100163853 | |||
| 855 | Ga0068865_100142996 | |||
| 856 | Ga0075436_100009118 | |||
| 857 | Ga0075436_100057718 | |||
| 858 | Ga0075436_100167573 | |||
| 859 | Ga0075436_100260537 | |||
| 860 | Ga0097620_100137230 | |||
| 861 | Ga0097620_100499408 | |||
| 862 | Ga0075435_100024703 | |||
| 863 | Ga0075435_100033602 | |||
| 864 | Ga0105240_10141184 | |||
| 865 | Ga0111539_10029949 | |||
| 866 | Ga0111539_10066836 | |||
| 867 | Ga0111539_10142780 | |||
| 868 | Ga0111539_10158938 | |||
| 869 | Ga0105245_10088620 | |||
| 870 | Ga0105245_10180539 | |||
| 871 | Ga0105245_10286218 | |||
| 872 | Ga0105245_10337268 | |||
| 873 | Ga0105247_10088938 | |||
| 874 | Ga0105247_10185751 | |||
| 875 | Ga0114129_10012826 | |||
| 876 | Ga0114129_10642058 | |||
| 877 | Ga0105242_10117020 | |||
| 878 | Ga0105248_10064973 | |||
| 879 | Ga0105237_10882636 | |||
| 880 | Ga0105238_10786575 | |||
| 881 | Ga0105249_10114500 | |||
| 882 | Ga0105035_102819 | |||
| 883 | Ga0099796_10083017 | |||
| 884 | Ga0105239_10467364 | |||
| 885 | Ga0105239_10837407 | |||
| 886 | Ga0157338_1001985 | |||
| 887 | Ga0157371_10009139 | |||
| 888 | Ga0157371_10254058 | |||
| 889 | Ga0157370_10064893 | |||
| 890 | Ga0157370_10278585 | |||
| 891 | Ga0157369_10178181 | |||
| 892 | Ga0157369_10493907 | |||
| 893 | Ga0157374_10111115 | |||
| 894 | Ga0163162_10315891 | |||
| 895 | Ga0157515_114685 | |||
| 896 | Ga0163163_10004189 | |||
| 897 | Ga0163163_10128431 | |||
| 898 | Ga0157380_10031456 | |||
| 899 | Ga0157380_10147293 | |||
| 900 | Ga0182008_10133107 | |||
| 901 | Ga0157377_10274807 | |||
| 902 | Ga0157379_10001027 | |||
| 903 | Ga0157379_10180558 | |||
| 904 | Ga0157376_10173091 | |||
| 905 | Ga0157376_10284048 | |||
| 906 | Ga0163161_10058380 | |||
| 907 | Ga0206356_10358345 | |||
| 908 | Ga0206349_1773716 | |||
| 909 | Ga0206350_10291945 | |||
| 910 | Ga0206354_10773791 | |||
| 911 | Ga0206353_10390560 | |||
| 912 | Ga0213876_10084979 | |||
| 913 | Ga0213875_10212341 | |||
| 914 | Ga0213875_10221833 | |||
| 915 | Ga0224712_10117714 | |||
| 916 | Ga0224712_10194979 | |||
| 917 | Ga0207653_10012464 | |||
| 918 | Ga0207692_10000966 | |||
| 919 | Ga0207692_10013096 | |||
| 920 | Ga0207692_10064931 | |||
| 921 | Ga0207692_10121479 | |||
| 922 | Ga0207642_10223115 | |||
| 923 | Ga0207688_10024382 | |||
| 924 | Ga0207685_10024334 | |||
| 925 | Ga0207699_10000366 | |||
| 926 | Ga0207699_10001959 | |||
| 927 | Ga0207699_10003408 | |||
| 928 | Ga0207699_10003884 | |||
| 929 | Ga0207699_10014731 | |||
| 930 | Ga0207699_10051348 | |||
| 931 | Ga0207643_10009448 | |||
| 932 | Ga0207643_10122304 | |||
| 933 | Ga0207684_10008826 | |||
| 934 | Ga0207684_10019245 | |||
| 935 | Ga0207684_10279629 | |||
| 936 | Ga0207684_10456986 | |||
| 937 | Ga0207654_10173292 | |||
| 938 | Ga0207707_10028349 | |||
| 939 | Ga0207693_10002752 | |||
| 940 | Ga0207693_10072516 | |||
| 941 | Ga0207693_10171365 | |||
| 942 | Ga0207663_10001895 | |||
| 943 | Ga0207663_10056739 | |||
| 944 | Ga0207663_10085205 | |||
| 945 | Ga0207663_10343798 | |||
| 946 | Ga0207662_10001081 | |||
| 947 | Ga0207657_10002955 | |||
| 948 | Ga0207657_10081085 | |||
| 949 | Ga0207649_10086544 | |||
| 950 | Ga0207652_10249027 | |||
| 951 | Ga0207646_10018866 | |||
| 952 | Ga0207646_10023168 | |||
| 953 | Ga0207646_10047523 | |||
| 954 | Ga0207646_10134237 | |||
| 955 | Ga0207646_10177223 | |||
| 956 | Ga0207646_10364447 | |||
| 957 | Ga0207646_10427159 | |||
| 958 | Ga0207694_10097141 | |||
| 959 | Ga0207659_10028288 | |||
| 960 | Ga0207659_10275152 | |||
| 961 | Ga0207687_10082915 | |||
| 962 | Ga0207700_10000437 | |||
| 963 | Ga0207700_10001974 | |||
| 964 | Ga0207700_10003241 | |||
| 965 | Ga0207700_10009420 | |||
| 966 | Ga0207700_10040574 | |||
| 967 | Ga0207700_10114516 | |||
| 968 | Ga0207700_10122315 | |||
| 969 | Ga0207700_10250378 | |||
| 970 | Ga0207700_10271814 | |||
| 971 | Ga0207700_10327701 | |||
| 972 | Ga0207700_10396860 | |||
| 973 | Ga0207664_10000185 | |||
| 974 | Ga0207664_10000416 | |||
| 975 | Ga0207664_10001256 | |||
| 976 | Ga0207664_10015007 | |||
| 977 | Ga0207664_10041260 | |||
| 978 | Ga0207664_10073327 | |||
| 979 | Ga0207664_10073790 | |||
| 980 | Ga0207664_10097020 | |||
| 981 | Ga0207664_10177388 | |||
| 982 | Ga0207664_10629049 | |||
| 983 | Ga0207644_10011115 | |||
| 984 | Ga0207644_10051620 | |||
| 985 | Ga0207706_10060654 | |||
| 986 | Ga0207670_10107011 | |||
| 987 | Ga0207670_10269834 | |||
| 988 | Ga0207704_10420004 | |||
| 989 | Ga0207665_10000097 | |||
| 990 | Ga0207665_10000234 | |||
| 991 | Ga0207665_10000457 | |||
| 992 | Ga0207665_10008379 | |||
| 993 | Ga0207665_10032338 | |||
| 994 | Ga0207665_10065615 | |||
| 995 | Ga0207665_10105099 | |||
| 996 | Ga0207691_10151020 | |||
| 997 | Ga0207691_10309583 | |||
| 998 | Ga0207711_10018133 | |||
| 999 | Ga0207689_10008280 | |||
| 1000 | Ga0207689_10008343 | |||
| 1001 | Ga0207661_10032444 | |||
| 1002 | Ga0207661_10173294 | |||
| 1003 | Ga0207651_10471580 | |||
| 1004 | Ga0207668_10052741 | |||
| 1005 | Ga0207668_10192258 | |||
| 1006 | Ga0207668_10277076 | |||
| 1007 | Ga0207640_10092925 | |||
| 1008 | Ga0207658_10057901 | |||
| 1009 | Ga0207677_10086289 | |||
| 1010 | Ga0207639_10297947 | |||
| 1011 | Ga0207678_10001939 | |||
| 1012 | Ga0207678_10024658 | |||
| 1013 | Ga0207708_10015930 | |||
| 1014 | Ga0207641_10002075 | |||
| 1015 | Ga0207641_10196397 | |||
| 1016 | Ga0207641_10730284 | |||
| 1017 | Ga0207648_10225903 | |||
| 1018 | Ga0207676_10237486 | |||
| 1019 | Ga0207674_10003214 | |||
| 1020 | Ga0207674_10037739 | |||
| 1021 | Ga0207674_10148084 | |||
| 1022 | Ga0207675_100006916 | |||
| 1023 | Ga0207675_100009944 | |||
| 1024 | Ga0207675_100146904 | |||
| 1025 | Ga0207683_10002008 | |||
| 1026 | Ga0207683_10021102 | |||
| 1027 | Ga0207698_10906762 | |||
| 1028 | Ga0268266_10026104 | |||
| 1029 | Ga0268266_10114238 | |||
| 1030 | Ga0268266_10139553 | |||
| 1031 | Ga0268266_10390284 | |||
| 1032 | Ga0268264_10252966 | |||
| 1033 | Ga0307513_10024279 | |||
| 1034 | Ga0307513_10025672 | |||
| 1035 | Ga0326468_10004221 | |||
| 1036 | Ga0373930_0019525 | |||
| 1037 | Ga0373959_0022735 | |||
| 1038 | Ga0373926_0001698 | |||
| 1039 | Ga0373926_0010380 | |||
| 1040 | Ga0373929_0011163 | |||
| 1041 | Ga0373934_0001661 | |||
| 1042 | Ga0373934_0004188 | |||
| 1043 | Ga0373934_0009807 | |||
| 1044 | Ga0373944_0001250 | |||
| 1045 | Ga0373944_0001307 | |||
| 1046 | Ga0373923_0004241 | |||
| 1047 | Ga0373923_0010967 | |||
| 1048 | Ga0373923_0173599 | |||
| 1049 | Ga0373936_0000136 | |||
| 1050 | Ga0373936_0000255 | |||
| 1051 | Ga0373936_0007607 | |||
| 1052 | Ga0373936_0011190 | |||
| 1053 | Ga0373936_0083346 | |||
| 1054 | Ga0373945_0001442 | |||
| 1055 | Ga0373945_0150424 | |||
| 1056 | Ga0373953_0015662 | |||
| 1057 | Ga0373953_0031801 | |||
| 1058 | Ga0373953_0052488 | |||
| 1059 | Ga0373953_0052960 | |||
| 1060 | Ga0373954_0004028 | |||
| 1061 | Ga0373954_0010013 | |||
| 1062 | Ga0373956_0002417 | |||
| 1063 | Ga0373956_0007704 | |||
| 1064 | Ga0373957_0006945 | |||
| 1065 | Ga0373957_0035415 | |||
| 1066 | Ga0373957_0056268 | |||
| 1067 | Ga0373957_0105883 | |||
| 1068 | Ga0373943_0001010 | |||
| 1069 | Ga0373943_0001481 | |||
| 1070 | Ga0373943_0075886 | |||
| 1071 | Ga0373943_0120500 | |||
| 1072 | Ga0373946_0000042 | |||
| 1073 | Ga0373946_0003285 | |||
| 1074 | Ga0373946_0041537 | |||
| 1075 | Ga0373946_0061767 | |||
| 1076 | Ga0373955_0004973 | |||
| 1077 | Ga0373955_0007890 | |||
| 1078 | Ga0373955_0024632 | |||
| 1079 | Ga0373955_0173934 | |||
| 1080 | Ga0373942_0022497 | |||
| 1081 | Ga0373962_0005290 | |||
| 1082 | Ga0373924_0000234 | |||
| 1083 | Ga0373924_0018690 | |||
| 1084 | Ga0373931_0074858 | |||
| 1085 | Ga0373935_0003363 | |||
| 1086 | Ga0373935_0006528 | |||
| 1087 | Ga0373935_0040943 | |||
| 1088 | Ga0373935_0348175 | |||
| 1089 | Ga0373927_0002474 | |||
| 1090 | Ga0373927_0013633 | |||
| 1091 | Ga0373927_0093925 | |||
| 1092 | Ga0373933_0003456 | |||
| 1093 | Ga0373933_0107612 | |||
| 1094 | Ga0373933_0120694 | |||
| 1095 | Ga0373933_0247967 | |||
| 1096 | Ga0373947_0000944 | |||
| 1097 | Ga0373947_0011829 | |||
| 1098 | Ga0373947_0038014 | |||
| 1099 | Ga0373947_0058874 | |||
| 1100 | Ga0373937_0002615 | |||
| 1101 | Ga0373937_0020697 | |||
| 1102 | Ga0373937_0034645 | |||
| 1103 | Ga0373937_0054896 | |||
| 1104 | Ga0373937_0059021 | |||
| 1105 | Ga0373937_0112423 | |||
| 1106 | Ga0373937_0304263 | |||
| 1107 | Ga0373937_0324184 | |||
| 1108 | Ga0373925_0002998 | |||
| 1109 | Ga0373925_0003140 | |||
| 1110 | Ga0373925_0017297 | |||
| 1111 | Ga0373925_0044869 | |||
| 1112 | Ga0373925_0047888 | |||
| 1113 | Ga0373925_0059929 | |||
| 1114 | Ga0373925_0271195 | |||
| 1115 | Ga0436364_0072739 | |||
| 1116 | Ga0436364_0188744 | |||
| 1117 | Ga0436364_0287407 | |||
| 1118 | Ga0436364_0385753 | |||
| 1119 | Ga0436364_0585527 | |||
| 1120 | Ga0436364_0884066 | |||
| 1121 | Ga0436365_0051225 | |||
| 1122 | Ga0436365_0074233 | |||
| 1123 | Ga0436363_0875728 | |||
| 1124 | Ga0466972_0086840 | |||
| 1125 | Ga0466965_0002074 | |||
| 1126 | Ga0466963_0066389 | |||
| 1127 | Ga0466964_0055903 | |||
| 1128 | Ga0466960_0001569 | |||
| 1129 | Ga0466960_0134846 | |||
| 1130 | Ga0466958_0166048 | |||
| 1131 | Ga0466967_0015291 | |||
| 1132 | Ga0466967_0033416 | |||
| 1133 | Ga0466967_0057155 | |||
| 1134 | Ga0466967_0165512 | |||
| 1135 | Ga0466967_0347151 | |||
| 1136 | Ga0495592_0081446 | |||
| 1137 | Ga0495603_0002385 | |||
| 1138 | Ga0495603_0070329 | |||
| 1139 | Ga0495629_0004467 | |||
| 1140 | Ga0495629_0006588 | |||
| 1141 | Ga0495641_0002810 | |||
| 1142 | Ga0495641_0009329 | |||
| 1143 | Ga0495641_0020029 | |||
| 1144 | Ga0495641_0032725 | |||
| 1145 | Ga0495651_0002945 | |||
| 1146 | Ga0495651_0010074 | |||
| 1147 | Ga0495651_0020289 | |||
| 1148 | Ga0495651_0021994 | |||
| 1149 | Ga0495651_0088131 | |||
| 1150 | Ga0495653_0008158 | |||
| 1151 | Ga0495653_0012670 | |||
| 1152 | Ga0495653_0013722 | |||
| 1153 | Ga0495653_0087584 | |||
| 1154 | Ga0495653_0103928 | |||
| 1155 | Ga0495653_0307754 | |||
| 1156 | Ga0495580_0004049 | |||
| 1157 | Ga0495582_0001282 | |||
| 1158 | Ga0495582_0004976 | |||
| 1159 | Ga0495582_0007862 | |||
| 1160 | Ga0495582_0090119 | |||
| 1161 | Ga0495639_0001660 | |||
| 1162 | Ga0495639_0091992 | |||
| 1163 | Ga0495662_0000892 | |||
| 1164 | Ga0495662_0004957 | |||
| 1165 | Ga0495662_0025885 | |||
| 1166 | Ga0495662_0078803 | |||
| 1167 | Ga0495664_0000213 | |||
| 1168 | Ga0495664_0006935 | |||
| 1169 | Ga0495664_0052365 | |||
| 1170 | Ga0495664_0055177 | |||
| 1171 | Ga0495664_0058691 | |||
| 1172 | Ga0495664_0072111 | |||
| 1173 | Ga0495664_0136594 | |||
| 1174 | Ga0495594_0008852 | |||
| 1175 | Ga0495594_0119109 | |||
| 1176 | Ga0495608_0000952 | |||
| 1177 | Ga0495608_0003331 | |||
| 1178 | Ga0495608_0004543 | |||
| 1179 | Ga0495608_0018759 | |||
| 1180 | Ga0495608_0026980 | |||
| 1181 | Ga0495608_0045203 | |||
| 1182 | Ga0495608_0121425 | |||
| 1183 | Ga0495608_0256323 | |||
| 1184 | Ga0495618_0027153 | |||
| 1185 | Ga0495618_0028946 | |||
| 1186 | Ga0495618_0037936 | |||
| 1187 | Ga0495618_0054622 | |||
| 1188 | Ga0495618_0076446 | |||
| 1189 | Ga0495628_0016513 | |||
| 1190 | Ga0495628_0045841 | |||
| 1191 | Ga0495628_0119101 | |||
| 1192 | Ga0495628_0228382 | |||
| 1193 | Ga0495628_0263891 | |||
| 1194 | Ga0495628_0484819 | |||
| 1195 | Ga0495630_0010206 | |||
| 1196 | Ga0495630_0015019 | |||
| 1197 | Ga0495630_0042047 | |||
| 1198 | Ga0495630_0051322 | |||
| 1199 | Ga0495630_0179597 | |||
| 1200 | Ga0495666_0013237 | |||
| 1201 | Ga0495666_0019694 | |||
| 1202 | Ga0495652_0002162 | |||
| 1203 | Ga0495652_0029506 | |||
| 1204 | Ga0495652_0050258 | |||
| 1205 | Ga0495652_0116976 | |||
| 1206 | Ga0495652_0174575 | |||
| 1207 | Ga0495665_0002247 | |||
| 1208 | Ga0495665_0009248 | |||
| 1209 | Ga0495665_0042625 | |||
| 1210 | Ga0495665_0281043 | |||
| 1211 | Ga0495640_0008632 | |||
| 1212 | Ga0495640_0018285 | |||
| 1213 | Ga0495640_0029732 | |||
| 1214 | Ga0495640_0033947 | |||
| 1215 | Ga0495640_0041596 | |||
| 1216 | Ga0495640_0084442 | |||
| 1217 | Ga0495586_0031246 | |||
| 1218 | Ga0495586_0054388 | |||
| 1219 | Ga0495587_0010351 | |||
| 1220 | Ga0495587_0031794 | |||
| 1221 | Ga0495587_0045779 | |||
| 1222 | Ga0495587_0048334 | |||
| 1223 | Ga0495587_0087314 | |||
| 1224 | Ga0495587_0185792 | |||
| 1225 | Ga0495645_0012581 | |||
| 1226 | Ga0495645_0024380 | |||
| 1227 | Ga0495645_0026811 | |||
| 1228 | Ga0495645_0050339 | |||
| 1229 | Ga0495645_0074303 | |||
| 1230 | Ga0495645_0209202 | |||
| 1231 | Ga0495645_0274414 | |||
| 1232 | Ga0495667_0000438 | |||
| 1233 | Ga0495667_0164265 | |||
| 1234 | Ga0495667_0190956 | |||
| 1235 | Ga0495634_0006453 | |||
| 1236 | Ga0495634_0009841 | |||
| 1237 | Ga0495634_0020244 | |||
| 1238 | Ga0495634_0053029 | |||
| 1239 | Ga0495634_0075217 | |||
| 1240 | Ga0495635_0001642 | |||
| 1241 | Ga0495635_0002077 | |||
| 1242 | Ga0495635_0031047 | |||
| 1243 | Ga0495635_0055235 | |||
| 1244 | Ga0495635_0121645 | |||
| 1245 | Ga0495635_0244621 | |||
| 1246 | Ga0495588_0064334 | |||
| 1247 | Ga0495657_0002319 | |||
| 1248 | Ga0495657_0013744 | |||
| 1249 | Ga0495657_0025078 | |||
| 1250 | Ga0495657_0075475 | |||
| 1251 | Ga0495599_0014013 | |||
| 1252 | Ga0495599_0018982 | |||
| 1253 | Ga0495599_0073599 | |||
| 1254 | Ga0495623_0041847 | |||
| 1255 | Ga0495623_0060948 | |||
| 1256 | Ga0495623_0099273 | |||
| 1257 | Ga0495646_0020465 | |||
| 1258 | Ga0495646_0037660 | |||
| 1259 | Ga0495646_0255144 | |||
| 1260 | Ga0495658_0001562 | |||
| 1261 | Ga0495658_0007166 | |||
| 1262 | Ga0495658_0008099 | |||
| 1263 | Ga0495658_0077030 | |||
| 1264 | Ga0495613_0006214 | |||
| 1265 | Ga0495613_0007771 | |||
| 1266 | Ga0495613_0100322 | |||
| 1267 | Ga0495624_0005078 | |||
| 1268 | Ga0495624_0025549 | |||
| 1269 | Ga0495600_0023502 | |||
| 1270 | Ga0495581_0000334 | |||
| 1271 | Ga0495581_0004575 | |||
| 1272 | Ga0495581_0068982 | |||
| 1273 | Ga0495604_0064587 | |||
| 1274 | Ga0495604_0077100 | |||
| 1275 | Ga0495604_0103741 | |||
| 1276 | Ga0495604_0273797 | |||
| 1277 | Ga0495674_0004016 | |||
| 1278 | Ga0495674_0008546 | |||
| 1279 | Ga0495674_0026448 | |||
| 1280 | Ga0495674_0041158 | |||
| 1281 | Ga0495674_0041840 | |||
| 1282 | Ga0495674_0065963 | |||
| 1283 | Ga0495674_0077932 | |||
| 1284 | Ga0495674_0150239 | |||
| 1285 | Ga0495674_0249824 | |||
| 1286 | Ga0495676_0010356 | |||
| 1287 | Ga0495676_0024775 | |||
| 1288 | Ga0495676_0198986 | |||
| 1289 | Ga0495680_0002773 | |||
| 1290 | Ga0495680_0006600 | |||
| 1291 | Ga0495680_0007541 | |||
| 1292 | Ga0495680_0008563 | |||
| 1293 | Ga0495680_0014491 | |||
| 1294 | Ga0495680_0015329 | |||
| 1295 | Ga0495680_0016495 | |||
| 1296 | Ga0495680_0051648 | |||
| 1297 | Ga0495675_0018562 | |||
| 1298 | Ga0495675_0024694 | |||
| 1299 | Ga0495675_0046706 | |||
| 1300 | Ga0495675_0090539 | |||
| 1301 | Ga0495675_0091433 | |||
| 1302 | Ga0495675_0131819 | |||
| 1303 | Ga0495684_0004012 | |||
| 1304 | Ga0495684_0013377 | |||
| 1305 | Ga0495684_0037457 | |||
| 1306 | Ga0495684_0125125 | |||
| 1307 | Ga0495684_0157875 | |||
| 1308 | Ga0495593_0002306 | |||
| 1309 | Ga0495593_0003796 | |||
| 1310 | Ga0495593_0020997 | |||
| 1311 | Ga0495602_0014410 | |||
| 1312 | Ga0495602_0021713 | |||
| 1313 | Ga0495602_0034829 | |||
| 1314 | Ga0495602_0034999 | |||
| 1315 | Ga0495602_0061304 | |||
| 1316 | Ga0495602_0088577 | |||
| 1317 | Ga0495602_0160970 | |||
| 1318 | Ga0495614_0045660 | |||
| 1319 | Ga0495614_0091164 | |||
| 1320 | Ga0496100_0031189 | |||
| 1321 | Ga0496101_0007606 | |||
| 1322 | Ga0496101_0016465 | |||
| 1323 | Ga0496102_0000018 | |||
| 1324 | Ga0496102_0140548 | |||
| 1325 | Ga0496102_0664112 | |||
| 1326 | Ga0496103_0000188 | |||
| 1327 | Ga0496104_0028278 | |||
| 1328 | Ga0496104_0144388 | |||
| 1329 | Ga0496105_0020504 | |||
| 1330 | Ga0496105_0042345 | |||
| 1331 | Ga0496105_0093344 | |||
| 1332 | Ga0496105_0179762 | |||
| 1333 | Ga0496106_0308996 | |||
| 1334 | Ga0496107_0022214 | |||
| 1335 | Ga0496108_0119530 | |||
| 1336 | Ga0496108_0191796 | |||
| 1337 | Ga0496108_0416353 | |||
| 1338 | Ga0496109_0106637 | |||
| 1339 | Ga0496109_0210671 | |||
| 1340 | Ga0496110_0696170 | |||
| 1341 | Ga0496111_0468449 | |||
| 1342 | Ga0496112_0056240 | |||
| 1343 | Ga0496112_0058641 | |||
| 1344 | Ga0496112_0160611 | |||
| 1345 | Ga0496112_0266267 | |||
| 1346 | Ga0496113_0077699 | |||
| 1347 | Ga0496113_0495839 | |||
| 1348 | Ga0496114_0011592 | |||
| 1349 | Ga0496114_0245261 | |||
| 1350 | Ga0496114_0319059 | |||
| 1351 | Ga0496115_0016167 | |||
| 1352 | Ga0496115_0048077 | |||
| 1353 | Ga0496115_0067682 | |||
| 1354 | Ga0496115_0328224 | |||
| 1355 | Ga0496116_0002538 | |||
| 1356 | Ga0496117_0000528 | |||
| 1357 | Ga0496118_0000136 | |||
| 1358 | Ga0496119_0001749 | |||
| 1359 | Ga0496121_0008808 | |||
| 1360 | Ga0496124_0001945 | |||
| 1361 | Ga0496125_0008449 | |||
| 1362 | Ga0496126_0000585 | |||
| 1363 | Ga0496126_0018077 | |||
| 1364 | Ga0496126_0464803 | |||
| 1365 | nmdc:mga05p37_145562_c1 | |||
| 1366 | nmdc:mga05p37_495152_c1 | |||
| 1367 | nmdc:mga05p37_9965_c1 | |||
| 1368 | nmdc:mga09592_109738_c1 | |||
| 1369 | nmdc:mga09592_486060_c1 | |||
| 1370 | nmdc:mga0qj67_338492_c1 | |||
| 1371 | nmdc:mga08y16_114293_c1 | |||
| 1372 | nmdc:mga0n895_141179_c1 | |||
| 1373 | nmdc:mga0n895_245636_c1 | |||
| 1374 | nmdc:mga0n895_572754_c1 | |||
| 1375 | nmdc:mga0n895_7305_c1 | |||
| 1376 | nmdc:mga0n895_89729_c1 | |||
| 1377 | nmdc:mga0rr50_16552_c1 | |||
| 1378 | nmdc:mga0rr50_210728_c1 | |||
| 1379 | nmdc:mga0rr50_28794_c1 | |||
| 1380 | nmdc:mga08x19_268877_c1 | |||
| 1381 | nmdc:mga08x19_319923_c1 | |||
| 1382 | nmdc:mga08x19_495006_c1 | |||
| 1383 | nmdc:mga0a205_148780_c1 | |||
| 1384 | Ga0495601_0028268 | |||
| 1385 | Ga0495601_0033637 | |||
| 1386 | Ga0495601_0066734 | |||
| 1387 | Ga0495601_0073089 | |||
| 1388 | Ga0495601_0094995 | |||
| 1389 | Ga0495601_0095828 | |||
| 1390 | Ga0495612_0001691 | |||
| 1391 | Ga0495612_0017788 | |||
| 1392 | Ga0495612_0037837 | |||
| 1393 | Ga0495595_0011106 | |||
| 1394 | Ga0495595_0011200 | |||
| 1395 | Ga0495619_0003740 | |||
| 1396 | Ga0495619_0018879 | |||
| 1397 | Ga0495619_0049253 | |||
| 1398 | Ga0495619_0177984 | |||
| 1399 | 2558913602 | |||
| 1400 | 2816510635 | |||
| 1401 | 2915360376 | |||
| 1402 | 8054478099 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3zig-assembly2.cif.gz_B | sepf-like protein from pyrococcus furiosus | 0.7458 | 72 | 99 |
| 1ydm-assembly1.cif.gz_A | x-ray structure of northeast structural genomics target sr44 | 0.7333 | 25 | 223 |
| 1ydm-assembly1.cif.gz_A | x-ray structure of northeast structural genomics target sr44 | 0.7222 | 25 | 223 |
| 1ydm-assembly1.cif.gz_B | x-ray structure of northeast structural genomics target sr44 | 0.7164 | 25 | 223 |
| 1wkc-assembly1.cif.gz_A | crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from thermus thermophilus hb8 | 0.7119 | 22 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7K717_81_247_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.9102 | 54 | 222 | 3.40.50.10420 |
| af_Q0P464_46_270_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.9014 | 55 | 256 | 3.40.50.10420 |
| af_Q3URQ7_10_217_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8983 | 24 | 227 | 3.40.50.10420 |
| af_K7K717_81_247_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8947 | 54 | 222 | 3.40.50.10420 |
| af_Q2M296_43_218_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8943 | 55 | 227 | 3.40.50.10420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534X374-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase | 0.9624 | 22 | 160 |
GO:0005737
|
| AF-A0A1I5ATK4-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase | 0.9585 | 14 | 154 |
GO:0005737
GO:0016874 |
| AF-A0A411YAR1-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase | 0.9562 | 7 | 258 |
GO:0005737
GO:0016874 |
| AF-A0A6H1WS78-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase | 0.9561 | 15 | 228 |
GO:0005737
GO:0016874 |
| AF-A0A151FC49-F1-model_v4 | Probable RNA 2'-phosphotransferase (EC 2.7.1.-) | 0.953 | 18 | 223 |
GO:0003950
GO:0005737 GO:0006388 GO:0016772 |