F476089
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 700 | 285 | 1400 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10484272|Ga0157372_104842721 |
| Length | 265 |
| Sequence | VITNCSQGFCNQTSIGFGLTVPKNGSAAKEHAGRVREMFGRIARRYDLLNHVLSGNVDKRWRRIVATRIREKLXXXLSANTEARVLDVACGTGDLSLALFEITGAGVVGTDFCRPMLAIAAGKTSGRIRLIEGDALDLPFRDGTFDVATIAFGLRNLSNVESGLAELSRVLKPGGWVAVLEFSRPANAILRPMFNLYFRKLLPMMGGLISGSLSAYTYLPASVQKFPDQSQLSLLMEQAGFDQVGYENLTGGIAALHMGKKAGMS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 176 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 177 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 193 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 201 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 205 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 206 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 207 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 217 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 218 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 224 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 225 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 226 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 227 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 228 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 229 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 239 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 240 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 241 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 242 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 243 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 244 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 245 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 246 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 248 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 249 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 251 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 252 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 253 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 254 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 255 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 256 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 257 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 258 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 259 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 261 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 263 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 264 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 265 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 266 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 267 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 269 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 270 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 281 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 282 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 284 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 285 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.86 |
| Metatranscriptomes | 0.86 |
| Isolates | 0.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 2 |
| Rhizosphere | 97.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 25.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157372_10484272 | 3300013307 | Unclassified | 1442 |
| 2 | SwRhRL2b_contig_3777873 | 2162886007 | Bacteria | 1122 |
| 3 | CNBas_1000630 | 3300000531 | Unclassified | 1618 |
| 4 | CNAas_1001018 | 3300000532 | Unclassified | 2586 |
| 5 | JGI24751J29686_10000018 | 3300002459 | Bacteria | 107255 |
| 6 | Ga0065714_10064448 | 3300005288 | Bacteria | 81247 |
| 7 | Ga0065704_10009998 | 3300005289 | Bacteria | 2322 |
| 8 | Ga0065712_10000125 | 3300005290 | Bacteria | 81248 |
| 9 | Ga0065712_10083355 | 3300005290 | Bacteria | 2817 |
| 10 | Ga0065712_10199224 | 3300005290 | Unclassified | 1115 |
| 11 | Ga0065715_10003822 | 3300005293 | Bacteria | 3818 |
| 12 | Ga0065715_10016236 | 3300005293 | Bacteria | 1876 |
| 13 | Ga0065715_10021447 | 3300005293 | Unclassified | 1516 |
| 14 | Ga0065715_10098956 | 3300005293 | Bacteria | 3477 |
| 15 | Ga0065707_10001187 | 3300005295 | Bacteria | 9530 |
| 16 | Ga0065707_10140670 | 3300005295 | Bacteria | 1777 |
| 17 | Ga0065707_10358074 | 3300005295 | Unclassified | 908 |
| 18 | Ga0070676_10134340 | 3300005328 | Bacteria | 1568 |
| 19 | Ga0070683_100069237 | 3300005329 | Bacteria | 3289 |
| 20 | Ga0070683_100601505 | 3300005329 | Bacteria | 1052 |
| 21 | Ga0070690_100032281 | 3300005330 | Bacteria | 3269 |
| 22 | Ga0070690_100081917 | 3300005330 | Bacteria | 2112 |
| 23 | Ga0070670_100000829 | 3300005331 | Bacteria | 24166 |
| 24 | Ga0070670_100078512 | 3300005331 | Bacteria | 2836 |
| 25 | Ga0070670_100156644 | 3300005331 | Bacteria | 1973 |
| 26 | Ga0070670_100525291 | 3300005331 | Bacteria | 1054 |
| 27 | Ga0068869_100017538 | 3300005334 | Bacteria | 4854 |
| 28 | Ga0068869_100184416 | 3300005334 | Bacteria | 1637 |
| 29 | Ga0070666_10121126 | 3300005335 | Unclassified | 1814 |
| 30 | Ga0070666_10166517 | 3300005335 | Unclassified | 1542 |
| 31 | Ga0070680_100000085 | 3300005336 | Bacteria | 51915 |
| 32 | Ga0070680_100032083 | 3300005336 | Bacteria | 4226 |
| 33 | Ga0068868_100057339 | 3300005338 | Bacteria | 3077 |
| 34 | Ga0070660_100040665 | 3300005339 | Bacteria | 3540 |
| 35 | Ga0070689_100003820 | 3300005340 | Bacteria | 10089 |
| 36 | Ga0070689_100058255 | 3300005340 | Bacteria | 3000 |
| 37 | Ga0070689_100147204 | 3300005340 | Bacteria | 1898 |
| 38 | Ga0070689_100216524 | 3300005340 | Unclassified | 1569 |
| 39 | Ga0070687_100014360 | 3300005343 | Bacteria | 3557 |
| 40 | Ga0070687_100040477 | 3300005343 | Bacteria | 2348 |
| 41 | Ga0070687_100082467 | 3300005343 | Unclassified | 1758 |
| 42 | Ga0070687_100085885 | 3300005343 | Bacteria | 1728 |
| 43 | Ga0070661_100017837 | 3300005344 | Bacteria | 5038 |
| 44 | Ga0070692_10104945 | 3300005345 | Unclassified | 1554 |
| 45 | Ga0070692_10217331 | 3300005345 | Bacteria | 1128 |
| 46 | Ga0070692_10377367 | 3300005345 | Unclassified | 888 |
| 47 | Ga0070668_100331882 | 3300005347 | Unclassified | 1283 |
| 48 | Ga0070669_100254018 | 3300005353 | Unclassified | 1400 |
| 49 | Ga0070675_100026344 | 3300005354 | Unclassified | 4666 |
| 50 | Ga0070675_100248928 | 3300005354 | Bacteria | 1555 |
| 51 | Ga0070675_100251998 | 3300005354 | Bacteria | 1545 |
| 52 | Ga0070675_100322179 | 3300005354 | Bacteria | 1365 |
| 53 | Ga0070671_100009327 | 3300005355 | Bacteria | 7881 |
| 54 | Ga0070671_100037974 | 3300005355 | Bacteria | 3996 |
| 55 | Ga0070671_100043065 | 3300005355 | Bacteria | 3753 |
| 56 | Ga0070671_100162188 | 3300005355 | Bacteria | 1890 |
| 57 | Ga0070671_100261601 | 3300005355 | Bacteria | 1471 |
| 58 | Ga0070671_100508350 | 3300005355 | Unclassified | 1037 |
| 59 | Ga0070674_100021879 | 3300005356 | Bacteria | 4115 |
| 60 | Ga0070674_100054459 | 3300005356 | Bacteria | 2767 |
| 61 | Ga0070673_100052450 | 3300005364 | Bacteria | 3200 |
| 62 | Ga0070673_100073204 | 3300005364 | Bacteria | 2757 |
| 63 | Ga0070688_100124050 | 3300005365 | Unclassified | 1734 |
| 64 | Ga0070688_100226715 | 3300005365 | Bacteria | 1320 |
| 65 | Ga0070659_100005823 | 3300005366 | Bacteria | 8879 |
| 66 | Ga0070667_100070252 | 3300005367 | Bacteria | 2980 |
| 67 | Ga0070703_10000590 | 3300005406 | Bacteria | 13107 |
| 68 | Ga0070703_10030797 | 3300005406 | Bacteria | 1619 |
| 69 | Ga0070705_100042791 | 3300005440 | Bacteria | 2591 |
| 70 | Ga0070705_100382162 | 3300005440 | Unclassified | 1037 |
| 71 | Ga0070705_100399062 | 3300005440 | Unclassified | 1018 |
| 72 | Ga0070705_100429035 | 3300005440 | Bacteria | 986 |
| 73 | Ga0070705_100456803 | 3300005440 | Bacteria | 959 |
| 74 | Ga0070700_100000082 | 3300005441 | Bacteria | 63662 |
| 75 | Ga0070700_100017779 | 3300005441 | Unclassified | 4073 |
| 76 | Ga0070700_100019597 | 3300005441 | Bacteria | 3907 |
| 77 | Ga0070700_100034320 | 3300005441 | Bacteria | 3063 |
| 78 | Ga0070700_100154118 | 3300005441 | Unclassified | 1574 |
| 79 | Ga0070694_100060520 | 3300005444 | Bacteria | 2583 |
| 80 | Ga0070694_100116969 | 3300005444 | Bacteria | 1908 |
| 81 | Ga0070694_100243747 | 3300005444 | Bacteria | 1357 |
| 82 | Ga0070708_100230421 | 3300005445 | Bacteria | 1738 |
| 83 | Ga0070708_100296717 | 3300005445 | Bacteria | 1522 |
| 84 | Ga0070678_100164102 | 3300005456 | Bacteria | 1803 |
| 85 | Ga0070662_100147623 | 3300005457 | Unclassified | 1828 |
| 86 | Ga0070662_100283347 | 3300005457 | Bacteria | 1342 |
| 87 | Ga0070681_10000189 | 3300005458 | Bacteria | 47802 |
| 88 | Ga0070681_10012114 | 3300005458 | Bacteria | 8552 |
| 89 | Ga0068867_100120362 | 3300005459 | Unclassified | 2028 |
| 90 | Ga0068867_100187719 | 3300005459 | Unclassified | 1648 |
| 91 | Ga0068867_100245747 | 3300005459 | Bacteria | 1453 |
| 92 | Ga0070685_10028014 | 3300005466 | Unclassified | 3118 |
| 93 | Ga0070685_10115757 | 3300005466 | Unclassified | 1658 |
| 94 | Ga0070685_10288554 | 3300005466 | Bacteria | 1101 |
| 95 | Ga0070685_10296861 | 3300005466 | Unclassified | 1088 |
| 96 | Ga0070706_100000032 | 3300005467 | Bacteria | 152892 |
| 97 | Ga0070706_100004529 | 3300005467 | Bacteria | 13381 |
| 98 | Ga0070706_100166730 | 3300005467 | Unclassified | 2057 |
| 99 | Ga0070707_100013173 | 3300005468 | Bacteria | 7730 |
| 100 | Ga0070707_100113615 | 3300005468 | Bacteria | 2628 |
| 101 | Ga0070707_100242307 | 3300005468 | Bacteria | 1755 |
| 102 | Ga0070707_100316552 | 3300005468 | Bacteria | 1516 |
| 103 | Ga0070698_100004879 | 3300005471 | Bacteria | 14718 |
| 104 | Ga0070698_100013434 | 3300005471 | Bacteria | 8667 |
| 105 | Ga0070698_100038837 | 3300005471 | Bacteria | 4905 |
| 106 | Ga0070698_100049712 | 3300005471 | Unclassified | 4278 |
| 107 | Ga0070698_100234328 | 3300005471 | Bacteria | 1769 |
| 108 | Ga0070699_100045130 | 3300005518 | Unclassified | 3814 |
| 109 | Ga0070699_100105975 | 3300005518 | Bacteria | 2466 |
| 110 | Ga0070679_100000291 | 3300005530 | Bacteria | 42609 |
| 111 | Ga0070679_100006719 | 3300005530 | Bacteria | 10729 |
| 112 | Ga0070679_100148691 | 3300005530 | Bacteria | 2320 |
| 113 | Ga0070684_100027640 | 3300005535 | Bacteria | 4791 |
| 114 | Ga0070684_101091455 | 3300005535 | Bacteria | 750 |
| 115 | Ga0070697_100001573 | 3300005536 | Bacteria | 17399 |
| 116 | Ga0070697_100159721 | 3300005536 | Bacteria | 1904 |
| 117 | Ga0070697_100192256 | 3300005536 | Bacteria | 1732 |
| 118 | Ga0070697_100245860 | 3300005536 | Bacteria | 1529 |
| 119 | Ga0070697_100278382 | 3300005536 | Bacteria | 1435 |
| 120 | Ga0068853_100005183 | 3300005539 | Bacteria | 10195 |
| 121 | Ga0068853_100009713 | 3300005539 | Bacteria | 7759 |
| 122 | Ga0068853_100060750 | 3300005539 | Bacteria | 3266 |
| 123 | Ga0068853_100119878 | 3300005539 | Bacteria | 2345 |
| 124 | Ga0068853_100237815 | 3300005539 | Bacteria | 1668 |
| 125 | Ga0070672_100024304 | 3300005543 | Bacteria | 4475 |
| 126 | Ga0070672_100094758 | 3300005543 | Bacteria | 2414 |
| 127 | Ga0070672_100495573 | 3300005543 | Bacteria | 1056 |
| 128 | Ga0070686_100015018 | 3300005544 | Bacteria | 4477 |
| 129 | Ga0070686_100038719 | 3300005544 | Bacteria | 2966 |
| 130 | Ga0070695_100031923 | 3300005545 | Bacteria | 3290 |
| 131 | Ga0070695_100059527 | 3300005545 | Bacteria | 2473 |
| 132 | Ga0070695_100107786 | 3300005545 | Bacteria | 1885 |
| 133 | Ga0070695_100142552 | 3300005545 | Unclassified | 1663 |
| 134 | Ga0070695_100321941 | 3300005545 | Unclassified | 1150 |
| 135 | Ga0070696_100028550 | 3300005546 | Bacteria | 3807 |
| 136 | Ga0070696_100069061 | 3300005546 | Bacteria | 2482 |
| 137 | Ga0070696_100235259 | 3300005546 | Unclassified | 1379 |
| 138 | Ga0070696_100391221 | 3300005546 | Bacteria | 1086 |
| 139 | Ga0070693_100003406 | 3300005547 | Bacteria | 7408 |
| 140 | Ga0070693_100011698 | 3300005547 | Bacteria | 4424 |
| 141 | Ga0070693_100118400 | 3300005547 | Bacteria | 1639 |
| 142 | Ga0070693_100121107 | 3300005547 | Bacteria | 1623 |
| 143 | Ga0070693_100455712 | 3300005547 | Bacteria | 898 |
| 144 | Ga0070665_100113442 | 3300005548 | Bacteria | 2713 |
| 145 | Ga0070665_100734833 | 3300005548 | Bacteria | 1000 |
| 146 | Ga0070704_100020119 | 3300005549 | Bacteria | 4297 |
| 147 | Ga0070704_100165969 | 3300005549 | Unclassified | 1751 |
| 148 | Ga0070704_100183663 | 3300005549 | Bacteria | 1675 |
| 149 | Ga0070704_100504242 | 3300005549 | Bacteria | 1050 |
| 150 | Ga0068855_100574693 | 3300005563 | Bacteria | 1218 |
| 151 | Ga0068855_100654633 | 3300005563 | Bacteria | 1128 |
| 152 | Ga0070664_100000776 | 3300005564 | Bacteria | 24631 |
| 153 | Ga0070664_100306620 | 3300005564 | Unclassified | 1436 |
| 154 | Ga0070664_100422442 | 3300005564 | Unclassified | 1221 |
| 155 | Ga0068857_100016988 | 3300005577 | Bacteria | 6375 |
| 156 | Ga0068857_100190695 | 3300005577 | Bacteria | 1867 |
| 157 | Ga0068857_100261789 | 3300005577 | Bacteria | 1587 |
| 158 | Ga0068857_100342291 | 3300005577 | Bacteria | 1384 |
| 159 | Ga0068857_100447314 | 3300005577 | Bacteria | 1207 |
| 160 | Ga0068857_100473769 | 3300005577 | Unclassified | 1173 |
| 161 | Ga0068857_100620818 | 3300005577 | Unclassified | 1023 |
| 162 | Ga0068854_100061560 | 3300005578 | Unclassified | 2719 |
| 163 | Ga0068854_100112913 | 3300005578 | Unclassified | 2052 |
| 164 | Ga0068854_100195615 | 3300005578 | Bacteria | 1587 |
| 165 | Ga0068854_100287133 | 3300005578 | Bacteria | 1327 |
| 166 | Ga0070702_100007938 | 3300005615 | Bacteria | 5113 |
| 167 | Ga0070702_100056597 | 3300005615 | Bacteria | 2265 |
| 168 | Ga0068852_100186401 | 3300005616 | Unclassified | 1954 |
| 169 | Ga0068852_100504253 | 3300005616 | Bacteria | 1205 |
| 170 | Ga0068859_100005862 | 3300005617 | Bacteria | 12470 |
| 171 | Ga0068859_100021877 | 3300005617 | Bacteria | 6412 |
| 172 | Ga0068859_100074033 | 3300005617 | Bacteria | 3444 |
| 173 | Ga0068859_100297767 | 3300005617 | Bacteria | 1706 |
| 174 | Ga0068859_100354765 | 3300005617 | Unclassified | 1561 |
| 175 | Ga0068859_100505621 | 3300005617 | Bacteria | 1303 |
| 176 | Ga0068859_100656770 | 3300005617 | Unclassified | 1140 |
| 177 | Ga0068859_100935724 | 3300005617 | Bacteria | 950 |
| 178 | Ga0068864_100003461 | 3300005618 | Bacteria | 13038 |
| 179 | Ga0068864_100010651 | 3300005618 | Bacteria | 7601 |
| 180 | Ga0068864_100010804 | 3300005618 | Bacteria | 7544 |
| 181 | Ga0068864_100174501 | 3300005618 | Bacteria | 1961 |
| 182 | Ga0068864_100233843 | 3300005618 | Bacteria | 1700 |
| 183 | Ga0068864_100360925 | 3300005618 | Bacteria | 1373 |
| 184 | Ga0068864_100555185 | 3300005618 | Unclassified | 1110 |
| 185 | Ga0068864_100657513 | 3300005618 | Bacteria | 1021 |
| 186 | Ga0068866_10004396 | 3300005718 | Bacteria | 5786 |
| 187 | Ga0068861_100008878 | 3300005719 | Bacteria | 6928 |
| 188 | Ga0068861_100054660 | 3300005719 | Bacteria | 3042 |
| 189 | Ga0068861_100689171 | 3300005719 | Unclassified | 948 |
| 190 | Ga0068851_10001971 | 3300005834 | Bacteria | 9017 |
| 191 | Ga0068870_10077871 | 3300005840 | Unclassified | 1825 |
| 192 | Ga0068870_10119978 | 3300005840 | Bacteria | 1513 |
| 193 | Ga0068870_10216546 | 3300005840 | Bacteria | 1170 |
| 194 | Ga0068863_100044755 | 3300005841 | Bacteria | 4200 |
| 195 | Ga0068863_100080761 | 3300005841 | Bacteria | 3080 |
| 196 | Ga0068863_100159412 | 3300005841 | Bacteria | 2161 |
| 197 | Ga0068863_100244662 | 3300005841 | Bacteria | 1732 |
| 198 | Ga0068863_100305117 | 3300005841 | Bacteria | 1545 |
| 199 | Ga0068863_100318823 | 3300005841 | Bacteria | 1510 |
| 200 | Ga0068863_100541586 | 3300005841 | Bacteria | 1149 |
| 201 | Ga0068858_100046446 | 3300005842 | Bacteria | 4025 |
| 202 | Ga0068858_100104178 | 3300005842 | Bacteria | 2647 |
| 203 | Ga0068858_100571031 | 3300005842 | Bacteria | 1096 |
| 204 | Ga0068858_100958367 | 3300005842 | Unclassified | 838 |
| 205 | Ga0068860_100043088 | 3300005843 | Bacteria | 4307 |
| 206 | Ga0068860_100066186 | 3300005843 | Bacteria | 3432 |
| 207 | Ga0068860_100198591 | 3300005843 | Unclassified | 1943 |
| 208 | Ga0068860_100593549 | 3300005843 | Unclassified | 1112 |
| 209 | Ga0068860_101101304 | 3300005843 | Unclassified | 814 |
| 210 | Ga0068862_100009515 | 3300005844 | Bacteria | 8039 |
| 211 | Ga0068862_100059803 | 3300005844 | Unclassified | 3272 |
| 212 | Ga0068862_100073109 | 3300005844 | Bacteria | 2963 |
| 213 | Ga0068862_100120417 | 3300005844 | Unclassified | 2313 |
| 214 | Ga0068862_100346017 | 3300005844 | Bacteria | 1378 |
| 215 | Ga0068862_100867536 | 3300005844 | Unclassified | 885 |
| 216 | Ga0068862_100925176 | 3300005844 | Bacteria | 858 |
| 217 | Ga0081539_10000119 | 3300005985 | Bacteria | 184136 |
| 218 | Ga0081539_10038216 | 3300005985 | Bacteria | 2847 |
| 219 | Ga0070716_100016082 | 3300006173 | Bacteria | 3856 |
| 220 | Ga0075427_10011930 | 3300006194 | Bacteria | 1315 |
| 221 | Ga0097621_100007801 | 3300006237 | Bacteria | 7678 |
| 222 | Ga0097621_100014964 | 3300006237 | Bacteria | 5823 |
| 223 | Ga0097621_100018926 | 3300006237 | Bacteria | 5274 |
| 224 | Ga0097621_100204375 | 3300006237 | Bacteria | 1716 |
| 225 | Ga0097621_100228828 | 3300006237 | Bacteria | 1623 |
| 226 | Ga0068871_100001650 | 3300006358 | Bacteria | 15016 |
| 227 | Ga0068871_100077222 | 3300006358 | Bacteria | 2752 |
| 228 | Ga0068871_100151077 | 3300006358 | Bacteria | 1981 |
| 229 | Ga0068871_100162516 | 3300006358 | Bacteria | 1910 |
| 230 | Ga0075428_100157015 | 3300006844 | Unclassified | 2470 |
| 231 | Ga0075430_100061664 | 3300006846 | Bacteria | 3151 |
| 232 | Ga0075433_10032818 | 3300006852 | Unclassified | 4448 |
| 233 | Ga0075433_10065296 | 3300006852 | Unclassified | 3192 |
| 234 | Ga0075433_10143130 | 3300006852 | Bacteria | 2125 |
| 235 | Ga0075433_10235713 | 3300006852 | Unclassified | 1625 |
| 236 | Ga0075433_10363839 | 3300006852 | Bacteria | 1278 |
| 237 | Ga0075434_100062273 | 3300006871 | Unclassified | 3713 |
| 238 | Ga0075434_100079800 | 3300006871 | Bacteria | 3269 |
| 239 | Ga0075434_100242465 | 3300006871 | Bacteria | 1822 |
| 240 | Ga0075429_100223441 | 3300006880 | Bacteria | 1649 |
| 241 | Ga0075436_100000018 | 3300006914 | Bacteria | 139195 |
| 242 | Ga0075436_100034671 | 3300006914 | Unclassified | 3481 |
| 243 | Ga0097620_100005862 | 3300006931 | Bacteria | 12470 |
| 244 | Ga0097620_100021877 | 3300006931 | Bacteria | 6412 |
| 245 | Ga0097620_100074031 | 3300006931 | Bacteria | 3444 |
| 246 | Ga0097620_100297753 | 3300006931 | Bacteria | 1706 |
| 247 | Ga0097620_100354794 | 3300006931 | Unclassified | 1561 |
| 248 | Ga0097620_100505634 | 3300006931 | Bacteria | 1303 |
| 249 | Ga0097620_100656761 | 3300006931 | Unclassified | 1140 |
| 250 | Ga0097620_100935686 | 3300006931 | Bacteria | 950 |
| 251 | Ga0075435_100039902 | 3300007076 | Bacteria | 3747 |
| 252 | Ga0075435_100366134 | 3300007076 | Bacteria | 1237 |
| 253 | Ga0105240_10201046 | 3300009093 | Bacteria | 2335 |
| 254 | Ga0111539_10002689 | 3300009094 | Bacteria | 23536 |
| 255 | Ga0111539_10020653 | 3300009094 | Bacteria | 8112 |
| 256 | Ga0111539_10043691 | 3300009094 | Bacteria | 5371 |
| 257 | Ga0105245_10085599 | 3300009098 | Bacteria | 2890 |
| 258 | Ga0105247_10022348 | 3300009101 | Bacteria | 3809 |
| 259 | Ga0114129_10020760 | 3300009147 | Bacteria | 9335 |
| 260 | Ga0114129_10043427 | 3300009147 | Bacteria | 6324 |
| 261 | Ga0114129_10086482 | 3300009147 | Bacteria | 4348 |
| 262 | Ga0114129_10116458 | 3300009147 | Bacteria | 3683 |
| 263 | Ga0114129_10138936 | 3300009147 | Unclassified | 3332 |
| 264 | Ga0114129_10402979 | 3300009147 | Bacteria | 1802 |
| 265 | Ga0114129_10914001 | 3300009147 | Bacteria | 1111 |
| 266 | Ga0114129_10966887 | 3300009147 | Bacteria | 1075 |
| 267 | Ga0105243_10003475 | 3300009148 | Bacteria | 12719 |
| 268 | Ga0105243_10100879 | 3300009148 | Bacteria | 2396 |
| 269 | Ga0105243_10521576 | 3300009148 | Bacteria | 1130 |
| 270 | Ga0105243_10681621 | 3300009148 | Unclassified | 1000 |
| 271 | Ga0105241_10118235 | 3300009174 | Bacteria | 2131 |
| 272 | Ga0105241_10207490 | 3300009174 | Bacteria | 1640 |
| 273 | Ga0105241_10210235 | 3300009174 | Unclassified | 1630 |
| 274 | Ga0105241_10217959 | 3300009174 | Unclassified | 1602 |
| 275 | Ga0105241_10245976 | 3300009174 | Unclassified | 1514 |
| 276 | Ga0105242_10014594 | 3300009176 | Bacteria | 6082 |
| 277 | Ga0105242_10734550 | 3300009176 | Unclassified | 970 |
| 278 | Ga0105248_10006121 | 3300009177 | Bacteria | 13199 |
| 279 | Ga0105248_10011370 | 3300009177 | Bacteria | 9809 |
| 280 | Ga0105248_10043882 | 3300009177 | Bacteria | 5015 |
| 281 | Ga0105248_10100888 | 3300009177 | Bacteria | 3253 |
| 282 | Ga0105248_10239829 | 3300009177 | Bacteria | 2041 |
| 283 | Ga0105248_10428158 | 3300009177 | Bacteria | 1490 |
| 284 | Ga0105248_10474221 | 3300009177 | Bacteria | 1411 |
| 285 | Ga0105248_10520859 | 3300009177 | Bacteria | 1341 |
| 286 | Ga0105237_10000839 | 3300009545 | Bacteria | 42008 |
| 287 | Ga0105237_10012180 | 3300009545 | Bacteria | 9069 |
| 288 | Ga0105237_10323035 | 3300009545 | Unclassified | 1547 |
| 289 | Ga0105238_10005480 | 3300009551 | Bacteria | 12546 |
| 290 | Ga0105238_10024095 | 3300009551 | Bacteria | 6205 |
| 291 | Ga0105249_10071983 | 3300009553 | Bacteria | 3195 |
| 292 | Ga0105249_10094619 | 3300009553 | Bacteria | 2800 |
| 293 | Ga0105249_10403697 | 3300009553 | Bacteria | 1397 |
| 294 | Ga0105249_10503952 | 3300009553 | Bacteria | 1256 |
| 295 | Ga0105249_10617851 | 3300009553 | Unclassified | 1139 |
| 296 | Ga0105249_10960336 | 3300009553 | Bacteria | 923 |
| 297 | Ga0105239_10050773 | 3300010375 | Bacteria | 4548 |
| 298 | Ga0105239_10181345 | 3300010375 | Bacteria | 2356 |
| 299 | Ga0105239_10412802 | 3300010375 | Unclassified | 1529 |
| 300 | Ga0105239_11544396 | 3300010375 | Bacteria | 767 |
| 301 | Ga0105246_10019654 | 3300011119 | Bacteria | 4321 |
| 302 | Ga0105246_10095744 | 3300011119 | Unclassified | 2150 |
| 303 | Ga0105246_10117138 | 3300011119 | Bacteria | 1968 |
| 304 | Ga0157373_10013264 | 3300013100 | Bacteria | 6049 |
| 305 | Ga0157373_10016977 | 3300013100 | Bacteria | 5302 |
| 306 | Ga0157373_10026123 | 3300013100 | Bacteria | 4220 |
| 307 | Ga0157373_10343465 | 3300013100 | Bacteria | 1064 |
| 308 | Ga0157373_10369330 | 3300013100 | Unclassified | 1025 |
| 309 | Ga0157373_10409732 | 3300013100 | Unclassified | 972 |
| 310 | Ga0157374_10011837 | 3300013296 | Bacteria | 7568 |
| 311 | Ga0157378_10008975 | 3300013297 | Bacteria | 8705 |
| 312 | Ga0157378_10086217 | 3300013297 | Bacteria | 2846 |
| 313 | Ga0157378_10150589 | 3300013297 | Bacteria | 2167 |
| 314 | Ga0157378_10300797 | 3300013297 | Unclassified | 1553 |
| 315 | Ga0157378_10627498 | 3300013297 | Bacteria | 1088 |
| 316 | Ga0157378_10758812 | 3300013297 | Unclassified | 993 |
| 317 | Ga0157378_11106208 | 3300013297 | Unclassified | 829 |
| 318 | Ga0163162_10001915 | 3300013306 | Bacteria | 19599 |
| 319 | Ga0163162_10003332 | 3300013306 | Bacteria | 15373 |
| 320 | Ga0163162_10013243 | 3300013306 | Bacteria | 8055 |
| 321 | Ga0163162_10126202 | 3300013306 | Unclassified | 2665 |
| 322 | Ga0163162_10143571 | 3300013306 | Bacteria | 2501 |
| 323 | Ga0163162_10175236 | 3300013306 | Unclassified | 2270 |
| 324 | Ga0163162_10419413 | 3300013306 | Unclassified | 1471 |
| 325 | Ga0163162_10513791 | 3300013306 | Bacteria | 1328 |
| 326 | Ga0163162_10613444 | 3300013306 | Bacteria | 1213 |
| 327 | Ga0157372_10174330 | 3300013307 | Bacteria | 2489 |
| 328 | Ga0157372_10393550 | 3300013307 | Unclassified | 1615 |
| 329 | Ga0157372_10650593 | 3300013307 | Bacteria | 1227 |
| 330 | Ga0157375_10021478 | 3300013308 | Bacteria | 5920 |
| 331 | Ga0157375_10205177 | 3300013308 | Unclassified | 2127 |
| 332 | Ga0157375_10378669 | 3300013308 | Bacteria | 1582 |
| 333 | Ga0157375_10451183 | 3300013308 | Unclassified | 1452 |
| 334 | Ga0157375_10606546 | 3300013308 | Unclassified | 1253 |
| 335 | Ga0157375_10623175 | 3300013308 | Bacteria | 1237 |
| 336 | Ga0157375_11325688 | 3300013308 | Unclassified | 847 |
| 337 | Ga0163163_10000359 | 3300014325 | Bacteria | 43790 |
| 338 | Ga0163163_10035844 | 3300014325 | Unclassified | 4816 |
| 339 | Ga0163163_10037238 | 3300014325 | Bacteria | 4731 |
| 340 | Ga0163163_10037790 | 3300014325 | Bacteria | 4698 |
| 341 | Ga0163163_10065180 | 3300014325 | Bacteria | 3615 |
| 342 | Ga0163163_10102986 | 3300014325 | Bacteria | 2879 |
| 343 | Ga0163163_10140275 | 3300014325 | Bacteria | 2459 |
| 344 | Ga0163163_10159870 | 3300014325 | Viruses | 2298 |
| 345 | Ga0163163_10260510 | 3300014325 | Bacteria | 1785 |
| 346 | Ga0157380_10005975 | 3300014326 | Bacteria | 8518 |
| 347 | Ga0157380_10022478 | 3300014326 | Bacteria | 4749 |
| 348 | Ga0157380_10065001 | 3300014326 | Bacteria | 2930 |
| 349 | Ga0157380_10173178 | 3300014326 | Bacteria | 1888 |
| 350 | Ga0157380_10210826 | 3300014326 | Bacteria | 1731 |
| 351 | Ga0157380_10292693 | 3300014326 | Bacteria | 1496 |
| 352 | Ga0157377_10019614 | 3300014745 | Bacteria | 3534 |
| 353 | Ga0157379_10154570 | 3300014968 | Bacteria | 2069 |
| 354 | Ga0157379_10160469 | 3300014968 | Bacteria | 2029 |
| 355 | Ga0157376_10019780 | 3300014969 | Bacteria | 5197 |
| 356 | Ga0157376_10041173 | 3300014969 | Bacteria | 3781 |
| 357 | Ga0163161_10002410 | 3300017792 | Bacteria | 13411 |
| 358 | Ga0163161_10374974 | 3300017792 | Bacteria | 1136 |
| 359 | Ga0213874_10027753 | 3300021377 | Bacteria | 1613 |
| 360 | Ga0213876_10194415 | 3300021384 | Bacteria | 1078 |
| 361 | Ga0207697_10008697 | 3300025315 | Bacteria | 4426 |
| 362 | Ga0207697_10050785 | 3300025315 | Bacteria | 1713 |
| 363 | Ga0207656_10019369 | 3300025321 | Bacteria | 2692 |
| 364 | Ga0207656_10121069 | 3300025321 | Bacteria | 1218 |
| 365 | Ga0207653_10034982 | 3300025885 | Bacteria | 1633 |
| 366 | Ga0207682_10143380 | 3300025893 | Bacteria | 1073 |
| 367 | Ga0207642_10048563 | 3300025899 | Unclassified | 1903 |
| 368 | Ga0207688_10076239 | 3300025901 | Unclassified | 1909 |
| 369 | Ga0207680_10157579 | 3300025903 | Bacteria | 1520 |
| 370 | Ga0207680_10219046 | 3300025903 | Unclassified | 1304 |
| 371 | Ga0207647_10013354 | 3300025904 | Bacteria | 5700 |
| 372 | Ga0207647_10094454 | 3300025904 | Bacteria | 1781 |
| 373 | Ga0207647_10201178 | 3300025904 | Unclassified | 1152 |
| 374 | Ga0207645_10092685 | 3300025907 | Bacteria | 1943 |
| 375 | Ga0207643_10002460 | 3300025908 | Bacteria | 9998 |
| 376 | Ga0207643_10006501 | 3300025908 | Bacteria | 6259 |
| 377 | Ga0207643_10112328 | 3300025908 | Unclassified | 1606 |
| 378 | Ga0207684_10001147 | 3300025910 | Bacteria | 29558 |
| 379 | Ga0207684_10117913 | 3300025910 | Bacteria | 2274 |
| 380 | Ga0207684_10262375 | 3300025910 | Bacteria | 1491 |
| 381 | Ga0207654_10426480 | 3300025911 | Unclassified | 926 |
| 382 | Ga0207654_10428043 | 3300025911 | Unclassified | 925 |
| 383 | Ga0207707_10000218 | 3300025912 | Bacteria | 61709 |
| 384 | Ga0207707_10078212 | 3300025912 | Bacteria | 2888 |
| 385 | Ga0207707_10354492 | 3300025912 | Bacteria | 1264 |
| 386 | Ga0207707_10357579 | 3300025912 | Bacteria | 1258 |
| 387 | Ga0207695_10727064 | 3300025913 | Unclassified | 873 |
| 388 | Ga0207671_10131725 | 3300025914 | Unclassified | 1920 |
| 389 | Ga0207671_10294727 | 3300025914 | Unclassified | 1281 |
| 390 | Ga0207671_10354932 | 3300025914 | Bacteria | 1163 |
| 391 | Ga0207660_10000187 | 3300025917 | Bacteria | 39221 |
| 392 | Ga0207660_10023719 | 3300025917 | Bacteria | 4146 |
| 393 | Ga0207662_10104404 | 3300025918 | Unclassified | 1760 |
| 394 | Ga0207662_10148443 | 3300025918 | Unclassified | 1490 |
| 395 | Ga0207657_10061600 | 3300025919 | Bacteria | 3216 |
| 396 | Ga0207649_10239935 | 3300025920 | Bacteria | 1301 |
| 397 | Ga0207649_10484677 | 3300025920 | Unclassified | 938 |
| 398 | Ga0207652_10000066 | 3300025921 | Bacteria | 110924 |
| 399 | Ga0207652_10117516 | 3300025921 | Bacteria | 2363 |
| 400 | Ga0207646_10005501 | 3300025922 | Bacteria | 13316 |
| 401 | Ga0207646_10267633 | 3300025922 | Bacteria | 1545 |
| 402 | Ga0207646_10315083 | 3300025922 | Bacteria | 1413 |
| 403 | Ga0207681_10039283 | 3300025923 | Bacteria | 3141 |
| 404 | Ga0207694_10001192 | 3300025924 | Bacteria | 22526 |
| 405 | Ga0207650_10000080 | 3300025925 | Bacteria | 129319 |
| 406 | Ga0207650_10149267 | 3300025925 | Unclassified | 1843 |
| 407 | Ga0207650_10311296 | 3300025925 | Unclassified | 1288 |
| 408 | Ga0207650_10446366 | 3300025925 | Unclassified | 1076 |
| 409 | Ga0207659_10010824 | 3300025926 | Bacteria | 5743 |
| 410 | Ga0207659_10547667 | 3300025926 | Bacteria | 983 |
| 411 | Ga0207659_10550915 | 3300025926 | Unclassified | 980 |
| 412 | Ga0207659_10642294 | 3300025926 | Unclassified | 907 |
| 413 | Ga0207687_10088287 | 3300025927 | Bacteria | 2255 |
| 414 | Ga0207687_10172501 | 3300025927 | Unclassified | 1669 |
| 415 | Ga0207644_10089082 | 3300025931 | Bacteria | 2296 |
| 416 | Ga0207644_10127176 | 3300025931 | Bacteria | 1946 |
| 417 | Ga0207644_10232988 | 3300025931 | Unclassified | 1464 |
| 418 | Ga0207690_10008814 | 3300025932 | Bacteria | 5987 |
| 419 | Ga0207690_10343622 | 3300025932 | Bacteria | 1178 |
| 420 | Ga0207706_10053477 | 3300025933 | Bacteria | 3564 |
| 421 | Ga0207706_10154387 | 3300025933 | Bacteria | 2019 |
| 422 | Ga0207706_10533230 | 3300025933 | Bacteria | 1012 |
| 423 | Ga0207706_10699233 | 3300025933 | Unclassified | 866 |
| 424 | Ga0207686_10034042 | 3300025934 | Bacteria | 3046 |
| 425 | Ga0207686_10136941 | 3300025934 | Bacteria | 1687 |
| 426 | Ga0207686_10585323 | 3300025934 | Unclassified | 876 |
| 427 | Ga0207709_10078123 | 3300025935 | Bacteria | 2124 |
| 428 | Ga0207670_10007075 | 3300025936 | Bacteria | 6248 |
| 429 | Ga0207670_10275406 | 3300025936 | Bacteria | 1310 |
| 430 | Ga0207670_10416771 | 3300025936 | Unclassified | 1077 |
| 431 | Ga0207669_10271012 | 3300025937 | Bacteria | 1275 |
| 432 | Ga0207704_10042027 | 3300025938 | Bacteria | 2687 |
| 433 | Ga0207704_10351887 | 3300025938 | Bacteria | 1147 |
| 434 | Ga0207665_10026051 | 3300025939 | Bacteria | 3858 |
| 435 | Ga0207691_10000799 | 3300025940 | Bacteria | 31267 |
| 436 | Ga0207691_10014396 | 3300025940 | Bacteria | 7542 |
| 437 | Ga0207691_10162826 | 3300025940 | Bacteria | 1956 |
| 438 | Ga0207691_10446593 | 3300025940 | Bacteria | 1101 |
| 439 | Ga0207711_10035287 | 3300025941 | Bacteria | 4239 |
| 440 | Ga0207711_10112324 | 3300025941 | Bacteria | 2424 |
| 441 | Ga0207711_10156837 | 3300025941 | Bacteria | 2058 |
| 442 | Ga0207711_10179374 | 3300025941 | Unclassified | 1925 |
| 443 | Ga0207711_10228963 | 3300025941 | Bacteria | 1702 |
| 444 | Ga0207711_10433813 | 3300025941 | Unclassified | 1223 |
| 445 | Ga0207711_10471065 | 3300025941 | Bacteria | 1170 |
| 446 | Ga0207689_10002744 | 3300025942 | Bacteria | 16283 |
| 447 | Ga0207689_10055109 | 3300025942 | Bacteria | 3273 |
| 448 | Ga0207689_10076003 | 3300025942 | Unclassified | 2761 |
| 449 | Ga0207689_10189677 | 3300025942 | Unclassified | 1696 |
| 450 | Ga0207689_10355838 | 3300025942 | Bacteria | 1217 |
| 451 | Ga0207689_10529662 | 3300025942 | Bacteria | 988 |
| 452 | Ga0207661_10365497 | 3300025944 | Bacteria | 1304 |
| 453 | Ga0207661_10480533 | 3300025944 | Bacteria | 1134 |
| 454 | Ga0207679_10017104 | 3300025945 | Bacteria | 4827 |
| 455 | Ga0207679_10569143 | 3300025945 | Unclassified | 1018 |
| 456 | Ga0207667_10656882 | 3300025949 | Bacteria | 1054 |
| 457 | Ga0207651_10068134 | 3300025960 | Unclassified | 2508 |
| 458 | Ga0207712_10059918 | 3300025961 | Bacteria | 2697 |
| 459 | Ga0207712_10396514 | 3300025961 | Bacteria | 1159 |
| 460 | Ga0207712_10425281 | 3300025961 | Unclassified | 1121 |
| 461 | Ga0207640_10076430 | 3300025981 | Bacteria | 2273 |
| 462 | Ga0207658_10434672 | 3300025986 | Bacteria | 1160 |
| 463 | Ga0207658_10534644 | 3300025986 | Unclassified | 1047 |
| 464 | Ga0207703_10054603 | 3300026035 | Bacteria | 3249 |
| 465 | Ga0207703_10092082 | 3300026035 | Unclassified | 2551 |
| 466 | Ga0207703_10299314 | 3300026035 | Bacteria | 1466 |
| 467 | Ga0207639_10011172 | 3300026041 | Bacteria | 6229 |
| 468 | Ga0207639_10035041 | 3300026041 | Bacteria | 3713 |
| 469 | Ga0207639_10308230 | 3300026041 | Bacteria | 1402 |
| 470 | Ga0207639_10661132 | 3300026041 | Unclassified | 967 |
| 471 | Ga0207678_10337436 | 3300026067 | Bacteria | 1298 |
| 472 | Ga0207708_10000063 | 3300026075 | Bacteria | 87390 |
| 473 | Ga0207708_10028774 | 3300026075 | Bacteria | 4208 |
| 474 | Ga0207708_10032604 | 3300026075 | Bacteria | 3956 |
| 475 | Ga0207708_10084519 | 3300026075 | Bacteria | 2440 |
| 476 | Ga0207708_10109619 | 3300026075 | Unclassified | 2142 |
| 477 | Ga0207702_10028364 | 3300026078 | Unclassified | 4653 |
| 478 | Ga0207641_10113870 | 3300026088 | Bacteria | 2402 |
| 479 | Ga0207641_10196431 | 3300026088 | Unclassified | 1857 |
| 480 | Ga0207641_10203454 | 3300026088 | Bacteria | 1827 |
| 481 | Ga0207641_10238755 | 3300026088 | Bacteria | 1692 |
| 482 | Ga0207641_10364571 | 3300026088 | Bacteria | 1380 |
| 483 | Ga0207641_10543687 | 3300026088 | Bacteria | 1132 |
| 484 | Ga0207641_10764265 | 3300026088 | Bacteria | 954 |
| 485 | Ga0207648_10001538 | 3300026089 | Bacteria | 25397 |
| 486 | Ga0207648_10067785 | 3300026089 | Unclassified | 3110 |
| 487 | Ga0207648_10095484 | 3300026089 | Unclassified | 2601 |
| 488 | Ga0207676_10004662 | 3300026095 | Bacteria | 9710 |
| 489 | Ga0207676_10011463 | 3300026095 | Bacteria | 6336 |
| 490 | Ga0207676_10015704 | 3300026095 | Bacteria | 5471 |
| 491 | Ga0207676_10016059 | 3300026095 | Bacteria | 5415 |
| 492 | Ga0207676_10058346 | 3300026095 | Bacteria | 3044 |
| 493 | Ga0207674_10000006 | 3300026116 | Bacteria | 233530 |
| 494 | Ga0207674_10080529 | 3300026116 | Bacteria | 3260 |
| 495 | Ga0207674_10084279 | 3300026116 | Unclassified | 3177 |
| 496 | Ga0207675_100000501 | 3300026118 | Bacteria | 38076 |
| 497 | Ga0207675_100003218 | 3300026118 | Bacteria | 16022 |
| 498 | Ga0207675_100082092 | 3300026118 | Unclassified | 3023 |
| 499 | Ga0207683_10102312 | 3300026121 | Bacteria | 2558 |
| 500 | Ga0207683_10137007 | 3300026121 | Bacteria | 2204 |
| 501 | Ga0207698_10413363 | 3300026142 | Bacteria | 1293 |
| 502 | Ga0207698_10418046 | 3300026142 | Bacteria | 1286 |
| 503 | Ga0207428_10010617 | 3300027907 | Bacteria | 8217 |
| 504 | Ga0268266_10361354 | 3300028379 | Unclassified | 1366 |
| 505 | Ga0268265_10080498 | 3300028380 | Unclassified | 2569 |
| 506 | Ga0268265_10134636 | 3300028380 | Bacteria | 2059 |
| 507 | Ga0268264_10122660 | 3300028381 | Unclassified | 2292 |
| 508 | Ga0268264_10339448 | 3300028381 | Unclassified | 1426 |
| 509 | Ga0268264_10546234 | 3300028381 | Unclassified | 1136 |
| 510 | Ga0316177_1040637 | 3300030731 | Unclassified | 1262 |
| 511 | Ga0314311_1254191 | 3300030733 | Bacteria | 1376 |
| 512 | Ga0316178_1063654 | 3300030735 | Bacteria | 1083 |
| 513 | Ga0307408_100009485 | 3300031548 | Bacteria | 6420 |
| 514 | Ga0307408_100032722 | 3300031548 | Bacteria | 3627 |
| 515 | Ga0307405_10004351 | 3300031731 | Bacteria | 6678 |
| 516 | Ga0307405_10005367 | 3300031731 | Bacteria | 6177 |
| 517 | Ga0307405_10299292 | 3300031731 | Bacteria | 1219 |
| 518 | Ga0307413_10005145 | 3300031824 | Bacteria | 5796 |
| 519 | Ga0307413_10158532 | 3300031824 | Bacteria | 1587 |
| 520 | Ga0307413_10218672 | 3300031824 | Unclassified | 1390 |
| 521 | Ga0307413_10469551 | 3300031824 | Bacteria | 1003 |
| 522 | Ga0307410_10002470 | 3300031852 | Bacteria | 8931 |
| 523 | Ga0307410_10003839 | 3300031852 | Bacteria | 7635 |
| 524 | Ga0307406_10002113 | 3300031901 | Bacteria | 10829 |
| 525 | Ga0307406_10053788 | 3300031901 | Unclassified | 2566 |
| 526 | Ga0307406_10084572 | 3300031901 | Unclassified | 2119 |
| 527 | Ga0307407_10005587 | 3300031903 | Bacteria | 5476 |
| 528 | Ga0307412_10067549 | 3300031911 | Bacteria | 2428 |
| 529 | Ga0307412_10081748 | 3300031911 | Bacteria | 2235 |
| 530 | Ga0307409_100031388 | 3300031995 | Bacteria | 3833 |
| 531 | Ga0307409_100125203 | 3300031995 | Bacteria | 2184 |
| 532 | Ga0307409_100224755 | 3300031995 | Unclassified | 1697 |
| 533 | Ga0307416_100006215 | 3300032002 | Bacteria | 7452 |
| 534 | Ga0307416_100504812 | 3300032002 | Bacteria | 1274 |
| 535 | Ga0307416_101406540 | 3300032002 | Unclassified | 803 |
| 536 | Ga0307414_10002955 | 3300032004 | Bacteria | 8989 |
| 537 | Ga0307414_10467108 | 3300032004 | Bacteria | 1110 |
| 538 | Ga0307411_10006755 | 3300032005 | Bacteria | 5771 |
| 539 | Ga0307411_10017459 | 3300032005 | Bacteria | 4090 |
| 540 | Ga0307411_10121888 | 3300032005 | Unclassified | 1888 |
| 541 | Ga0307411_10229831 | 3300032005 | Bacteria | 1445 |
| 542 | Ga0307415_100002220 | 3300032126 | Bacteria | 9618 |
| 543 | Ga0307415_100006058 | 3300032126 | Bacteria | 6482 |
| 544 | Ga0307415_100105930 | 3300032126 | Bacteria | 2075 |
| 545 | Ga0307415_100178264 | 3300032126 | Bacteria | 1664 |
| 546 | Ga0307415_100274873 | 3300032126 | Bacteria | 1382 |
| 547 | Ga0307415_100336225 | 3300032126 | Unclassified | 1266 |
| 548 | Ga0373951_0004278 | 3300035091 | Bacteria | 3398 |
| 549 | Ga0373951_0052567 | 3300035091 | Bacteria | 1005 |
| 550 | Ga0373932_0113519 | 3300035112 | Bacteria | 896 |
| 551 | Ga0373939_0126810 | 3300035114 | Bacteria | 907 |
| 552 | Ga0373941_0007615 | 3300035115 | Unclassified | 2656 |
| 553 | Ga0373942_0009262 | 3300035207 | Unclassified | 2302 |
| 554 | Ga0316574_0103295 | 3300035398 | Bacteria | 1825 |
| 555 | Ga0373931_0060245 | 3300035691 | Unclassified | 2043 |
| 556 | Ga0373931_0254590 | 3300035691 | Bacteria | 1069 |
| 557 | Ga0395900_0431457 | 3300037418 | Bacteria | 1277 |
| 558 | Ga0395900_0609835 | 3300037418 | Unclassified | 1031 |
| 559 | Ga0395898_0039410 | 3300037466 | Bacteria | 4677 |
| 560 | Ga0395898_0225095 | 3300037466 | Bacteria | 1789 |
| 561 | Ga0395901_0235451 | 3300038443 | Unclassified | 1911 |
| 562 | Ga0395901_0683056 | 3300038443 | Unclassified | 1026 |
| 563 | Ga0242422_00667 | 3300038699 | Bacteria | 2253 |
| 564 | Ga0242420_000317 | 3300038996 | Bacteria | 5345 |
| 565 | Ga0242420_005396 | 3300038996 | Bacteria | 1980 |
| 566 | Ga0436365_0890990 | 3300039437 | Bacteria | 4375 |
| 567 | Ga0436363_1034008 | 3300039450 | Unclassified | 2821 |
| 568 | Ga0450889_006898 | 3300042144 | Unclassified | 1143 |
| 569 | Ga0439458_0001522 | 3300042157 | Bacteria | 5811 |
| 570 | Ga0439459_0030612 | 3300042438 | Bacteria | 1093 |
| 571 | Ga0451577_0569956 | 3300042876 | Unclassified | 1028 |
| 572 | Ga0453684_0092780 | 3300044712 | Bacteria | 3721 |
| 573 | Ga0451576_0224260 | 3300045051 | Bacteria | 1963 |
| 574 | Ga0451576_0559973 | 3300045051 | Unclassified | 1201 |
| 575 | Ga0495582_0147789 | 3300046473 | Bacteria | 1334 |
| 576 | Ga0495636_0008281 | 3300047318 | Bacteria | 4105 |
| 577 | Ga0495674_0464987 | 3300047319 | Bacteria | 1015 |
| 578 | Ga0496100_0270638 | 3300048903 | Bacteria | 1263 |
| 579 | Ga0496102_0016276 | 3300048905 | Bacteria | 6498 |
| 580 | Ga0496104_0900403 | 3300048907 | Bacteria | 790 |
| 581 | Ga0496106_0125739 | 3300048909 | Bacteria | 2007 |
| 582 | Ga0496107_0657154 | 3300048910 | Unclassified | 773 |
| 583 | Ga0496108_0075737 | 3300048911 | Bacteria | 2844 |
| 584 | Ga0496108_0299101 | 3300048911 | Unclassified | 1402 |
| 585 | Ga0496109_0716470 | 3300048912 | Unclassified | 938 |
| 586 | Ga0496109_1217082 | 3300048912 | Bacteria | 690 |
| 587 | Ga0496110_0143785 | 3300048913 | Unclassified | 2157 |
| 588 | Ga0496112_0094154 | 3300048915 | Bacteria | 2966 |
| 589 | Ga0496112_0132173 | 3300048915 | Bacteria | 2467 |
| 590 | Ga0496112_0544591 | 3300048915 | Unclassified | 1095 |
| 591 | Ga0496112_0611957 | 3300048915 | Unclassified | 1021 |
| 592 | Ga0501305_042354 | 3300049161 | Unclassified | 744 |
| 593 | Ga0501291_001939 | 3300049514 | Bacteria | 2432 |
| 594 | Ga0501291_005889 | 3300049514 | Bacteria | 1618 |
| 595 | Ga0501292_004055 | 3300049515 | Bacteria | 1984 |
| 596 | Ga0501296_000949 | 3300049519 | Bacteria | 2865 |
| 597 | Ga0501298_002082 | 3300049521 | Bacteria | 3000 |
| 598 | Ga0501299_010270 | 3300049522 | Bacteria | 1561 |
| 599 | Ga0501299_013639 | 3300049522 | Bacteria | 1404 |
| 600 | Ga0501299_044589 | 3300049522 | Unclassified | 900 |
| 601 | Ga0501300_005448 | 3300049523 | Unclassified | 1874 |
| 602 | Ga0501313_024650 | 3300049529 | Bacteria | 758 |
| 603 | Ga0501314_015699 | 3300049530 | Bacteria | 750 |
| 604 | Ga0501315_023532 | 3300049531 | Bacteria | 847 |
| 605 | Ga0501316_012545 | 3300049532 | Bacteria | 992 |
| 606 | Ga0501034_0002080 | 3300049571 | Bacteria | 24992 |
| 607 | Ga0501038_0001586 | 3300049574 | Bacteria | 21094 |
| 608 | Ga0501040_0205008 | 3300049576 | Unclassified | 1401 |
| 609 | Ga0501046_0526786 | 3300049580 | Unclassified | 844 |
| 610 | Ga0501048_0246107 | 3300049582 | Unclassified | 1269 |
| 611 | Ga0501198_019415 | 3300049649 | Bacteria | 1071 |
| 612 | Ga0501202_000976 | 3300049652 | Bacteria | 4418 |
| 613 | Ga0501207_008961 | 3300049654 | Bacteria | 1454 |
| 614 | Ga0501209_068015 | 3300049656 | Bacteria | 1008 |
| 615 | Ga0501216_000773 | 3300049660 | Bacteria | 3999 |
| 616 | Ga0501216_016496 | 3300049660 | Bacteria | 1254 |
| 617 | Ga0501217_013221 | 3300049661 | Unclassified | 1850 |
| 618 | Ga0501217_078309 | 3300049661 | Bacteria | 911 |
| 619 | Ga0501223_006766 | 3300049663 | Bacteria | 2360 |
| 620 | Ga0501224_014204 | 3300049664 | Bacteria | 1176 |
| 621 | Ga0501227_011076 | 3300049665 | Bacteria | 1961 |
| 622 | Ga0501227_080182 | 3300049665 | Bacteria | 855 |
| 623 | Ga0501230_003640 | 3300049667 | Bacteria | 2063 |
| 624 | Ga0501230_021474 | 3300049667 | Bacteria | 1132 |
| 625 | Ga0501233_008690 | 3300049668 | Bacteria | 1963 |
| 626 | Ga0501233_016313 | 3300049668 | Bacteria | 1539 |
| 627 | Ga0501235_002211 | 3300049669 | Bacteria | 4183 |
| 628 | Ga0501235_009095 | 3300049669 | Bacteria | 2170 |
| 629 | Ga0501240_005879 | 3300049673 | Unclassified | 1487 |
| 630 | Ga0501243_027894 | 3300049675 | Bacteria | 954 |
| 631 | Ga0501249_002680 | 3300049679 | Bacteria | 3587 |
| 632 | Ga0501249_014170 | 3300049679 | Unclassified | 1697 |
| 633 | Ga0501249_043140 | 3300049679 | Bacteria | 1026 |
| 634 | Ga0501251_011494 | 3300049681 | Bacteria | 1056 |
| 635 | Ga0501256_002409 | 3300049685 | Bacteria | 1483 |
| 636 | Ga0501257_009134 | 3300049686 | Bacteria | 2234 |
| 637 | Ga0501257_012597 | 3300049686 | Bacteria | 1936 |
| 638 | Ga0501257_089087 | 3300049686 | Bacteria | 801 |
| 639 | Ga0501257_103964 | 3300049686 | Unclassified | 748 |
| 640 | Ga0501260_001045 | 3300049689 | Bacteria | 2238 |
| 641 | Ga0501261_004189 | 3300049690 | Unclassified | 1776 |
| 642 | Ga0501221_032077 | 3300049704 | Bacteria | 1102 |
| 643 | Ga0501225_0001616 | 3300049705 | Bacteria | 7047 |
| 644 | Ga0501225_0007450 | 3300049705 | Bacteria | 3169 |
| 645 | Ga0501225_0028900 | 3300049705 | Bacteria | 1523 |
| 646 | Ga0501229_010667 | 3300049706 | Bacteria | 1162 |
| 647 | Ga0501234_001279 | 3300049707 | Bacteria | 3947 |
| 648 | Ga0501234_002098 | 3300049707 | Bacteria | 3153 |
| 649 | Ga0501245_006095 | 3300049708 | Bacteria | 1680 |
| 650 | Ga0501245_012644 | 3300049708 | Unclassified | 1241 |
| 651 | Ga0501241_043600 | 3300049758 | Bacteria | 874 |
| 652 | Ga0501266_001817 | 3300049763 | Bacteria | 2697 |
| 653 | Ga0501267_002264 | 3300049764 | Bacteria | 1715 |
| 654 | Ga0501268_000456 | 3300049765 | Unclassified | 4434 |
| 655 | Ga0501268_028761 | 3300049765 | Bacteria | 995 |
| 656 | Ga0501270_001395 | 3300049767 | Bacteria | 2301 |
| 657 | Ga0501270_008103 | 3300049767 | Unclassified | 1320 |
| 658 | Ga0501272_012257 | 3300049769 | Bacteria | 973 |
| 659 | Ga0501283_000664 | 3300049779 | Bacteria | 4541 |
| 660 | Ga0501283_027079 | 3300049779 | Unclassified | 946 |
| 661 | Ga0501212_001224 | 3300049851 | Bacteria | 2851 |
| 662 | nmdc:mga05p37_121528_c1 | 3300050507 | Bacteria | 3208 |
| 663 | nmdc:mga05p37_38866_c1 | 3300050507 | Bacteria | 5838 |
| 664 | nmdc:mga05p37_43020_c1 | 3300050507 | Bacteria | 5553 |
| 665 | nmdc:mga05p37_503697_c1 | 3300050507 | Bacteria | 1389 |
| 666 | nmdc:mga05p37_51198_c1 | 3300050507 | Bacteria | 5079 |
| 667 | nmdc:mga05p37_84625_c1 | 3300050507 | Bacteria | 3907 |
| 668 | nmdc:mga09592_296931_c1 | 3300050508 | Bacteria | 1401 |
| 669 | nmdc:mga09592_519751_c1 | 3300050508 | Bacteria | 1024 |
| 670 | nmdc:mga09592_583238_c1 | 3300050508 | Bacteria | 959 |
| 671 | nmdc:mga09592_65435_c1 | 3300050508 | Unclassified | 3080 |
| 672 | nmdc:mga0qj67_11815_c2 | 3300050509 | Unclassified | 3712 |
| 673 | nmdc:mga0qj67_60787_c1 | 3300050509 | Unclassified | 2999 |
| 674 | nmdc:mga06r32_203218_c1 | 3300050510 | Bacteria | 1969 |
| 675 | nmdc:mga06r32_592771_c1 | 3300050510 | Bacteria | 1080 |
| 676 | nmdc:mga08y16_150452_c1 | 3300050511 | Bacteria | 2420 |
| 677 | nmdc:mga08y16_306372_c1 | 3300050511 | Unclassified | 1636 |
| 678 | nmdc:mga08y16_310467_c1 | 3300050511 | Bacteria | 1624 |
| 679 | nmdc:mga08y16_5441_c1 | 3300050511 | Bacteria | 13314 |
| 680 | nmdc:mga0n895_24520_c1 | 3300050512 | Bacteria | 5685 |
| 681 | nmdc:mga0n895_36400_c1 | 3300050512 | Bacteria | 4752 |
| 682 | nmdc:mga0n895_427374_c1 | 3300050512 | Unclassified | 1339 |
| 683 | nmdc:mga0n895_433167_c1 | 3300050512 | Bacteria | 1329 |
| 684 | nmdc:mga0n895_83662_c1 | 3300050512 | Bacteria | 3183 |
| 685 | nmdc:mga0rr50_534062_c1 | 3300050513 | Bacteria | 998 |
| 686 | nmdc:mga08x19_12_c1 | 3300050514 | Bacteria | 395395 |
| 687 | nmdc:mga08x19_3296_c1 | 3300050514 | Bacteria | 9649 |
| 688 | nmdc:mga0a205_158723_c1 | 3300050515 | Unclassified | 2159 |
| 689 | nmdc:mga0a205_25329_c1 | 3300050515 | Bacteria | 5651 |
| 690 | nmdc:mga0a205_273989_c1 | 3300050515 | Bacteria | 1564 |
| 691 | nmdc:mga0a205_41701_c1 | 3300050515 | Bacteria | 4421 |
| 692 | nmdc:mga0a205_677184_c1 | 3300050515 | Unclassified | 882 |
| 693 | nmdc:mga0a205_96085_c1 | 3300050515 | Bacteria | 2862 |
| 694 | nmdc:mga0a205_9932_c1 | 3300050515 | Bacteria | 8730 |
| 695 | Ga0500577_0018049 | 3300053142 | Bacteria | 2260 |
| 696 | Ga0500616_0006873 | 3300053153 | Bacteria | 7344 |
| 697 | Ga0587111_0017192 | 3300060346 | Bacteria | 1345 |
| 698 | Ga0530510_0029243 | 3300061734 | Bacteria | 3954 |
| 699 | 8054281465 | 8054280661 | Bacteria | 4232245 |
| 700 | 8057635186 | 8057632132 | Bacteria | 4726859 |
| 701 | Ga0157372_10484272 | |||
| 702 | SwRhRL2b_contig_3777873 | |||
| 703 | CNBas_1000630 | |||
| 704 | CNAas_1001018 | |||
| 705 | JGI24751J29686_10000018 | |||
| 706 | Ga0065714_10064448 | |||
| 707 | Ga0065704_10009998 | |||
| 708 | Ga0065712_10000125 | |||
| 709 | Ga0065712_10083355 | |||
| 710 | Ga0065712_10199224 | |||
| 711 | Ga0065715_10003822 | |||
| 712 | Ga0065715_10016236 | |||
| 713 | Ga0065715_10021447 | |||
| 714 | Ga0065715_10098956 | |||
| 715 | Ga0065707_10001187 | |||
| 716 | Ga0065707_10140670 | |||
| 717 | Ga0065707_10358074 | |||
| 718 | Ga0070676_10134340 | |||
| 719 | Ga0070683_100069237 | |||
| 720 | Ga0070683_100601505 | |||
| 721 | Ga0070690_100032281 | |||
| 722 | Ga0070690_100081917 | |||
| 723 | Ga0070670_100000829 | |||
| 724 | Ga0070670_100078512 | |||
| 725 | Ga0070670_100156644 | |||
| 726 | Ga0070670_100525291 | |||
| 727 | Ga0068869_100017538 | |||
| 728 | Ga0068869_100184416 | |||
| 729 | Ga0070666_10121126 | |||
| 730 | Ga0070666_10166517 | |||
| 731 | Ga0070680_100000085 | |||
| 732 | Ga0070680_100032083 | |||
| 733 | Ga0068868_100057339 | |||
| 734 | Ga0070660_100040665 | |||
| 735 | Ga0070689_100003820 | |||
| 736 | Ga0070689_100058255 | |||
| 737 | Ga0070689_100147204 | |||
| 738 | Ga0070689_100216524 | |||
| 739 | Ga0070687_100014360 | |||
| 740 | Ga0070687_100040477 | |||
| 741 | Ga0070687_100082467 | |||
| 742 | Ga0070687_100085885 | |||
| 743 | Ga0070661_100017837 | |||
| 744 | Ga0070692_10104945 | |||
| 745 | Ga0070692_10217331 | |||
| 746 | Ga0070692_10377367 | |||
| 747 | Ga0070668_100331882 | |||
| 748 | Ga0070669_100254018 | |||
| 749 | Ga0070675_100026344 | |||
| 750 | Ga0070675_100248928 | |||
| 751 | Ga0070675_100251998 | |||
| 752 | Ga0070675_100322179 | |||
| 753 | Ga0070671_100009327 | |||
| 754 | Ga0070671_100037974 | |||
| 755 | Ga0070671_100043065 | |||
| 756 | Ga0070671_100162188 | |||
| 757 | Ga0070671_100261601 | |||
| 758 | Ga0070671_100508350 | |||
| 759 | Ga0070674_100021879 | |||
| 760 | Ga0070674_100054459 | |||
| 761 | Ga0070673_100052450 | |||
| 762 | Ga0070673_100073204 | |||
| 763 | Ga0070688_100124050 | |||
| 764 | Ga0070688_100226715 | |||
| 765 | Ga0070659_100005823 | |||
| 766 | Ga0070667_100070252 | |||
| 767 | Ga0070703_10000590 | |||
| 768 | Ga0070703_10030797 | |||
| 769 | Ga0070705_100042791 | |||
| 770 | Ga0070705_100382162 | |||
| 771 | Ga0070705_100399062 | |||
| 772 | Ga0070705_100429035 | |||
| 773 | Ga0070705_100456803 | |||
| 774 | Ga0070700_100000082 | |||
| 775 | Ga0070700_100017779 | |||
| 776 | Ga0070700_100019597 | |||
| 777 | Ga0070700_100034320 | |||
| 778 | Ga0070700_100154118 | |||
| 779 | Ga0070694_100060520 | |||
| 780 | Ga0070694_100116969 | |||
| 781 | Ga0070694_100243747 | |||
| 782 | Ga0070708_100230421 | |||
| 783 | Ga0070708_100296717 | |||
| 784 | Ga0070678_100164102 | |||
| 785 | Ga0070662_100147623 | |||
| 786 | Ga0070662_100283347 | |||
| 787 | Ga0070681_10000189 | |||
| 788 | Ga0070681_10012114 | |||
| 789 | Ga0068867_100120362 | |||
| 790 | Ga0068867_100187719 | |||
| 791 | Ga0068867_100245747 | |||
| 792 | Ga0070685_10028014 | |||
| 793 | Ga0070685_10115757 | |||
| 794 | Ga0070685_10288554 | |||
| 795 | Ga0070685_10296861 | |||
| 796 | Ga0070706_100000032 | |||
| 797 | Ga0070706_100004529 | |||
| 798 | Ga0070706_100166730 | |||
| 799 | Ga0070707_100013173 | |||
| 800 | Ga0070707_100113615 | |||
| 801 | Ga0070707_100242307 | |||
| 802 | Ga0070707_100316552 | |||
| 803 | Ga0070698_100004879 | |||
| 804 | Ga0070698_100013434 | |||
| 805 | Ga0070698_100038837 | |||
| 806 | Ga0070698_100049712 | |||
| 807 | Ga0070698_100234328 | |||
| 808 | Ga0070699_100045130 | |||
| 809 | Ga0070699_100105975 | |||
| 810 | Ga0070679_100000291 | |||
| 811 | Ga0070679_100006719 | |||
| 812 | Ga0070679_100148691 | |||
| 813 | Ga0070684_100027640 | |||
| 814 | Ga0070684_101091455 | |||
| 815 | Ga0070697_100001573 | |||
| 816 | Ga0070697_100159721 | |||
| 817 | Ga0070697_100192256 | |||
| 818 | Ga0070697_100245860 | |||
| 819 | Ga0070697_100278382 | |||
| 820 | Ga0068853_100005183 | |||
| 821 | Ga0068853_100009713 | |||
| 822 | Ga0068853_100060750 | |||
| 823 | Ga0068853_100119878 | |||
| 824 | Ga0068853_100237815 | |||
| 825 | Ga0070672_100024304 | |||
| 826 | Ga0070672_100094758 | |||
| 827 | Ga0070672_100495573 | |||
| 828 | Ga0070686_100015018 | |||
| 829 | Ga0070686_100038719 | |||
| 830 | Ga0070695_100031923 | |||
| 831 | Ga0070695_100059527 | |||
| 832 | Ga0070695_100107786 | |||
| 833 | Ga0070695_100142552 | |||
| 834 | Ga0070695_100321941 | |||
| 835 | Ga0070696_100028550 | |||
| 836 | Ga0070696_100069061 | |||
| 837 | Ga0070696_100235259 | |||
| 838 | Ga0070696_100391221 | |||
| 839 | Ga0070693_100003406 | |||
| 840 | Ga0070693_100011698 | |||
| 841 | Ga0070693_100118400 | |||
| 842 | Ga0070693_100121107 | |||
| 843 | Ga0070693_100455712 | |||
| 844 | Ga0070665_100113442 | |||
| 845 | Ga0070665_100734833 | |||
| 846 | Ga0070704_100020119 | |||
| 847 | Ga0070704_100165969 | |||
| 848 | Ga0070704_100183663 | |||
| 849 | Ga0070704_100504242 | |||
| 850 | Ga0068855_100574693 | |||
| 851 | Ga0068855_100654633 | |||
| 852 | Ga0070664_100000776 | |||
| 853 | Ga0070664_100306620 | |||
| 854 | Ga0070664_100422442 | |||
| 855 | Ga0068857_100016988 | |||
| 856 | Ga0068857_100190695 | |||
| 857 | Ga0068857_100261789 | |||
| 858 | Ga0068857_100342291 | |||
| 859 | Ga0068857_100447314 | |||
| 860 | Ga0068857_100473769 | |||
| 861 | Ga0068857_100620818 | |||
| 862 | Ga0068854_100061560 | |||
| 863 | Ga0068854_100112913 | |||
| 864 | Ga0068854_100195615 | |||
| 865 | Ga0068854_100287133 | |||
| 866 | Ga0070702_100007938 | |||
| 867 | Ga0070702_100056597 | |||
| 868 | Ga0068852_100186401 | |||
| 869 | Ga0068852_100504253 | |||
| 870 | Ga0068859_100005862 | |||
| 871 | Ga0068859_100021877 | |||
| 872 | Ga0068859_100074033 | |||
| 873 | Ga0068859_100297767 | |||
| 874 | Ga0068859_100354765 | |||
| 875 | Ga0068859_100505621 | |||
| 876 | Ga0068859_100656770 | |||
| 877 | Ga0068859_100935724 | |||
| 878 | Ga0068864_100003461 | |||
| 879 | Ga0068864_100010651 | |||
| 880 | Ga0068864_100010804 | |||
| 881 | Ga0068864_100174501 | |||
| 882 | Ga0068864_100233843 | |||
| 883 | Ga0068864_100360925 | |||
| 884 | Ga0068864_100555185 | |||
| 885 | Ga0068864_100657513 | |||
| 886 | Ga0068866_10004396 | |||
| 887 | Ga0068861_100008878 | |||
| 888 | Ga0068861_100054660 | |||
| 889 | Ga0068861_100689171 | |||
| 890 | Ga0068851_10001971 | |||
| 891 | Ga0068870_10077871 | |||
| 892 | Ga0068870_10119978 | |||
| 893 | Ga0068870_10216546 | |||
| 894 | Ga0068863_100044755 | |||
| 895 | Ga0068863_100080761 | |||
| 896 | Ga0068863_100159412 | |||
| 897 | Ga0068863_100244662 | |||
| 898 | Ga0068863_100305117 | |||
| 899 | Ga0068863_100318823 | |||
| 900 | Ga0068863_100541586 | |||
| 901 | Ga0068858_100046446 | |||
| 902 | Ga0068858_100104178 | |||
| 903 | Ga0068858_100571031 | |||
| 904 | Ga0068858_100958367 | |||
| 905 | Ga0068860_100043088 | |||
| 906 | Ga0068860_100066186 | |||
| 907 | Ga0068860_100198591 | |||
| 908 | Ga0068860_100593549 | |||
| 909 | Ga0068860_101101304 | |||
| 910 | Ga0068862_100009515 | |||
| 911 | Ga0068862_100059803 | |||
| 912 | Ga0068862_100073109 | |||
| 913 | Ga0068862_100120417 | |||
| 914 | Ga0068862_100346017 | |||
| 915 | Ga0068862_100867536 | |||
| 916 | Ga0068862_100925176 | |||
| 917 | Ga0081539_10000119 | |||
| 918 | Ga0081539_10038216 | |||
| 919 | Ga0070716_100016082 | |||
| 920 | Ga0075427_10011930 | |||
| 921 | Ga0097621_100007801 | |||
| 922 | Ga0097621_100014964 | |||
| 923 | Ga0097621_100018926 | |||
| 924 | Ga0097621_100204375 | |||
| 925 | Ga0097621_100228828 | |||
| 926 | Ga0068871_100001650 | |||
| 927 | Ga0068871_100077222 | |||
| 928 | Ga0068871_100151077 | |||
| 929 | Ga0068871_100162516 | |||
| 930 | Ga0075428_100157015 | |||
| 931 | Ga0075430_100061664 | |||
| 932 | Ga0075433_10032818 | |||
| 933 | Ga0075433_10065296 | |||
| 934 | Ga0075433_10143130 | |||
| 935 | Ga0075433_10235713 | |||
| 936 | Ga0075433_10363839 | |||
| 937 | Ga0075434_100062273 | |||
| 938 | Ga0075434_100079800 | |||
| 939 | Ga0075434_100242465 | |||
| 940 | Ga0075429_100223441 | |||
| 941 | Ga0075436_100000018 | |||
| 942 | Ga0075436_100034671 | |||
| 943 | Ga0097620_100005862 | |||
| 944 | Ga0097620_100021877 | |||
| 945 | Ga0097620_100074031 | |||
| 946 | Ga0097620_100297753 | |||
| 947 | Ga0097620_100354794 | |||
| 948 | Ga0097620_100505634 | |||
| 949 | Ga0097620_100656761 | |||
| 950 | Ga0097620_100935686 | |||
| 951 | Ga0075435_100039902 | |||
| 952 | Ga0075435_100366134 | |||
| 953 | Ga0105240_10201046 | |||
| 954 | Ga0111539_10002689 | |||
| 955 | Ga0111539_10020653 | |||
| 956 | Ga0111539_10043691 | |||
| 957 | Ga0105245_10085599 | |||
| 958 | Ga0105247_10022348 | |||
| 959 | Ga0114129_10020760 | |||
| 960 | Ga0114129_10043427 | |||
| 961 | Ga0114129_10086482 | |||
| 962 | Ga0114129_10116458 | |||
| 963 | Ga0114129_10138936 | |||
| 964 | Ga0114129_10402979 | |||
| 965 | Ga0114129_10914001 | |||
| 966 | Ga0114129_10966887 | |||
| 967 | Ga0105243_10003475 | |||
| 968 | Ga0105243_10100879 | |||
| 969 | Ga0105243_10521576 | |||
| 970 | Ga0105243_10681621 | |||
| 971 | Ga0105241_10118235 | |||
| 972 | Ga0105241_10207490 | |||
| 973 | Ga0105241_10210235 | |||
| 974 | Ga0105241_10217959 | |||
| 975 | Ga0105241_10245976 | |||
| 976 | Ga0105242_10014594 | |||
| 977 | Ga0105242_10734550 | |||
| 978 | Ga0105248_10006121 | |||
| 979 | Ga0105248_10011370 | |||
| 980 | Ga0105248_10043882 | |||
| 981 | Ga0105248_10100888 | |||
| 982 | Ga0105248_10239829 | |||
| 983 | Ga0105248_10428158 | |||
| 984 | Ga0105248_10474221 | |||
| 985 | Ga0105248_10520859 | |||
| 986 | Ga0105237_10000839 | |||
| 987 | Ga0105237_10012180 | |||
| 988 | Ga0105237_10323035 | |||
| 989 | Ga0105238_10005480 | |||
| 990 | Ga0105238_10024095 | |||
| 991 | Ga0105249_10071983 | |||
| 992 | Ga0105249_10094619 | |||
| 993 | Ga0105249_10403697 | |||
| 994 | Ga0105249_10503952 | |||
| 995 | Ga0105249_10617851 | |||
| 996 | Ga0105249_10960336 | |||
| 997 | Ga0105239_10050773 | |||
| 998 | Ga0105239_10181345 | |||
| 999 | Ga0105239_10412802 | |||
| 1000 | Ga0105239_11544396 | |||
| 1001 | Ga0105246_10019654 | |||
| 1002 | Ga0105246_10095744 | |||
| 1003 | Ga0105246_10117138 | |||
| 1004 | Ga0157373_10013264 | |||
| 1005 | Ga0157373_10016977 | |||
| 1006 | Ga0157373_10026123 | |||
| 1007 | Ga0157373_10343465 | |||
| 1008 | Ga0157373_10369330 | |||
| 1009 | Ga0157373_10409732 | |||
| 1010 | Ga0157374_10011837 | |||
| 1011 | Ga0157378_10008975 | |||
| 1012 | Ga0157378_10086217 | |||
| 1013 | Ga0157378_10150589 | |||
| 1014 | Ga0157378_10300797 | |||
| 1015 | Ga0157378_10627498 | |||
| 1016 | Ga0157378_10758812 | |||
| 1017 | Ga0157378_11106208 | |||
| 1018 | Ga0163162_10001915 | |||
| 1019 | Ga0163162_10003332 | |||
| 1020 | Ga0163162_10013243 | |||
| 1021 | Ga0163162_10126202 | |||
| 1022 | Ga0163162_10143571 | |||
| 1023 | Ga0163162_10175236 | |||
| 1024 | Ga0163162_10419413 | |||
| 1025 | Ga0163162_10513791 | |||
| 1026 | Ga0163162_10613444 | |||
| 1027 | Ga0157372_10174330 | |||
| 1028 | Ga0157372_10393550 | |||
| 1029 | Ga0157372_10650593 | |||
| 1030 | Ga0157375_10021478 | |||
| 1031 | Ga0157375_10205177 | |||
| 1032 | Ga0157375_10378669 | |||
| 1033 | Ga0157375_10451183 | |||
| 1034 | Ga0157375_10606546 | |||
| 1035 | Ga0157375_10623175 | |||
| 1036 | Ga0157375_11325688 | |||
| 1037 | Ga0163163_10000359 | |||
| 1038 | Ga0163163_10035844 | |||
| 1039 | Ga0163163_10037238 | |||
| 1040 | Ga0163163_10037790 | |||
| 1041 | Ga0163163_10065180 | |||
| 1042 | Ga0163163_10102986 | |||
| 1043 | Ga0163163_10140275 | |||
| 1044 | Ga0163163_10159870 | |||
| 1045 | Ga0163163_10260510 | |||
| 1046 | Ga0157380_10005975 | |||
| 1047 | Ga0157380_10022478 | |||
| 1048 | Ga0157380_10065001 | |||
| 1049 | Ga0157380_10173178 | |||
| 1050 | Ga0157380_10210826 | |||
| 1051 | Ga0157380_10292693 | |||
| 1052 | Ga0157377_10019614 | |||
| 1053 | Ga0157379_10154570 | |||
| 1054 | Ga0157379_10160469 | |||
| 1055 | Ga0157376_10019780 | |||
| 1056 | Ga0157376_10041173 | |||
| 1057 | Ga0163161_10002410 | |||
| 1058 | Ga0163161_10374974 | |||
| 1059 | Ga0213874_10027753 | |||
| 1060 | Ga0213876_10194415 | |||
| 1061 | Ga0207697_10008697 | |||
| 1062 | Ga0207697_10050785 | |||
| 1063 | Ga0207656_10019369 | |||
| 1064 | Ga0207656_10121069 | |||
| 1065 | Ga0207653_10034982 | |||
| 1066 | Ga0207682_10143380 | |||
| 1067 | Ga0207642_10048563 | |||
| 1068 | Ga0207688_10076239 | |||
| 1069 | Ga0207680_10157579 | |||
| 1070 | Ga0207680_10219046 | |||
| 1071 | Ga0207647_10013354 | |||
| 1072 | Ga0207647_10094454 | |||
| 1073 | Ga0207647_10201178 | |||
| 1074 | Ga0207645_10092685 | |||
| 1075 | Ga0207643_10002460 | |||
| 1076 | Ga0207643_10006501 | |||
| 1077 | Ga0207643_10112328 | |||
| 1078 | Ga0207684_10001147 | |||
| 1079 | Ga0207684_10117913 | |||
| 1080 | Ga0207684_10262375 | |||
| 1081 | Ga0207654_10426480 | |||
| 1082 | Ga0207654_10428043 | |||
| 1083 | Ga0207707_10000218 | |||
| 1084 | Ga0207707_10078212 | |||
| 1085 | Ga0207707_10354492 | |||
| 1086 | Ga0207707_10357579 | |||
| 1087 | Ga0207695_10727064 | |||
| 1088 | Ga0207671_10131725 | |||
| 1089 | Ga0207671_10294727 | |||
| 1090 | Ga0207671_10354932 | |||
| 1091 | Ga0207660_10000187 | |||
| 1092 | Ga0207660_10023719 | |||
| 1093 | Ga0207662_10104404 | |||
| 1094 | Ga0207662_10148443 | |||
| 1095 | Ga0207657_10061600 | |||
| 1096 | Ga0207649_10239935 | |||
| 1097 | Ga0207649_10484677 | |||
| 1098 | Ga0207652_10000066 | |||
| 1099 | Ga0207652_10117516 | |||
| 1100 | Ga0207646_10005501 | |||
| 1101 | Ga0207646_10267633 | |||
| 1102 | Ga0207646_10315083 | |||
| 1103 | Ga0207681_10039283 | |||
| 1104 | Ga0207694_10001192 | |||
| 1105 | Ga0207650_10000080 | |||
| 1106 | Ga0207650_10149267 | |||
| 1107 | Ga0207650_10311296 | |||
| 1108 | Ga0207650_10446366 | |||
| 1109 | Ga0207659_10010824 | |||
| 1110 | Ga0207659_10547667 | |||
| 1111 | Ga0207659_10550915 | |||
| 1112 | Ga0207659_10642294 | |||
| 1113 | Ga0207687_10088287 | |||
| 1114 | Ga0207687_10172501 | |||
| 1115 | Ga0207644_10089082 | |||
| 1116 | Ga0207644_10127176 | |||
| 1117 | Ga0207644_10232988 | |||
| 1118 | Ga0207690_10008814 | |||
| 1119 | Ga0207690_10343622 | |||
| 1120 | Ga0207706_10053477 | |||
| 1121 | Ga0207706_10154387 | |||
| 1122 | Ga0207706_10533230 | |||
| 1123 | Ga0207706_10699233 | |||
| 1124 | Ga0207686_10034042 | |||
| 1125 | Ga0207686_10136941 | |||
| 1126 | Ga0207686_10585323 | |||
| 1127 | Ga0207709_10078123 | |||
| 1128 | Ga0207670_10007075 | |||
| 1129 | Ga0207670_10275406 | |||
| 1130 | Ga0207670_10416771 | |||
| 1131 | Ga0207669_10271012 | |||
| 1132 | Ga0207704_10042027 | |||
| 1133 | Ga0207704_10351887 | |||
| 1134 | Ga0207665_10026051 | |||
| 1135 | Ga0207691_10000799 | |||
| 1136 | Ga0207691_10014396 | |||
| 1137 | Ga0207691_10162826 | |||
| 1138 | Ga0207691_10446593 | |||
| 1139 | Ga0207711_10035287 | |||
| 1140 | Ga0207711_10112324 | |||
| 1141 | Ga0207711_10156837 | |||
| 1142 | Ga0207711_10179374 | |||
| 1143 | Ga0207711_10228963 | |||
| 1144 | Ga0207711_10433813 | |||
| 1145 | Ga0207711_10471065 | |||
| 1146 | Ga0207689_10002744 | |||
| 1147 | Ga0207689_10055109 | |||
| 1148 | Ga0207689_10076003 | |||
| 1149 | Ga0207689_10189677 | |||
| 1150 | Ga0207689_10355838 | |||
| 1151 | Ga0207689_10529662 | |||
| 1152 | Ga0207661_10365497 | |||
| 1153 | Ga0207661_10480533 | |||
| 1154 | Ga0207679_10017104 | |||
| 1155 | Ga0207679_10569143 | |||
| 1156 | Ga0207667_10656882 | |||
| 1157 | Ga0207651_10068134 | |||
| 1158 | Ga0207712_10059918 | |||
| 1159 | Ga0207712_10396514 | |||
| 1160 | Ga0207712_10425281 | |||
| 1161 | Ga0207640_10076430 | |||
| 1162 | Ga0207658_10434672 | |||
| 1163 | Ga0207658_10534644 | |||
| 1164 | Ga0207703_10054603 | |||
| 1165 | Ga0207703_10092082 | |||
| 1166 | Ga0207703_10299314 | |||
| 1167 | Ga0207639_10011172 | |||
| 1168 | Ga0207639_10035041 | |||
| 1169 | Ga0207639_10308230 | |||
| 1170 | Ga0207639_10661132 | |||
| 1171 | Ga0207678_10337436 | |||
| 1172 | Ga0207708_10000063 | |||
| 1173 | Ga0207708_10028774 | |||
| 1174 | Ga0207708_10032604 | |||
| 1175 | Ga0207708_10084519 | |||
| 1176 | Ga0207708_10109619 | |||
| 1177 | Ga0207702_10028364 | |||
| 1178 | Ga0207641_10113870 | |||
| 1179 | Ga0207641_10196431 | |||
| 1180 | Ga0207641_10203454 | |||
| 1181 | Ga0207641_10238755 | |||
| 1182 | Ga0207641_10364571 | |||
| 1183 | Ga0207641_10543687 | |||
| 1184 | Ga0207641_10764265 | |||
| 1185 | Ga0207648_10001538 | |||
| 1186 | Ga0207648_10067785 | |||
| 1187 | Ga0207648_10095484 | |||
| 1188 | Ga0207676_10004662 | |||
| 1189 | Ga0207676_10011463 | |||
| 1190 | Ga0207676_10015704 | |||
| 1191 | Ga0207676_10016059 | |||
| 1192 | Ga0207676_10058346 | |||
| 1193 | Ga0207674_10000006 | |||
| 1194 | Ga0207674_10080529 | |||
| 1195 | Ga0207674_10084279 | |||
| 1196 | Ga0207675_100000501 | |||
| 1197 | Ga0207675_100003218 | |||
| 1198 | Ga0207675_100082092 | |||
| 1199 | Ga0207683_10102312 | |||
| 1200 | Ga0207683_10137007 | |||
| 1201 | Ga0207698_10413363 | |||
| 1202 | Ga0207698_10418046 | |||
| 1203 | Ga0207428_10010617 | |||
| 1204 | Ga0268266_10361354 | |||
| 1205 | Ga0268265_10080498 | |||
| 1206 | Ga0268265_10134636 | |||
| 1207 | Ga0268264_10122660 | |||
| 1208 | Ga0268264_10339448 | |||
| 1209 | Ga0268264_10546234 | |||
| 1210 | Ga0316177_1040637 | |||
| 1211 | Ga0314311_1254191 | |||
| 1212 | Ga0316178_1063654 | |||
| 1213 | Ga0307408_100009485 | |||
| 1214 | Ga0307408_100032722 | |||
| 1215 | Ga0307405_10004351 | |||
| 1216 | Ga0307405_10005367 | |||
| 1217 | Ga0307405_10299292 | |||
| 1218 | Ga0307413_10005145 | |||
| 1219 | Ga0307413_10158532 | |||
| 1220 | Ga0307413_10218672 | |||
| 1221 | Ga0307413_10469551 | |||
| 1222 | Ga0307410_10002470 | |||
| 1223 | Ga0307410_10003839 | |||
| 1224 | Ga0307406_10002113 | |||
| 1225 | Ga0307406_10053788 | |||
| 1226 | Ga0307406_10084572 | |||
| 1227 | Ga0307407_10005587 | |||
| 1228 | Ga0307412_10067549 | |||
| 1229 | Ga0307412_10081748 | |||
| 1230 | Ga0307409_100031388 | |||
| 1231 | Ga0307409_100125203 | |||
| 1232 | Ga0307409_100224755 | |||
| 1233 | Ga0307416_100006215 | |||
| 1234 | Ga0307416_100504812 | |||
| 1235 | Ga0307416_101406540 | |||
| 1236 | Ga0307414_10002955 | |||
| 1237 | Ga0307414_10467108 | |||
| 1238 | Ga0307411_10006755 | |||
| 1239 | Ga0307411_10017459 | |||
| 1240 | Ga0307411_10121888 | |||
| 1241 | Ga0307411_10229831 | |||
| 1242 | Ga0307415_100002220 | |||
| 1243 | Ga0307415_100006058 | |||
| 1244 | Ga0307415_100105930 | |||
| 1245 | Ga0307415_100178264 | |||
| 1246 | Ga0307415_100274873 | |||
| 1247 | Ga0307415_100336225 | |||
| 1248 | Ga0373951_0004278 | |||
| 1249 | Ga0373951_0052567 | |||
| 1250 | Ga0373932_0113519 | |||
| 1251 | Ga0373939_0126810 | |||
| 1252 | Ga0373941_0007615 | |||
| 1253 | Ga0373942_0009262 | |||
| 1254 | Ga0316574_0103295 | |||
| 1255 | Ga0373931_0060245 | |||
| 1256 | Ga0373931_0254590 | |||
| 1257 | Ga0395900_0431457 | |||
| 1258 | Ga0395900_0609835 | |||
| 1259 | Ga0395898_0039410 | |||
| 1260 | Ga0395898_0225095 | |||
| 1261 | Ga0395901_0235451 | |||
| 1262 | Ga0395901_0683056 | |||
| 1263 | Ga0242422_00667 | |||
| 1264 | Ga0242420_000317 | |||
| 1265 | Ga0242420_005396 | |||
| 1266 | Ga0436365_0890990 | |||
| 1267 | Ga0436363_1034008 | |||
| 1268 | Ga0450889_006898 | |||
| 1269 | Ga0439458_0001522 | |||
| 1270 | Ga0439459_0030612 | |||
| 1271 | Ga0451577_0569956 | |||
| 1272 | Ga0453684_0092780 | |||
| 1273 | Ga0451576_0224260 | |||
| 1274 | Ga0451576_0559973 | |||
| 1275 | Ga0495582_0147789 | |||
| 1276 | Ga0495636_0008281 | |||
| 1277 | Ga0495674_0464987 | |||
| 1278 | Ga0496100_0270638 | |||
| 1279 | Ga0496102_0016276 | |||
| 1280 | Ga0496104_0900403 | |||
| 1281 | Ga0496106_0125739 | |||
| 1282 | Ga0496107_0657154 | |||
| 1283 | Ga0496108_0075737 | |||
| 1284 | Ga0496108_0299101 | |||
| 1285 | Ga0496109_0716470 | |||
| 1286 | Ga0496109_1217082 | |||
| 1287 | Ga0496110_0143785 | |||
| 1288 | Ga0496112_0094154 | |||
| 1289 | Ga0496112_0132173 | |||
| 1290 | Ga0496112_0544591 | |||
| 1291 | Ga0496112_0611957 | |||
| 1292 | Ga0501305_042354 | |||
| 1293 | Ga0501291_001939 | |||
| 1294 | Ga0501291_005889 | |||
| 1295 | Ga0501292_004055 | |||
| 1296 | Ga0501296_000949 | |||
| 1297 | Ga0501298_002082 | |||
| 1298 | Ga0501299_010270 | |||
| 1299 | Ga0501299_013639 | |||
| 1300 | Ga0501299_044589 | |||
| 1301 | Ga0501300_005448 | |||
| 1302 | Ga0501313_024650 | |||
| 1303 | Ga0501314_015699 | |||
| 1304 | Ga0501315_023532 | |||
| 1305 | Ga0501316_012545 | |||
| 1306 | Ga0501034_0002080 | |||
| 1307 | Ga0501038_0001586 | |||
| 1308 | Ga0501040_0205008 | |||
| 1309 | Ga0501046_0526786 | |||
| 1310 | Ga0501048_0246107 | |||
| 1311 | Ga0501198_019415 | |||
| 1312 | Ga0501202_000976 | |||
| 1313 | Ga0501207_008961 | |||
| 1314 | Ga0501209_068015 | |||
| 1315 | Ga0501216_000773 | |||
| 1316 | Ga0501216_016496 | |||
| 1317 | Ga0501217_013221 | |||
| 1318 | Ga0501217_078309 | |||
| 1319 | Ga0501223_006766 | |||
| 1320 | Ga0501224_014204 | |||
| 1321 | Ga0501227_011076 | |||
| 1322 | Ga0501227_080182 | |||
| 1323 | Ga0501230_003640 | |||
| 1324 | Ga0501230_021474 | |||
| 1325 | Ga0501233_008690 | |||
| 1326 | Ga0501233_016313 | |||
| 1327 | Ga0501235_002211 | |||
| 1328 | Ga0501235_009095 | |||
| 1329 | Ga0501240_005879 | |||
| 1330 | Ga0501243_027894 | |||
| 1331 | Ga0501249_002680 | |||
| 1332 | Ga0501249_014170 | |||
| 1333 | Ga0501249_043140 | |||
| 1334 | Ga0501251_011494 | |||
| 1335 | Ga0501256_002409 | |||
| 1336 | Ga0501257_009134 | |||
| 1337 | Ga0501257_012597 | |||
| 1338 | Ga0501257_089087 | |||
| 1339 | Ga0501257_103964 | |||
| 1340 | Ga0501260_001045 | |||
| 1341 | Ga0501261_004189 | |||
| 1342 | Ga0501221_032077 | |||
| 1343 | Ga0501225_0001616 | |||
| 1344 | Ga0501225_0007450 | |||
| 1345 | Ga0501225_0028900 | |||
| 1346 | Ga0501229_010667 | |||
| 1347 | Ga0501234_001279 | |||
| 1348 | Ga0501234_002098 | |||
| 1349 | Ga0501245_006095 | |||
| 1350 | Ga0501245_012644 | |||
| 1351 | Ga0501241_043600 | |||
| 1352 | Ga0501266_001817 | |||
| 1353 | Ga0501267_002264 | |||
| 1354 | Ga0501268_000456 | |||
| 1355 | Ga0501268_028761 | |||
| 1356 | Ga0501270_001395 | |||
| 1357 | Ga0501270_008103 | |||
| 1358 | Ga0501272_012257 | |||
| 1359 | Ga0501283_000664 | |||
| 1360 | Ga0501283_027079 | |||
| 1361 | Ga0501212_001224 | |||
| 1362 | nmdc:mga05p37_121528_c1 | |||
| 1363 | nmdc:mga05p37_38866_c1 | |||
| 1364 | nmdc:mga05p37_43020_c1 | |||
| 1365 | nmdc:mga05p37_503697_c1 | |||
| 1366 | nmdc:mga05p37_51198_c1 | |||
| 1367 | nmdc:mga05p37_84625_c1 | |||
| 1368 | nmdc:mga09592_296931_c1 | |||
| 1369 | nmdc:mga09592_519751_c1 | |||
| 1370 | nmdc:mga09592_583238_c1 | |||
| 1371 | nmdc:mga09592_65435_c1 | |||
| 1372 | nmdc:mga0qj67_11815_c2 | |||
| 1373 | nmdc:mga0qj67_60787_c1 | |||
| 1374 | nmdc:mga06r32_203218_c1 | |||
| 1375 | nmdc:mga06r32_592771_c1 | |||
| 1376 | nmdc:mga08y16_150452_c1 | |||
| 1377 | nmdc:mga08y16_306372_c1 | |||
| 1378 | nmdc:mga08y16_310467_c1 | |||
| 1379 | nmdc:mga08y16_5441_c1 | |||
| 1380 | nmdc:mga0n895_24520_c1 | |||
| 1381 | nmdc:mga0n895_36400_c1 | |||
| 1382 | nmdc:mga0n895_427374_c1 | |||
| 1383 | nmdc:mga0n895_433167_c1 | |||
| 1384 | nmdc:mga0n895_83662_c1 | |||
| 1385 | nmdc:mga0rr50_534062_c1 | |||
| 1386 | nmdc:mga08x19_12_c1 | |||
| 1387 | nmdc:mga08x19_3296_c1 | |||
| 1388 | nmdc:mga0a205_158723_c1 | |||
| 1389 | nmdc:mga0a205_25329_c1 | |||
| 1390 | nmdc:mga0a205_273989_c1 | |||
| 1391 | nmdc:mga0a205_41701_c1 | |||
| 1392 | nmdc:mga0a205_677184_c1 | |||
| 1393 | nmdc:mga0a205_96085_c1 | |||
| 1394 | nmdc:mga0a205_9932_c1 | |||
| 1395 | Ga0500577_0018049 | |||
| 1396 | Ga0500616_0006873 | |||
| 1397 | Ga0587111_0017192 | |||
| 1398 | Ga0530510_0029243 | |||
| 1399 | 8054281465 | |||
| 1400 | 8057635186 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.9024 | 5 | 219 |
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.8754 | 5 | 219 |
| 3ege-assembly1.cif.gz_A | crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution | 0.84 | 26 | 205 |
| 3dh0-assembly1.cif.gz_A | crystal structure of a sam dependent methyltransferase from aquifex aeolicus | 0.8204 | 28 | 218 |
| 3ofk-assembly2.cif.gz_B | crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9 in complex with s-adenosyl-l-homocysteine (sah) | 0.8055 | 23 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFR3_19_228_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9639 | 6 | 220 | 3.40.50.150 |
| af_P9WFR3_19_228_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9505 | 6 | 220 | 3.40.50.150 |
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9434 | 5 | 219 | 3.40.50.150 |
| af_A4IC78_24_256_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9299 | 5 | 219 | 3.40.50.150 |
| af_Q9VYF8_68_301_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9292 | 5 | 219 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I9YGS2-F1-model_v4 | Demethylmenaquinone methyltransferase (EC 2.1.1.163) | 0.9616 | 1 | 220 |
GO:0009234
GO:0032259 GO:0043770 |
| AF-A0A1X6X8D4-F1-model_v4 | Demethylmenaquinone methyltransferase (EC 2.1.1.163) | 0.9599 | 2 | 220 |
GO:0009234
GO:0032259 GO:0043770 |
| AF-A0A7V5FHF0-F1-model_v4 | Demethylmenaquinone methyltransferase (EC 2.1.1.163) | 0.9593 | 1 | 220 |
GO:0009234
GO:0032259 GO:0043770 |
| AF-A0A832CZD7-F1-model_v4 | Demethylmenaquinone methyltransferase (EC 2.1.1.163) | 0.9586 | 2 | 221 |
GO:0009234
GO:0032259 GO:0043770 |
| AF-A0A183AS31-F1-model_v4 | 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) | 0.9576 | 91 | 220 |
GO:0008425
GO:0031314 GO:0032259 |