F476089

General Info

Members Datasets Scaffolds Average Seq Length
700 285 1400 234

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10484272|Ga0157372_104842721
Length 265
Sequence VITNCSQGFCNQTSIGFGLTVPKNGSAAKEHAGRVREMFGRIARRYDLLNHVLSGNVDKRWRRIVATRIREKLXXXLSANTEARVLDVACGTGDLSLALFEITGAGVVGTDFCRPMLAIAAGKTSGRIRLIEGDALDLPFRDGTFDVATIAFGLRNLSNVESGLAELSRVLKPGGWVAVLEFSRPANAILRPMFNLYFRKLLPMMGGLISGSLSAYTYLPASVQKFPDQSQLSLLMEQAGFDQVGYENLTGGIAALHMGKKAGMS

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
176 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
177 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
201 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
205 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
206 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
224 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
225 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
226 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
227 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
228 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
229 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
239 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
240 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
241 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
242 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
243 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
244 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
245 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
246 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
247 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
248 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
251 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
252 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
253 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
254 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
255 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
256 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
257 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
258 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
261 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
262 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
263 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
264 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
265 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
266 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
267 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
268 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
269 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
270 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
276 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
285 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.86
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 2
Rhizosphere 97.14
Stem 0
Stem Tuber 0
Unclassified 25.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10484272 3300013307 Unclassified 1442
2 SwRhRL2b_contig_3777873 2162886007 Bacteria 1122
3 CNBas_1000630 3300000531 Unclassified 1618
4 CNAas_1001018 3300000532 Unclassified 2586
5 JGI24751J29686_10000018 3300002459 Bacteria 107255
6 Ga0065714_10064448 3300005288 Bacteria 81247
7 Ga0065704_10009998 3300005289 Bacteria 2322
8 Ga0065712_10000125 3300005290 Bacteria 81248
9 Ga0065712_10083355 3300005290 Bacteria 2817
10 Ga0065712_10199224 3300005290 Unclassified 1115
11 Ga0065715_10003822 3300005293 Bacteria 3818
12 Ga0065715_10016236 3300005293 Bacteria 1876
13 Ga0065715_10021447 3300005293 Unclassified 1516
14 Ga0065715_10098956 3300005293 Bacteria 3477
15 Ga0065707_10001187 3300005295 Bacteria 9530
16 Ga0065707_10140670 3300005295 Bacteria 1777
17 Ga0065707_10358074 3300005295 Unclassified 908
18 Ga0070676_10134340 3300005328 Bacteria 1568
19 Ga0070683_100069237 3300005329 Bacteria 3289
20 Ga0070683_100601505 3300005329 Bacteria 1052
21 Ga0070690_100032281 3300005330 Bacteria 3269
22 Ga0070690_100081917 3300005330 Bacteria 2112
23 Ga0070670_100000829 3300005331 Bacteria 24166
24 Ga0070670_100078512 3300005331 Bacteria 2836
25 Ga0070670_100156644 3300005331 Bacteria 1973
26 Ga0070670_100525291 3300005331 Bacteria 1054
27 Ga0068869_100017538 3300005334 Bacteria 4854
28 Ga0068869_100184416 3300005334 Bacteria 1637
29 Ga0070666_10121126 3300005335 Unclassified 1814
30 Ga0070666_10166517 3300005335 Unclassified 1542
31 Ga0070680_100000085 3300005336 Bacteria 51915
32 Ga0070680_100032083 3300005336 Bacteria 4226
33 Ga0068868_100057339 3300005338 Bacteria 3077
34 Ga0070660_100040665 3300005339 Bacteria 3540
35 Ga0070689_100003820 3300005340 Bacteria 10089
36 Ga0070689_100058255 3300005340 Bacteria 3000
37 Ga0070689_100147204 3300005340 Bacteria 1898
38 Ga0070689_100216524 3300005340 Unclassified 1569
39 Ga0070687_100014360 3300005343 Bacteria 3557
40 Ga0070687_100040477 3300005343 Bacteria 2348
41 Ga0070687_100082467 3300005343 Unclassified 1758
42 Ga0070687_100085885 3300005343 Bacteria 1728
43 Ga0070661_100017837 3300005344 Bacteria 5038
44 Ga0070692_10104945 3300005345 Unclassified 1554
45 Ga0070692_10217331 3300005345 Bacteria 1128
46 Ga0070692_10377367 3300005345 Unclassified 888
47 Ga0070668_100331882 3300005347 Unclassified 1283
48 Ga0070669_100254018 3300005353 Unclassified 1400
49 Ga0070675_100026344 3300005354 Unclassified 4666
50 Ga0070675_100248928 3300005354 Bacteria 1555
51 Ga0070675_100251998 3300005354 Bacteria 1545
52 Ga0070675_100322179 3300005354 Bacteria 1365
53 Ga0070671_100009327 3300005355 Bacteria 7881
54 Ga0070671_100037974 3300005355 Bacteria 3996
55 Ga0070671_100043065 3300005355 Bacteria 3753
56 Ga0070671_100162188 3300005355 Bacteria 1890
57 Ga0070671_100261601 3300005355 Bacteria 1471
58 Ga0070671_100508350 3300005355 Unclassified 1037
59 Ga0070674_100021879 3300005356 Bacteria 4115
60 Ga0070674_100054459 3300005356 Bacteria 2767
61 Ga0070673_100052450 3300005364 Bacteria 3200
62 Ga0070673_100073204 3300005364 Bacteria 2757
63 Ga0070688_100124050 3300005365 Unclassified 1734
64 Ga0070688_100226715 3300005365 Bacteria 1320
65 Ga0070659_100005823 3300005366 Bacteria 8879
66 Ga0070667_100070252 3300005367 Bacteria 2980
67 Ga0070703_10000590 3300005406 Bacteria 13107
68 Ga0070703_10030797 3300005406 Bacteria 1619
69 Ga0070705_100042791 3300005440 Bacteria 2591
70 Ga0070705_100382162 3300005440 Unclassified 1037
71 Ga0070705_100399062 3300005440 Unclassified 1018
72 Ga0070705_100429035 3300005440 Bacteria 986
73 Ga0070705_100456803 3300005440 Bacteria 959
74 Ga0070700_100000082 3300005441 Bacteria 63662
75 Ga0070700_100017779 3300005441 Unclassified 4073
76 Ga0070700_100019597 3300005441 Bacteria 3907
77 Ga0070700_100034320 3300005441 Bacteria 3063
78 Ga0070700_100154118 3300005441 Unclassified 1574
79 Ga0070694_100060520 3300005444 Bacteria 2583
80 Ga0070694_100116969 3300005444 Bacteria 1908
81 Ga0070694_100243747 3300005444 Bacteria 1357
82 Ga0070708_100230421 3300005445 Bacteria 1738
83 Ga0070708_100296717 3300005445 Bacteria 1522
84 Ga0070678_100164102 3300005456 Bacteria 1803
85 Ga0070662_100147623 3300005457 Unclassified 1828
86 Ga0070662_100283347 3300005457 Bacteria 1342
87 Ga0070681_10000189 3300005458 Bacteria 47802
88 Ga0070681_10012114 3300005458 Bacteria 8552
89 Ga0068867_100120362 3300005459 Unclassified 2028
90 Ga0068867_100187719 3300005459 Unclassified 1648
91 Ga0068867_100245747 3300005459 Bacteria 1453
92 Ga0070685_10028014 3300005466 Unclassified 3118
93 Ga0070685_10115757 3300005466 Unclassified 1658
94 Ga0070685_10288554 3300005466 Bacteria 1101
95 Ga0070685_10296861 3300005466 Unclassified 1088
96 Ga0070706_100000032 3300005467 Bacteria 152892
97 Ga0070706_100004529 3300005467 Bacteria 13381
98 Ga0070706_100166730 3300005467 Unclassified 2057
99 Ga0070707_100013173 3300005468 Bacteria 7730
100 Ga0070707_100113615 3300005468 Bacteria 2628
101 Ga0070707_100242307 3300005468 Bacteria 1755
102 Ga0070707_100316552 3300005468 Bacteria 1516
103 Ga0070698_100004879 3300005471 Bacteria 14718
104 Ga0070698_100013434 3300005471 Bacteria 8667
105 Ga0070698_100038837 3300005471 Bacteria 4905
106 Ga0070698_100049712 3300005471 Unclassified 4278
107 Ga0070698_100234328 3300005471 Bacteria 1769
108 Ga0070699_100045130 3300005518 Unclassified 3814
109 Ga0070699_100105975 3300005518 Bacteria 2466
110 Ga0070679_100000291 3300005530 Bacteria 42609
111 Ga0070679_100006719 3300005530 Bacteria 10729
112 Ga0070679_100148691 3300005530 Bacteria 2320
113 Ga0070684_100027640 3300005535 Bacteria 4791
114 Ga0070684_101091455 3300005535 Bacteria 750
115 Ga0070697_100001573 3300005536 Bacteria 17399
116 Ga0070697_100159721 3300005536 Bacteria 1904
117 Ga0070697_100192256 3300005536 Bacteria 1732
118 Ga0070697_100245860 3300005536 Bacteria 1529
119 Ga0070697_100278382 3300005536 Bacteria 1435
120 Ga0068853_100005183 3300005539 Bacteria 10195
121 Ga0068853_100009713 3300005539 Bacteria 7759
122 Ga0068853_100060750 3300005539 Bacteria 3266
123 Ga0068853_100119878 3300005539 Bacteria 2345
124 Ga0068853_100237815 3300005539 Bacteria 1668
125 Ga0070672_100024304 3300005543 Bacteria 4475
126 Ga0070672_100094758 3300005543 Bacteria 2414
127 Ga0070672_100495573 3300005543 Bacteria 1056
128 Ga0070686_100015018 3300005544 Bacteria 4477
129 Ga0070686_100038719 3300005544 Bacteria 2966
130 Ga0070695_100031923 3300005545 Bacteria 3290
131 Ga0070695_100059527 3300005545 Bacteria 2473
132 Ga0070695_100107786 3300005545 Bacteria 1885
133 Ga0070695_100142552 3300005545 Unclassified 1663
134 Ga0070695_100321941 3300005545 Unclassified 1150
135 Ga0070696_100028550 3300005546 Bacteria 3807
136 Ga0070696_100069061 3300005546 Bacteria 2482
137 Ga0070696_100235259 3300005546 Unclassified 1379
138 Ga0070696_100391221 3300005546 Bacteria 1086
139 Ga0070693_100003406 3300005547 Bacteria 7408
140 Ga0070693_100011698 3300005547 Bacteria 4424
141 Ga0070693_100118400 3300005547 Bacteria 1639
142 Ga0070693_100121107 3300005547 Bacteria 1623
143 Ga0070693_100455712 3300005547 Bacteria 898
144 Ga0070665_100113442 3300005548 Bacteria 2713
145 Ga0070665_100734833 3300005548 Bacteria 1000
146 Ga0070704_100020119 3300005549 Bacteria 4297
147 Ga0070704_100165969 3300005549 Unclassified 1751
148 Ga0070704_100183663 3300005549 Bacteria 1675
149 Ga0070704_100504242 3300005549 Bacteria 1050
150 Ga0068855_100574693 3300005563 Bacteria 1218
151 Ga0068855_100654633 3300005563 Bacteria 1128
152 Ga0070664_100000776 3300005564 Bacteria 24631
153 Ga0070664_100306620 3300005564 Unclassified 1436
154 Ga0070664_100422442 3300005564 Unclassified 1221
155 Ga0068857_100016988 3300005577 Bacteria 6375
156 Ga0068857_100190695 3300005577 Bacteria 1867
157 Ga0068857_100261789 3300005577 Bacteria 1587
158 Ga0068857_100342291 3300005577 Bacteria 1384
159 Ga0068857_100447314 3300005577 Bacteria 1207
160 Ga0068857_100473769 3300005577 Unclassified 1173
161 Ga0068857_100620818 3300005577 Unclassified 1023
162 Ga0068854_100061560 3300005578 Unclassified 2719
163 Ga0068854_100112913 3300005578 Unclassified 2052
164 Ga0068854_100195615 3300005578 Bacteria 1587
165 Ga0068854_100287133 3300005578 Bacteria 1327
166 Ga0070702_100007938 3300005615 Bacteria 5113
167 Ga0070702_100056597 3300005615 Bacteria 2265
168 Ga0068852_100186401 3300005616 Unclassified 1954
169 Ga0068852_100504253 3300005616 Bacteria 1205
170 Ga0068859_100005862 3300005617 Bacteria 12470
171 Ga0068859_100021877 3300005617 Bacteria 6412
172 Ga0068859_100074033 3300005617 Bacteria 3444
173 Ga0068859_100297767 3300005617 Bacteria 1706
174 Ga0068859_100354765 3300005617 Unclassified 1561
175 Ga0068859_100505621 3300005617 Bacteria 1303
176 Ga0068859_100656770 3300005617 Unclassified 1140
177 Ga0068859_100935724 3300005617 Bacteria 950
178 Ga0068864_100003461 3300005618 Bacteria 13038
179 Ga0068864_100010651 3300005618 Bacteria 7601
180 Ga0068864_100010804 3300005618 Bacteria 7544
181 Ga0068864_100174501 3300005618 Bacteria 1961
182 Ga0068864_100233843 3300005618 Bacteria 1700
183 Ga0068864_100360925 3300005618 Bacteria 1373
184 Ga0068864_100555185 3300005618 Unclassified 1110
185 Ga0068864_100657513 3300005618 Bacteria 1021
186 Ga0068866_10004396 3300005718 Bacteria 5786
187 Ga0068861_100008878 3300005719 Bacteria 6928
188 Ga0068861_100054660 3300005719 Bacteria 3042
189 Ga0068861_100689171 3300005719 Unclassified 948
190 Ga0068851_10001971 3300005834 Bacteria 9017
191 Ga0068870_10077871 3300005840 Unclassified 1825
192 Ga0068870_10119978 3300005840 Bacteria 1513
193 Ga0068870_10216546 3300005840 Bacteria 1170
194 Ga0068863_100044755 3300005841 Bacteria 4200
195 Ga0068863_100080761 3300005841 Bacteria 3080
196 Ga0068863_100159412 3300005841 Bacteria 2161
197 Ga0068863_100244662 3300005841 Bacteria 1732
198 Ga0068863_100305117 3300005841 Bacteria 1545
199 Ga0068863_100318823 3300005841 Bacteria 1510
200 Ga0068863_100541586 3300005841 Bacteria 1149
201 Ga0068858_100046446 3300005842 Bacteria 4025
202 Ga0068858_100104178 3300005842 Bacteria 2647
203 Ga0068858_100571031 3300005842 Bacteria 1096
204 Ga0068858_100958367 3300005842 Unclassified 838
205 Ga0068860_100043088 3300005843 Bacteria 4307
206 Ga0068860_100066186 3300005843 Bacteria 3432
207 Ga0068860_100198591 3300005843 Unclassified 1943
208 Ga0068860_100593549 3300005843 Unclassified 1112
209 Ga0068860_101101304 3300005843 Unclassified 814
210 Ga0068862_100009515 3300005844 Bacteria 8039
211 Ga0068862_100059803 3300005844 Unclassified 3272
212 Ga0068862_100073109 3300005844 Bacteria 2963
213 Ga0068862_100120417 3300005844 Unclassified 2313
214 Ga0068862_100346017 3300005844 Bacteria 1378
215 Ga0068862_100867536 3300005844 Unclassified 885
216 Ga0068862_100925176 3300005844 Bacteria 858
217 Ga0081539_10000119 3300005985 Bacteria 184136
218 Ga0081539_10038216 3300005985 Bacteria 2847
219 Ga0070716_100016082 3300006173 Bacteria 3856
220 Ga0075427_10011930 3300006194 Bacteria 1315
221 Ga0097621_100007801 3300006237 Bacteria 7678
222 Ga0097621_100014964 3300006237 Bacteria 5823
223 Ga0097621_100018926 3300006237 Bacteria 5274
224 Ga0097621_100204375 3300006237 Bacteria 1716
225 Ga0097621_100228828 3300006237 Bacteria 1623
226 Ga0068871_100001650 3300006358 Bacteria 15016
227 Ga0068871_100077222 3300006358 Bacteria 2752
228 Ga0068871_100151077 3300006358 Bacteria 1981
229 Ga0068871_100162516 3300006358 Bacteria 1910
230 Ga0075428_100157015 3300006844 Unclassified 2470
231 Ga0075430_100061664 3300006846 Bacteria 3151
232 Ga0075433_10032818 3300006852 Unclassified 4448
233 Ga0075433_10065296 3300006852 Unclassified 3192
234 Ga0075433_10143130 3300006852 Bacteria 2125
235 Ga0075433_10235713 3300006852 Unclassified 1625
236 Ga0075433_10363839 3300006852 Bacteria 1278
237 Ga0075434_100062273 3300006871 Unclassified 3713
238 Ga0075434_100079800 3300006871 Bacteria 3269
239 Ga0075434_100242465 3300006871 Bacteria 1822
240 Ga0075429_100223441 3300006880 Bacteria 1649
241 Ga0075436_100000018 3300006914 Bacteria 139195
242 Ga0075436_100034671 3300006914 Unclassified 3481
243 Ga0097620_100005862 3300006931 Bacteria 12470
244 Ga0097620_100021877 3300006931 Bacteria 6412
245 Ga0097620_100074031 3300006931 Bacteria 3444
246 Ga0097620_100297753 3300006931 Bacteria 1706
247 Ga0097620_100354794 3300006931 Unclassified 1561
248 Ga0097620_100505634 3300006931 Bacteria 1303
249 Ga0097620_100656761 3300006931 Unclassified 1140
250 Ga0097620_100935686 3300006931 Bacteria 950
251 Ga0075435_100039902 3300007076 Bacteria 3747
252 Ga0075435_100366134 3300007076 Bacteria 1237
253 Ga0105240_10201046 3300009093 Bacteria 2335
254 Ga0111539_10002689 3300009094 Bacteria 23536
255 Ga0111539_10020653 3300009094 Bacteria 8112
256 Ga0111539_10043691 3300009094 Bacteria 5371
257 Ga0105245_10085599 3300009098 Bacteria 2890
258 Ga0105247_10022348 3300009101 Bacteria 3809
259 Ga0114129_10020760 3300009147 Bacteria 9335
260 Ga0114129_10043427 3300009147 Bacteria 6324
261 Ga0114129_10086482 3300009147 Bacteria 4348
262 Ga0114129_10116458 3300009147 Bacteria 3683
263 Ga0114129_10138936 3300009147 Unclassified 3332
264 Ga0114129_10402979 3300009147 Bacteria 1802
265 Ga0114129_10914001 3300009147 Bacteria 1111
266 Ga0114129_10966887 3300009147 Bacteria 1075
267 Ga0105243_10003475 3300009148 Bacteria 12719
268 Ga0105243_10100879 3300009148 Bacteria 2396
269 Ga0105243_10521576 3300009148 Bacteria 1130
270 Ga0105243_10681621 3300009148 Unclassified 1000
271 Ga0105241_10118235 3300009174 Bacteria 2131
272 Ga0105241_10207490 3300009174 Bacteria 1640
273 Ga0105241_10210235 3300009174 Unclassified 1630
274 Ga0105241_10217959 3300009174 Unclassified 1602
275 Ga0105241_10245976 3300009174 Unclassified 1514
276 Ga0105242_10014594 3300009176 Bacteria 6082
277 Ga0105242_10734550 3300009176 Unclassified 970
278 Ga0105248_10006121 3300009177 Bacteria 13199
279 Ga0105248_10011370 3300009177 Bacteria 9809
280 Ga0105248_10043882 3300009177 Bacteria 5015
281 Ga0105248_10100888 3300009177 Bacteria 3253
282 Ga0105248_10239829 3300009177 Bacteria 2041
283 Ga0105248_10428158 3300009177 Bacteria 1490
284 Ga0105248_10474221 3300009177 Bacteria 1411
285 Ga0105248_10520859 3300009177 Bacteria 1341
286 Ga0105237_10000839 3300009545 Bacteria 42008
287 Ga0105237_10012180 3300009545 Bacteria 9069
288 Ga0105237_10323035 3300009545 Unclassified 1547
289 Ga0105238_10005480 3300009551 Bacteria 12546
290 Ga0105238_10024095 3300009551 Bacteria 6205
291 Ga0105249_10071983 3300009553 Bacteria 3195
292 Ga0105249_10094619 3300009553 Bacteria 2800
293 Ga0105249_10403697 3300009553 Bacteria 1397
294 Ga0105249_10503952 3300009553 Bacteria 1256
295 Ga0105249_10617851 3300009553 Unclassified 1139
296 Ga0105249_10960336 3300009553 Bacteria 923
297 Ga0105239_10050773 3300010375 Bacteria 4548
298 Ga0105239_10181345 3300010375 Bacteria 2356
299 Ga0105239_10412802 3300010375 Unclassified 1529
300 Ga0105239_11544396 3300010375 Bacteria 767
301 Ga0105246_10019654 3300011119 Bacteria 4321
302 Ga0105246_10095744 3300011119 Unclassified 2150
303 Ga0105246_10117138 3300011119 Bacteria 1968
304 Ga0157373_10013264 3300013100 Bacteria 6049
305 Ga0157373_10016977 3300013100 Bacteria 5302
306 Ga0157373_10026123 3300013100 Bacteria 4220
307 Ga0157373_10343465 3300013100 Bacteria 1064
308 Ga0157373_10369330 3300013100 Unclassified 1025
309 Ga0157373_10409732 3300013100 Unclassified 972
310 Ga0157374_10011837 3300013296 Bacteria 7568
311 Ga0157378_10008975 3300013297 Bacteria 8705
312 Ga0157378_10086217 3300013297 Bacteria 2846
313 Ga0157378_10150589 3300013297 Bacteria 2167
314 Ga0157378_10300797 3300013297 Unclassified 1553
315 Ga0157378_10627498 3300013297 Bacteria 1088
316 Ga0157378_10758812 3300013297 Unclassified 993
317 Ga0157378_11106208 3300013297 Unclassified 829
318 Ga0163162_10001915 3300013306 Bacteria 19599
319 Ga0163162_10003332 3300013306 Bacteria 15373
320 Ga0163162_10013243 3300013306 Bacteria 8055
321 Ga0163162_10126202 3300013306 Unclassified 2665
322 Ga0163162_10143571 3300013306 Bacteria 2501
323 Ga0163162_10175236 3300013306 Unclassified 2270
324 Ga0163162_10419413 3300013306 Unclassified 1471
325 Ga0163162_10513791 3300013306 Bacteria 1328
326 Ga0163162_10613444 3300013306 Bacteria 1213
327 Ga0157372_10174330 3300013307 Bacteria 2489
328 Ga0157372_10393550 3300013307 Unclassified 1615
329 Ga0157372_10650593 3300013307 Bacteria 1227
330 Ga0157375_10021478 3300013308 Bacteria 5920
331 Ga0157375_10205177 3300013308 Unclassified 2127
332 Ga0157375_10378669 3300013308 Bacteria 1582
333 Ga0157375_10451183 3300013308 Unclassified 1452
334 Ga0157375_10606546 3300013308 Unclassified 1253
335 Ga0157375_10623175 3300013308 Bacteria 1237
336 Ga0157375_11325688 3300013308 Unclassified 847
337 Ga0163163_10000359 3300014325 Bacteria 43790
338 Ga0163163_10035844 3300014325 Unclassified 4816
339 Ga0163163_10037238 3300014325 Bacteria 4731
340 Ga0163163_10037790 3300014325 Bacteria 4698
341 Ga0163163_10065180 3300014325 Bacteria 3615
342 Ga0163163_10102986 3300014325 Bacteria 2879
343 Ga0163163_10140275 3300014325 Bacteria 2459
344 Ga0163163_10159870 3300014325 Viruses 2298
345 Ga0163163_10260510 3300014325 Bacteria 1785
346 Ga0157380_10005975 3300014326 Bacteria 8518
347 Ga0157380_10022478 3300014326 Bacteria 4749
348 Ga0157380_10065001 3300014326 Bacteria 2930
349 Ga0157380_10173178 3300014326 Bacteria 1888
350 Ga0157380_10210826 3300014326 Bacteria 1731
351 Ga0157380_10292693 3300014326 Bacteria 1496
352 Ga0157377_10019614 3300014745 Bacteria 3534
353 Ga0157379_10154570 3300014968 Bacteria 2069
354 Ga0157379_10160469 3300014968 Bacteria 2029
355 Ga0157376_10019780 3300014969 Bacteria 5197
356 Ga0157376_10041173 3300014969 Bacteria 3781
357 Ga0163161_10002410 3300017792 Bacteria 13411
358 Ga0163161_10374974 3300017792 Bacteria 1136
359 Ga0213874_10027753 3300021377 Bacteria 1613
360 Ga0213876_10194415 3300021384 Bacteria 1078
361 Ga0207697_10008697 3300025315 Bacteria 4426
362 Ga0207697_10050785 3300025315 Bacteria 1713
363 Ga0207656_10019369 3300025321 Bacteria 2692
364 Ga0207656_10121069 3300025321 Bacteria 1218
365 Ga0207653_10034982 3300025885 Bacteria 1633
366 Ga0207682_10143380 3300025893 Bacteria 1073
367 Ga0207642_10048563 3300025899 Unclassified 1903
368 Ga0207688_10076239 3300025901 Unclassified 1909
369 Ga0207680_10157579 3300025903 Bacteria 1520
370 Ga0207680_10219046 3300025903 Unclassified 1304
371 Ga0207647_10013354 3300025904 Bacteria 5700
372 Ga0207647_10094454 3300025904 Bacteria 1781
373 Ga0207647_10201178 3300025904 Unclassified 1152
374 Ga0207645_10092685 3300025907 Bacteria 1943
375 Ga0207643_10002460 3300025908 Bacteria 9998
376 Ga0207643_10006501 3300025908 Bacteria 6259
377 Ga0207643_10112328 3300025908 Unclassified 1606
378 Ga0207684_10001147 3300025910 Bacteria 29558
379 Ga0207684_10117913 3300025910 Bacteria 2274
380 Ga0207684_10262375 3300025910 Bacteria 1491
381 Ga0207654_10426480 3300025911 Unclassified 926
382 Ga0207654_10428043 3300025911 Unclassified 925
383 Ga0207707_10000218 3300025912 Bacteria 61709
384 Ga0207707_10078212 3300025912 Bacteria 2888
385 Ga0207707_10354492 3300025912 Bacteria 1264
386 Ga0207707_10357579 3300025912 Bacteria 1258
387 Ga0207695_10727064 3300025913 Unclassified 873
388 Ga0207671_10131725 3300025914 Unclassified 1920
389 Ga0207671_10294727 3300025914 Unclassified 1281
390 Ga0207671_10354932 3300025914 Bacteria 1163
391 Ga0207660_10000187 3300025917 Bacteria 39221
392 Ga0207660_10023719 3300025917 Bacteria 4146
393 Ga0207662_10104404 3300025918 Unclassified 1760
394 Ga0207662_10148443 3300025918 Unclassified 1490
395 Ga0207657_10061600 3300025919 Bacteria 3216
396 Ga0207649_10239935 3300025920 Bacteria 1301
397 Ga0207649_10484677 3300025920 Unclassified 938
398 Ga0207652_10000066 3300025921 Bacteria 110924
399 Ga0207652_10117516 3300025921 Bacteria 2363
400 Ga0207646_10005501 3300025922 Bacteria 13316
401 Ga0207646_10267633 3300025922 Bacteria 1545
402 Ga0207646_10315083 3300025922 Bacteria 1413
403 Ga0207681_10039283 3300025923 Bacteria 3141
404 Ga0207694_10001192 3300025924 Bacteria 22526
405 Ga0207650_10000080 3300025925 Bacteria 129319
406 Ga0207650_10149267 3300025925 Unclassified 1843
407 Ga0207650_10311296 3300025925 Unclassified 1288
408 Ga0207650_10446366 3300025925 Unclassified 1076
409 Ga0207659_10010824 3300025926 Bacteria 5743
410 Ga0207659_10547667 3300025926 Bacteria 983
411 Ga0207659_10550915 3300025926 Unclassified 980
412 Ga0207659_10642294 3300025926 Unclassified 907
413 Ga0207687_10088287 3300025927 Bacteria 2255
414 Ga0207687_10172501 3300025927 Unclassified 1669
415 Ga0207644_10089082 3300025931 Bacteria 2296
416 Ga0207644_10127176 3300025931 Bacteria 1946
417 Ga0207644_10232988 3300025931 Unclassified 1464
418 Ga0207690_10008814 3300025932 Bacteria 5987
419 Ga0207690_10343622 3300025932 Bacteria 1178
420 Ga0207706_10053477 3300025933 Bacteria 3564
421 Ga0207706_10154387 3300025933 Bacteria 2019
422 Ga0207706_10533230 3300025933 Bacteria 1012
423 Ga0207706_10699233 3300025933 Unclassified 866
424 Ga0207686_10034042 3300025934 Bacteria 3046
425 Ga0207686_10136941 3300025934 Bacteria 1687
426 Ga0207686_10585323 3300025934 Unclassified 876
427 Ga0207709_10078123 3300025935 Bacteria 2124
428 Ga0207670_10007075 3300025936 Bacteria 6248
429 Ga0207670_10275406 3300025936 Bacteria 1310
430 Ga0207670_10416771 3300025936 Unclassified 1077
431 Ga0207669_10271012 3300025937 Bacteria 1275
432 Ga0207704_10042027 3300025938 Bacteria 2687
433 Ga0207704_10351887 3300025938 Bacteria 1147
434 Ga0207665_10026051 3300025939 Bacteria 3858
435 Ga0207691_10000799 3300025940 Bacteria 31267
436 Ga0207691_10014396 3300025940 Bacteria 7542
437 Ga0207691_10162826 3300025940 Bacteria 1956
438 Ga0207691_10446593 3300025940 Bacteria 1101
439 Ga0207711_10035287 3300025941 Bacteria 4239
440 Ga0207711_10112324 3300025941 Bacteria 2424
441 Ga0207711_10156837 3300025941 Bacteria 2058
442 Ga0207711_10179374 3300025941 Unclassified 1925
443 Ga0207711_10228963 3300025941 Bacteria 1702
444 Ga0207711_10433813 3300025941 Unclassified 1223
445 Ga0207711_10471065 3300025941 Bacteria 1170
446 Ga0207689_10002744 3300025942 Bacteria 16283
447 Ga0207689_10055109 3300025942 Bacteria 3273
448 Ga0207689_10076003 3300025942 Unclassified 2761
449 Ga0207689_10189677 3300025942 Unclassified 1696
450 Ga0207689_10355838 3300025942 Bacteria 1217
451 Ga0207689_10529662 3300025942 Bacteria 988
452 Ga0207661_10365497 3300025944 Bacteria 1304
453 Ga0207661_10480533 3300025944 Bacteria 1134
454 Ga0207679_10017104 3300025945 Bacteria 4827
455 Ga0207679_10569143 3300025945 Unclassified 1018
456 Ga0207667_10656882 3300025949 Bacteria 1054
457 Ga0207651_10068134 3300025960 Unclassified 2508
458 Ga0207712_10059918 3300025961 Bacteria 2697
459 Ga0207712_10396514 3300025961 Bacteria 1159
460 Ga0207712_10425281 3300025961 Unclassified 1121
461 Ga0207640_10076430 3300025981 Bacteria 2273
462 Ga0207658_10434672 3300025986 Bacteria 1160
463 Ga0207658_10534644 3300025986 Unclassified 1047
464 Ga0207703_10054603 3300026035 Bacteria 3249
465 Ga0207703_10092082 3300026035 Unclassified 2551
466 Ga0207703_10299314 3300026035 Bacteria 1466
467 Ga0207639_10011172 3300026041 Bacteria 6229
468 Ga0207639_10035041 3300026041 Bacteria 3713
469 Ga0207639_10308230 3300026041 Bacteria 1402
470 Ga0207639_10661132 3300026041 Unclassified 967
471 Ga0207678_10337436 3300026067 Bacteria 1298
472 Ga0207708_10000063 3300026075 Bacteria 87390
473 Ga0207708_10028774 3300026075 Bacteria 4208
474 Ga0207708_10032604 3300026075 Bacteria 3956
475 Ga0207708_10084519 3300026075 Bacteria 2440
476 Ga0207708_10109619 3300026075 Unclassified 2142
477 Ga0207702_10028364 3300026078 Unclassified 4653
478 Ga0207641_10113870 3300026088 Bacteria 2402
479 Ga0207641_10196431 3300026088 Unclassified 1857
480 Ga0207641_10203454 3300026088 Bacteria 1827
481 Ga0207641_10238755 3300026088 Bacteria 1692
482 Ga0207641_10364571 3300026088 Bacteria 1380
483 Ga0207641_10543687 3300026088 Bacteria 1132
484 Ga0207641_10764265 3300026088 Bacteria 954
485 Ga0207648_10001538 3300026089 Bacteria 25397
486 Ga0207648_10067785 3300026089 Unclassified 3110
487 Ga0207648_10095484 3300026089 Unclassified 2601
488 Ga0207676_10004662 3300026095 Bacteria 9710
489 Ga0207676_10011463 3300026095 Bacteria 6336
490 Ga0207676_10015704 3300026095 Bacteria 5471
491 Ga0207676_10016059 3300026095 Bacteria 5415
492 Ga0207676_10058346 3300026095 Bacteria 3044
493 Ga0207674_10000006 3300026116 Bacteria 233530
494 Ga0207674_10080529 3300026116 Bacteria 3260
495 Ga0207674_10084279 3300026116 Unclassified 3177
496 Ga0207675_100000501 3300026118 Bacteria 38076
497 Ga0207675_100003218 3300026118 Bacteria 16022
498 Ga0207675_100082092 3300026118 Unclassified 3023
499 Ga0207683_10102312 3300026121 Bacteria 2558
500 Ga0207683_10137007 3300026121 Bacteria 2204
501 Ga0207698_10413363 3300026142 Bacteria 1293
502 Ga0207698_10418046 3300026142 Bacteria 1286
503 Ga0207428_10010617 3300027907 Bacteria 8217
504 Ga0268266_10361354 3300028379 Unclassified 1366
505 Ga0268265_10080498 3300028380 Unclassified 2569
506 Ga0268265_10134636 3300028380 Bacteria 2059
507 Ga0268264_10122660 3300028381 Unclassified 2292
508 Ga0268264_10339448 3300028381 Unclassified 1426
509 Ga0268264_10546234 3300028381 Unclassified 1136
510 Ga0316177_1040637 3300030731 Unclassified 1262
511 Ga0314311_1254191 3300030733 Bacteria 1376
512 Ga0316178_1063654 3300030735 Bacteria 1083
513 Ga0307408_100009485 3300031548 Bacteria 6420
514 Ga0307408_100032722 3300031548 Bacteria 3627
515 Ga0307405_10004351 3300031731 Bacteria 6678
516 Ga0307405_10005367 3300031731 Bacteria 6177
517 Ga0307405_10299292 3300031731 Bacteria 1219
518 Ga0307413_10005145 3300031824 Bacteria 5796
519 Ga0307413_10158532 3300031824 Bacteria 1587
520 Ga0307413_10218672 3300031824 Unclassified 1390
521 Ga0307413_10469551 3300031824 Bacteria 1003
522 Ga0307410_10002470 3300031852 Bacteria 8931
523 Ga0307410_10003839 3300031852 Bacteria 7635
524 Ga0307406_10002113 3300031901 Bacteria 10829
525 Ga0307406_10053788 3300031901 Unclassified 2566
526 Ga0307406_10084572 3300031901 Unclassified 2119
527 Ga0307407_10005587 3300031903 Bacteria 5476
528 Ga0307412_10067549 3300031911 Bacteria 2428
529 Ga0307412_10081748 3300031911 Bacteria 2235
530 Ga0307409_100031388 3300031995 Bacteria 3833
531 Ga0307409_100125203 3300031995 Bacteria 2184
532 Ga0307409_100224755 3300031995 Unclassified 1697
533 Ga0307416_100006215 3300032002 Bacteria 7452
534 Ga0307416_100504812 3300032002 Bacteria 1274
535 Ga0307416_101406540 3300032002 Unclassified 803
536 Ga0307414_10002955 3300032004 Bacteria 8989
537 Ga0307414_10467108 3300032004 Bacteria 1110
538 Ga0307411_10006755 3300032005 Bacteria 5771
539 Ga0307411_10017459 3300032005 Bacteria 4090
540 Ga0307411_10121888 3300032005 Unclassified 1888
541 Ga0307411_10229831 3300032005 Bacteria 1445
542 Ga0307415_100002220 3300032126 Bacteria 9618
543 Ga0307415_100006058 3300032126 Bacteria 6482
544 Ga0307415_100105930 3300032126 Bacteria 2075
545 Ga0307415_100178264 3300032126 Bacteria 1664
546 Ga0307415_100274873 3300032126 Bacteria 1382
547 Ga0307415_100336225 3300032126 Unclassified 1266
548 Ga0373951_0004278 3300035091 Bacteria 3398
549 Ga0373951_0052567 3300035091 Bacteria 1005
550 Ga0373932_0113519 3300035112 Bacteria 896
551 Ga0373939_0126810 3300035114 Bacteria 907
552 Ga0373941_0007615 3300035115 Unclassified 2656
553 Ga0373942_0009262 3300035207 Unclassified 2302
554 Ga0316574_0103295 3300035398 Bacteria 1825
555 Ga0373931_0060245 3300035691 Unclassified 2043
556 Ga0373931_0254590 3300035691 Bacteria 1069
557 Ga0395900_0431457 3300037418 Bacteria 1277
558 Ga0395900_0609835 3300037418 Unclassified 1031
559 Ga0395898_0039410 3300037466 Bacteria 4677
560 Ga0395898_0225095 3300037466 Bacteria 1789
561 Ga0395901_0235451 3300038443 Unclassified 1911
562 Ga0395901_0683056 3300038443 Unclassified 1026
563 Ga0242422_00667 3300038699 Bacteria 2253
564 Ga0242420_000317 3300038996 Bacteria 5345
565 Ga0242420_005396 3300038996 Bacteria 1980
566 Ga0436365_0890990 3300039437 Bacteria 4375
567 Ga0436363_1034008 3300039450 Unclassified 2821
568 Ga0450889_006898 3300042144 Unclassified 1143
569 Ga0439458_0001522 3300042157 Bacteria 5811
570 Ga0439459_0030612 3300042438 Bacteria 1093
571 Ga0451577_0569956 3300042876 Unclassified 1028
572 Ga0453684_0092780 3300044712 Bacteria 3721
573 Ga0451576_0224260 3300045051 Bacteria 1963
574 Ga0451576_0559973 3300045051 Unclassified 1201
575 Ga0495582_0147789 3300046473 Bacteria 1334
576 Ga0495636_0008281 3300047318 Bacteria 4105
577 Ga0495674_0464987 3300047319 Bacteria 1015
578 Ga0496100_0270638 3300048903 Bacteria 1263
579 Ga0496102_0016276 3300048905 Bacteria 6498
580 Ga0496104_0900403 3300048907 Bacteria 790
581 Ga0496106_0125739 3300048909 Bacteria 2007
582 Ga0496107_0657154 3300048910 Unclassified 773
583 Ga0496108_0075737 3300048911 Bacteria 2844
584 Ga0496108_0299101 3300048911 Unclassified 1402
585 Ga0496109_0716470 3300048912 Unclassified 938
586 Ga0496109_1217082 3300048912 Bacteria 690
587 Ga0496110_0143785 3300048913 Unclassified 2157
588 Ga0496112_0094154 3300048915 Bacteria 2966
589 Ga0496112_0132173 3300048915 Bacteria 2467
590 Ga0496112_0544591 3300048915 Unclassified 1095
591 Ga0496112_0611957 3300048915 Unclassified 1021
592 Ga0501305_042354 3300049161 Unclassified 744
593 Ga0501291_001939 3300049514 Bacteria 2432
594 Ga0501291_005889 3300049514 Bacteria 1618
595 Ga0501292_004055 3300049515 Bacteria 1984
596 Ga0501296_000949 3300049519 Bacteria 2865
597 Ga0501298_002082 3300049521 Bacteria 3000
598 Ga0501299_010270 3300049522 Bacteria 1561
599 Ga0501299_013639 3300049522 Bacteria 1404
600 Ga0501299_044589 3300049522 Unclassified 900
601 Ga0501300_005448 3300049523 Unclassified 1874
602 Ga0501313_024650 3300049529 Bacteria 758
603 Ga0501314_015699 3300049530 Bacteria 750
604 Ga0501315_023532 3300049531 Bacteria 847
605 Ga0501316_012545 3300049532 Bacteria 992
606 Ga0501034_0002080 3300049571 Bacteria 24992
607 Ga0501038_0001586 3300049574 Bacteria 21094
608 Ga0501040_0205008 3300049576 Unclassified 1401
609 Ga0501046_0526786 3300049580 Unclassified 844
610 Ga0501048_0246107 3300049582 Unclassified 1269
611 Ga0501198_019415 3300049649 Bacteria 1071
612 Ga0501202_000976 3300049652 Bacteria 4418
613 Ga0501207_008961 3300049654 Bacteria 1454
614 Ga0501209_068015 3300049656 Bacteria 1008
615 Ga0501216_000773 3300049660 Bacteria 3999
616 Ga0501216_016496 3300049660 Bacteria 1254
617 Ga0501217_013221 3300049661 Unclassified 1850
618 Ga0501217_078309 3300049661 Bacteria 911
619 Ga0501223_006766 3300049663 Bacteria 2360
620 Ga0501224_014204 3300049664 Bacteria 1176
621 Ga0501227_011076 3300049665 Bacteria 1961
622 Ga0501227_080182 3300049665 Bacteria 855
623 Ga0501230_003640 3300049667 Bacteria 2063
624 Ga0501230_021474 3300049667 Bacteria 1132
625 Ga0501233_008690 3300049668 Bacteria 1963
626 Ga0501233_016313 3300049668 Bacteria 1539
627 Ga0501235_002211 3300049669 Bacteria 4183
628 Ga0501235_009095 3300049669 Bacteria 2170
629 Ga0501240_005879 3300049673 Unclassified 1487
630 Ga0501243_027894 3300049675 Bacteria 954
631 Ga0501249_002680 3300049679 Bacteria 3587
632 Ga0501249_014170 3300049679 Unclassified 1697
633 Ga0501249_043140 3300049679 Bacteria 1026
634 Ga0501251_011494 3300049681 Bacteria 1056
635 Ga0501256_002409 3300049685 Bacteria 1483
636 Ga0501257_009134 3300049686 Bacteria 2234
637 Ga0501257_012597 3300049686 Bacteria 1936
638 Ga0501257_089087 3300049686 Bacteria 801
639 Ga0501257_103964 3300049686 Unclassified 748
640 Ga0501260_001045 3300049689 Bacteria 2238
641 Ga0501261_004189 3300049690 Unclassified 1776
642 Ga0501221_032077 3300049704 Bacteria 1102
643 Ga0501225_0001616 3300049705 Bacteria 7047
644 Ga0501225_0007450 3300049705 Bacteria 3169
645 Ga0501225_0028900 3300049705 Bacteria 1523
646 Ga0501229_010667 3300049706 Bacteria 1162
647 Ga0501234_001279 3300049707 Bacteria 3947
648 Ga0501234_002098 3300049707 Bacteria 3153
649 Ga0501245_006095 3300049708 Bacteria 1680
650 Ga0501245_012644 3300049708 Unclassified 1241
651 Ga0501241_043600 3300049758 Bacteria 874
652 Ga0501266_001817 3300049763 Bacteria 2697
653 Ga0501267_002264 3300049764 Bacteria 1715
654 Ga0501268_000456 3300049765 Unclassified 4434
655 Ga0501268_028761 3300049765 Bacteria 995
656 Ga0501270_001395 3300049767 Bacteria 2301
657 Ga0501270_008103 3300049767 Unclassified 1320
658 Ga0501272_012257 3300049769 Bacteria 973
659 Ga0501283_000664 3300049779 Bacteria 4541
660 Ga0501283_027079 3300049779 Unclassified 946
661 Ga0501212_001224 3300049851 Bacteria 2851
662 nmdc:mga05p37_121528_c1 3300050507 Bacteria 3208
663 nmdc:mga05p37_38866_c1 3300050507 Bacteria 5838
664 nmdc:mga05p37_43020_c1 3300050507 Bacteria 5553
665 nmdc:mga05p37_503697_c1 3300050507 Bacteria 1389
666 nmdc:mga05p37_51198_c1 3300050507 Bacteria 5079
667 nmdc:mga05p37_84625_c1 3300050507 Bacteria 3907
668 nmdc:mga09592_296931_c1 3300050508 Bacteria 1401
669 nmdc:mga09592_519751_c1 3300050508 Bacteria 1024
670 nmdc:mga09592_583238_c1 3300050508 Bacteria 959
671 nmdc:mga09592_65435_c1 3300050508 Unclassified 3080
672 nmdc:mga0qj67_11815_c2 3300050509 Unclassified 3712
673 nmdc:mga0qj67_60787_c1 3300050509 Unclassified 2999
674 nmdc:mga06r32_203218_c1 3300050510 Bacteria 1969
675 nmdc:mga06r32_592771_c1 3300050510 Bacteria 1080
676 nmdc:mga08y16_150452_c1 3300050511 Bacteria 2420
677 nmdc:mga08y16_306372_c1 3300050511 Unclassified 1636
678 nmdc:mga08y16_310467_c1 3300050511 Bacteria 1624
679 nmdc:mga08y16_5441_c1 3300050511 Bacteria 13314
680 nmdc:mga0n895_24520_c1 3300050512 Bacteria 5685
681 nmdc:mga0n895_36400_c1 3300050512 Bacteria 4752
682 nmdc:mga0n895_427374_c1 3300050512 Unclassified 1339
683 nmdc:mga0n895_433167_c1 3300050512 Bacteria 1329
684 nmdc:mga0n895_83662_c1 3300050512 Bacteria 3183
685 nmdc:mga0rr50_534062_c1 3300050513 Bacteria 998
686 nmdc:mga08x19_12_c1 3300050514 Bacteria 395395
687 nmdc:mga08x19_3296_c1 3300050514 Bacteria 9649
688 nmdc:mga0a205_158723_c1 3300050515 Unclassified 2159
689 nmdc:mga0a205_25329_c1 3300050515 Bacteria 5651
690 nmdc:mga0a205_273989_c1 3300050515 Bacteria 1564
691 nmdc:mga0a205_41701_c1 3300050515 Bacteria 4421
692 nmdc:mga0a205_677184_c1 3300050515 Unclassified 882
693 nmdc:mga0a205_96085_c1 3300050515 Bacteria 2862
694 nmdc:mga0a205_9932_c1 3300050515 Bacteria 8730
695 Ga0500577_0018049 3300053142 Bacteria 2260
696 Ga0500616_0006873 3300053153 Bacteria 7344
697 Ga0587111_0017192 3300060346 Bacteria 1345
698 Ga0530510_0029243 3300061734 Bacteria 3954
699 8054281465 8054280661 Bacteria 4232245
700 8057635186 8057632132 Bacteria 4726859
701 Ga0157372_10484272
702 SwRhRL2b_contig_3777873
703 CNBas_1000630
704 CNAas_1001018
705 JGI24751J29686_10000018
706 Ga0065714_10064448
707 Ga0065704_10009998
708 Ga0065712_10000125
709 Ga0065712_10083355
710 Ga0065712_10199224
711 Ga0065715_10003822
712 Ga0065715_10016236
713 Ga0065715_10021447
714 Ga0065715_10098956
715 Ga0065707_10001187
716 Ga0065707_10140670
717 Ga0065707_10358074
718 Ga0070676_10134340
719 Ga0070683_100069237
720 Ga0070683_100601505
721 Ga0070690_100032281
722 Ga0070690_100081917
723 Ga0070670_100000829
724 Ga0070670_100078512
725 Ga0070670_100156644
726 Ga0070670_100525291
727 Ga0068869_100017538
728 Ga0068869_100184416
729 Ga0070666_10121126
730 Ga0070666_10166517
731 Ga0070680_100000085
732 Ga0070680_100032083
733 Ga0068868_100057339
734 Ga0070660_100040665
735 Ga0070689_100003820
736 Ga0070689_100058255
737 Ga0070689_100147204
738 Ga0070689_100216524
739 Ga0070687_100014360
740 Ga0070687_100040477
741 Ga0070687_100082467
742 Ga0070687_100085885
743 Ga0070661_100017837
744 Ga0070692_10104945
745 Ga0070692_10217331
746 Ga0070692_10377367
747 Ga0070668_100331882
748 Ga0070669_100254018
749 Ga0070675_100026344
750 Ga0070675_100248928
751 Ga0070675_100251998
752 Ga0070675_100322179
753 Ga0070671_100009327
754 Ga0070671_100037974
755 Ga0070671_100043065
756 Ga0070671_100162188
757 Ga0070671_100261601
758 Ga0070671_100508350
759 Ga0070674_100021879
760 Ga0070674_100054459
761 Ga0070673_100052450
762 Ga0070673_100073204
763 Ga0070688_100124050
764 Ga0070688_100226715
765 Ga0070659_100005823
766 Ga0070667_100070252
767 Ga0070703_10000590
768 Ga0070703_10030797
769 Ga0070705_100042791
770 Ga0070705_100382162
771 Ga0070705_100399062
772 Ga0070705_100429035
773 Ga0070705_100456803
774 Ga0070700_100000082
775 Ga0070700_100017779
776 Ga0070700_100019597
777 Ga0070700_100034320
778 Ga0070700_100154118
779 Ga0070694_100060520
780 Ga0070694_100116969
781 Ga0070694_100243747
782 Ga0070708_100230421
783 Ga0070708_100296717
784 Ga0070678_100164102
785 Ga0070662_100147623
786 Ga0070662_100283347
787 Ga0070681_10000189
788 Ga0070681_10012114
789 Ga0068867_100120362
790 Ga0068867_100187719
791 Ga0068867_100245747
792 Ga0070685_10028014
793 Ga0070685_10115757
794 Ga0070685_10288554
795 Ga0070685_10296861
796 Ga0070706_100000032
797 Ga0070706_100004529
798 Ga0070706_100166730
799 Ga0070707_100013173
800 Ga0070707_100113615
801 Ga0070707_100242307
802 Ga0070707_100316552
803 Ga0070698_100004879
804 Ga0070698_100013434
805 Ga0070698_100038837
806 Ga0070698_100049712
807 Ga0070698_100234328
808 Ga0070699_100045130
809 Ga0070699_100105975
810 Ga0070679_100000291
811 Ga0070679_100006719
812 Ga0070679_100148691
813 Ga0070684_100027640
814 Ga0070684_101091455
815 Ga0070697_100001573
816 Ga0070697_100159721
817 Ga0070697_100192256
818 Ga0070697_100245860
819 Ga0070697_100278382
820 Ga0068853_100005183
821 Ga0068853_100009713
822 Ga0068853_100060750
823 Ga0068853_100119878
824 Ga0068853_100237815
825 Ga0070672_100024304
826 Ga0070672_100094758
827 Ga0070672_100495573
828 Ga0070686_100015018
829 Ga0070686_100038719
830 Ga0070695_100031923
831 Ga0070695_100059527
832 Ga0070695_100107786
833 Ga0070695_100142552
834 Ga0070695_100321941
835 Ga0070696_100028550
836 Ga0070696_100069061
837 Ga0070696_100235259
838 Ga0070696_100391221
839 Ga0070693_100003406
840 Ga0070693_100011698
841 Ga0070693_100118400
842 Ga0070693_100121107
843 Ga0070693_100455712
844 Ga0070665_100113442
845 Ga0070665_100734833
846 Ga0070704_100020119
847 Ga0070704_100165969
848 Ga0070704_100183663
849 Ga0070704_100504242
850 Ga0068855_100574693
851 Ga0068855_100654633
852 Ga0070664_100000776
853 Ga0070664_100306620
854 Ga0070664_100422442
855 Ga0068857_100016988
856 Ga0068857_100190695
857 Ga0068857_100261789
858 Ga0068857_100342291
859 Ga0068857_100447314
860 Ga0068857_100473769
861 Ga0068857_100620818
862 Ga0068854_100061560
863 Ga0068854_100112913
864 Ga0068854_100195615
865 Ga0068854_100287133
866 Ga0070702_100007938
867 Ga0070702_100056597
868 Ga0068852_100186401
869 Ga0068852_100504253
870 Ga0068859_100005862
871 Ga0068859_100021877
872 Ga0068859_100074033
873 Ga0068859_100297767
874 Ga0068859_100354765
875 Ga0068859_100505621
876 Ga0068859_100656770
877 Ga0068859_100935724
878 Ga0068864_100003461
879 Ga0068864_100010651
880 Ga0068864_100010804
881 Ga0068864_100174501
882 Ga0068864_100233843
883 Ga0068864_100360925
884 Ga0068864_100555185
885 Ga0068864_100657513
886 Ga0068866_10004396
887 Ga0068861_100008878
888 Ga0068861_100054660
889 Ga0068861_100689171
890 Ga0068851_10001971
891 Ga0068870_10077871
892 Ga0068870_10119978
893 Ga0068870_10216546
894 Ga0068863_100044755
895 Ga0068863_100080761
896 Ga0068863_100159412
897 Ga0068863_100244662
898 Ga0068863_100305117
899 Ga0068863_100318823
900 Ga0068863_100541586
901 Ga0068858_100046446
902 Ga0068858_100104178
903 Ga0068858_100571031
904 Ga0068858_100958367
905 Ga0068860_100043088
906 Ga0068860_100066186
907 Ga0068860_100198591
908 Ga0068860_100593549
909 Ga0068860_101101304
910 Ga0068862_100009515
911 Ga0068862_100059803
912 Ga0068862_100073109
913 Ga0068862_100120417
914 Ga0068862_100346017
915 Ga0068862_100867536
916 Ga0068862_100925176
917 Ga0081539_10000119
918 Ga0081539_10038216
919 Ga0070716_100016082
920 Ga0075427_10011930
921 Ga0097621_100007801
922 Ga0097621_100014964
923 Ga0097621_100018926
924 Ga0097621_100204375
925 Ga0097621_100228828
926 Ga0068871_100001650
927 Ga0068871_100077222
928 Ga0068871_100151077
929 Ga0068871_100162516
930 Ga0075428_100157015
931 Ga0075430_100061664
932 Ga0075433_10032818
933 Ga0075433_10065296
934 Ga0075433_10143130
935 Ga0075433_10235713
936 Ga0075433_10363839
937 Ga0075434_100062273
938 Ga0075434_100079800
939 Ga0075434_100242465
940 Ga0075429_100223441
941 Ga0075436_100000018
942 Ga0075436_100034671
943 Ga0097620_100005862
944 Ga0097620_100021877
945 Ga0097620_100074031
946 Ga0097620_100297753
947 Ga0097620_100354794
948 Ga0097620_100505634
949 Ga0097620_100656761
950 Ga0097620_100935686
951 Ga0075435_100039902
952 Ga0075435_100366134
953 Ga0105240_10201046
954 Ga0111539_10002689
955 Ga0111539_10020653
956 Ga0111539_10043691
957 Ga0105245_10085599
958 Ga0105247_10022348
959 Ga0114129_10020760
960 Ga0114129_10043427
961 Ga0114129_10086482
962 Ga0114129_10116458
963 Ga0114129_10138936
964 Ga0114129_10402979
965 Ga0114129_10914001
966 Ga0114129_10966887
967 Ga0105243_10003475
968 Ga0105243_10100879
969 Ga0105243_10521576
970 Ga0105243_10681621
971 Ga0105241_10118235
972 Ga0105241_10207490
973 Ga0105241_10210235
974 Ga0105241_10217959
975 Ga0105241_10245976
976 Ga0105242_10014594
977 Ga0105242_10734550
978 Ga0105248_10006121
979 Ga0105248_10011370
980 Ga0105248_10043882
981 Ga0105248_10100888
982 Ga0105248_10239829
983 Ga0105248_10428158
984 Ga0105248_10474221
985 Ga0105248_10520859
986 Ga0105237_10000839
987 Ga0105237_10012180
988 Ga0105237_10323035
989 Ga0105238_10005480
990 Ga0105238_10024095
991 Ga0105249_10071983
992 Ga0105249_10094619
993 Ga0105249_10403697
994 Ga0105249_10503952
995 Ga0105249_10617851
996 Ga0105249_10960336
997 Ga0105239_10050773
998 Ga0105239_10181345
999 Ga0105239_10412802
1000 Ga0105239_11544396
1001 Ga0105246_10019654
1002 Ga0105246_10095744
1003 Ga0105246_10117138
1004 Ga0157373_10013264
1005 Ga0157373_10016977
1006 Ga0157373_10026123
1007 Ga0157373_10343465
1008 Ga0157373_10369330
1009 Ga0157373_10409732
1010 Ga0157374_10011837
1011 Ga0157378_10008975
1012 Ga0157378_10086217
1013 Ga0157378_10150589
1014 Ga0157378_10300797
1015 Ga0157378_10627498
1016 Ga0157378_10758812
1017 Ga0157378_11106208
1018 Ga0163162_10001915
1019 Ga0163162_10003332
1020 Ga0163162_10013243
1021 Ga0163162_10126202
1022 Ga0163162_10143571
1023 Ga0163162_10175236
1024 Ga0163162_10419413
1025 Ga0163162_10513791
1026 Ga0163162_10613444
1027 Ga0157372_10174330
1028 Ga0157372_10393550
1029 Ga0157372_10650593
1030 Ga0157375_10021478
1031 Ga0157375_10205177
1032 Ga0157375_10378669
1033 Ga0157375_10451183
1034 Ga0157375_10606546
1035 Ga0157375_10623175
1036 Ga0157375_11325688
1037 Ga0163163_10000359
1038 Ga0163163_10035844
1039 Ga0163163_10037238
1040 Ga0163163_10037790
1041 Ga0163163_10065180
1042 Ga0163163_10102986
1043 Ga0163163_10140275
1044 Ga0163163_10159870
1045 Ga0163163_10260510
1046 Ga0157380_10005975
1047 Ga0157380_10022478
1048 Ga0157380_10065001
1049 Ga0157380_10173178
1050 Ga0157380_10210826
1051 Ga0157380_10292693
1052 Ga0157377_10019614
1053 Ga0157379_10154570
1054 Ga0157379_10160469
1055 Ga0157376_10019780
1056 Ga0157376_10041173
1057 Ga0163161_10002410
1058 Ga0163161_10374974
1059 Ga0213874_10027753
1060 Ga0213876_10194415
1061 Ga0207697_10008697
1062 Ga0207697_10050785
1063 Ga0207656_10019369
1064 Ga0207656_10121069
1065 Ga0207653_10034982
1066 Ga0207682_10143380
1067 Ga0207642_10048563
1068 Ga0207688_10076239
1069 Ga0207680_10157579
1070 Ga0207680_10219046
1071 Ga0207647_10013354
1072 Ga0207647_10094454
1073 Ga0207647_10201178
1074 Ga0207645_10092685
1075 Ga0207643_10002460
1076 Ga0207643_10006501
1077 Ga0207643_10112328
1078 Ga0207684_10001147
1079 Ga0207684_10117913
1080 Ga0207684_10262375
1081 Ga0207654_10426480
1082 Ga0207654_10428043
1083 Ga0207707_10000218
1084 Ga0207707_10078212
1085 Ga0207707_10354492
1086 Ga0207707_10357579
1087 Ga0207695_10727064
1088 Ga0207671_10131725
1089 Ga0207671_10294727
1090 Ga0207671_10354932
1091 Ga0207660_10000187
1092 Ga0207660_10023719
1093 Ga0207662_10104404
1094 Ga0207662_10148443
1095 Ga0207657_10061600
1096 Ga0207649_10239935
1097 Ga0207649_10484677
1098 Ga0207652_10000066
1099 Ga0207652_10117516
1100 Ga0207646_10005501
1101 Ga0207646_10267633
1102 Ga0207646_10315083
1103 Ga0207681_10039283
1104 Ga0207694_10001192
1105 Ga0207650_10000080
1106 Ga0207650_10149267
1107 Ga0207650_10311296
1108 Ga0207650_10446366
1109 Ga0207659_10010824
1110 Ga0207659_10547667
1111 Ga0207659_10550915
1112 Ga0207659_10642294
1113 Ga0207687_10088287
1114 Ga0207687_10172501
1115 Ga0207644_10089082
1116 Ga0207644_10127176
1117 Ga0207644_10232988
1118 Ga0207690_10008814
1119 Ga0207690_10343622
1120 Ga0207706_10053477
1121 Ga0207706_10154387
1122 Ga0207706_10533230
1123 Ga0207706_10699233
1124 Ga0207686_10034042
1125 Ga0207686_10136941
1126 Ga0207686_10585323
1127 Ga0207709_10078123
1128 Ga0207670_10007075
1129 Ga0207670_10275406
1130 Ga0207670_10416771
1131 Ga0207669_10271012
1132 Ga0207704_10042027
1133 Ga0207704_10351887
1134 Ga0207665_10026051
1135 Ga0207691_10000799
1136 Ga0207691_10014396
1137 Ga0207691_10162826
1138 Ga0207691_10446593
1139 Ga0207711_10035287
1140 Ga0207711_10112324
1141 Ga0207711_10156837
1142 Ga0207711_10179374
1143 Ga0207711_10228963
1144 Ga0207711_10433813
1145 Ga0207711_10471065
1146 Ga0207689_10002744
1147 Ga0207689_10055109
1148 Ga0207689_10076003
1149 Ga0207689_10189677
1150 Ga0207689_10355838
1151 Ga0207689_10529662
1152 Ga0207661_10365497
1153 Ga0207661_10480533
1154 Ga0207679_10017104
1155 Ga0207679_10569143
1156 Ga0207667_10656882
1157 Ga0207651_10068134
1158 Ga0207712_10059918
1159 Ga0207712_10396514
1160 Ga0207712_10425281
1161 Ga0207640_10076430
1162 Ga0207658_10434672
1163 Ga0207658_10534644
1164 Ga0207703_10054603
1165 Ga0207703_10092082
1166 Ga0207703_10299314
1167 Ga0207639_10011172
1168 Ga0207639_10035041
1169 Ga0207639_10308230
1170 Ga0207639_10661132
1171 Ga0207678_10337436
1172 Ga0207708_10000063
1173 Ga0207708_10028774
1174 Ga0207708_10032604
1175 Ga0207708_10084519
1176 Ga0207708_10109619
1177 Ga0207702_10028364
1178 Ga0207641_10113870
1179 Ga0207641_10196431
1180 Ga0207641_10203454
1181 Ga0207641_10238755
1182 Ga0207641_10364571
1183 Ga0207641_10543687
1184 Ga0207641_10764265
1185 Ga0207648_10001538
1186 Ga0207648_10067785
1187 Ga0207648_10095484
1188 Ga0207676_10004662
1189 Ga0207676_10011463
1190 Ga0207676_10015704
1191 Ga0207676_10016059
1192 Ga0207676_10058346
1193 Ga0207674_10000006
1194 Ga0207674_10080529
1195 Ga0207674_10084279
1196 Ga0207675_100000501
1197 Ga0207675_100003218
1198 Ga0207675_100082092
1199 Ga0207683_10102312
1200 Ga0207683_10137007
1201 Ga0207698_10413363
1202 Ga0207698_10418046
1203 Ga0207428_10010617
1204 Ga0268266_10361354
1205 Ga0268265_10080498
1206 Ga0268265_10134636
1207 Ga0268264_10122660
1208 Ga0268264_10339448
1209 Ga0268264_10546234
1210 Ga0316177_1040637
1211 Ga0314311_1254191
1212 Ga0316178_1063654
1213 Ga0307408_100009485
1214 Ga0307408_100032722
1215 Ga0307405_10004351
1216 Ga0307405_10005367
1217 Ga0307405_10299292
1218 Ga0307413_10005145
1219 Ga0307413_10158532
1220 Ga0307413_10218672
1221 Ga0307413_10469551
1222 Ga0307410_10002470
1223 Ga0307410_10003839
1224 Ga0307406_10002113
1225 Ga0307406_10053788
1226 Ga0307406_10084572
1227 Ga0307407_10005587
1228 Ga0307412_10067549
1229 Ga0307412_10081748
1230 Ga0307409_100031388
1231 Ga0307409_100125203
1232 Ga0307409_100224755
1233 Ga0307416_100006215
1234 Ga0307416_100504812
1235 Ga0307416_101406540
1236 Ga0307414_10002955
1237 Ga0307414_10467108
1238 Ga0307411_10006755
1239 Ga0307411_10017459
1240 Ga0307411_10121888
1241 Ga0307411_10229831
1242 Ga0307415_100002220
1243 Ga0307415_100006058
1244 Ga0307415_100105930
1245 Ga0307415_100178264
1246 Ga0307415_100274873
1247 Ga0307415_100336225
1248 Ga0373951_0004278
1249 Ga0373951_0052567
1250 Ga0373932_0113519
1251 Ga0373939_0126810
1252 Ga0373941_0007615
1253 Ga0373942_0009262
1254 Ga0316574_0103295
1255 Ga0373931_0060245
1256 Ga0373931_0254590
1257 Ga0395900_0431457
1258 Ga0395900_0609835
1259 Ga0395898_0039410
1260 Ga0395898_0225095
1261 Ga0395901_0235451
1262 Ga0395901_0683056
1263 Ga0242422_00667
1264 Ga0242420_000317
1265 Ga0242420_005396
1266 Ga0436365_0890990
1267 Ga0436363_1034008
1268 Ga0450889_006898
1269 Ga0439458_0001522
1270 Ga0439459_0030612
1271 Ga0451577_0569956
1272 Ga0453684_0092780
1273 Ga0451576_0224260
1274 Ga0451576_0559973
1275 Ga0495582_0147789
1276 Ga0495636_0008281
1277 Ga0495674_0464987
1278 Ga0496100_0270638
1279 Ga0496102_0016276
1280 Ga0496104_0900403
1281 Ga0496106_0125739
1282 Ga0496107_0657154
1283 Ga0496108_0075737
1284 Ga0496108_0299101
1285 Ga0496109_0716470
1286 Ga0496109_1217082
1287 Ga0496110_0143785
1288 Ga0496112_0094154
1289 Ga0496112_0132173
1290 Ga0496112_0544591
1291 Ga0496112_0611957
1292 Ga0501305_042354
1293 Ga0501291_001939
1294 Ga0501291_005889
1295 Ga0501292_004055
1296 Ga0501296_000949
1297 Ga0501298_002082
1298 Ga0501299_010270
1299 Ga0501299_013639
1300 Ga0501299_044589
1301 Ga0501300_005448
1302 Ga0501313_024650
1303 Ga0501314_015699
1304 Ga0501315_023532
1305 Ga0501316_012545
1306 Ga0501034_0002080
1307 Ga0501038_0001586
1308 Ga0501040_0205008
1309 Ga0501046_0526786
1310 Ga0501048_0246107
1311 Ga0501198_019415
1312 Ga0501202_000976
1313 Ga0501207_008961
1314 Ga0501209_068015
1315 Ga0501216_000773
1316 Ga0501216_016496
1317 Ga0501217_013221
1318 Ga0501217_078309
1319 Ga0501223_006766
1320 Ga0501224_014204
1321 Ga0501227_011076
1322 Ga0501227_080182
1323 Ga0501230_003640
1324 Ga0501230_021474
1325 Ga0501233_008690
1326 Ga0501233_016313
1327 Ga0501235_002211
1328 Ga0501235_009095
1329 Ga0501240_005879
1330 Ga0501243_027894
1331 Ga0501249_002680
1332 Ga0501249_014170
1333 Ga0501249_043140
1334 Ga0501251_011494
1335 Ga0501256_002409
1336 Ga0501257_009134
1337 Ga0501257_012597
1338 Ga0501257_089087
1339 Ga0501257_103964
1340 Ga0501260_001045
1341 Ga0501261_004189
1342 Ga0501221_032077
1343 Ga0501225_0001616
1344 Ga0501225_0007450
1345 Ga0501225_0028900
1346 Ga0501229_010667
1347 Ga0501234_001279
1348 Ga0501234_002098
1349 Ga0501245_006095
1350 Ga0501245_012644
1351 Ga0501241_043600
1352 Ga0501266_001817
1353 Ga0501267_002264
1354 Ga0501268_000456
1355 Ga0501268_028761
1356 Ga0501270_001395
1357 Ga0501270_008103
1358 Ga0501272_012257
1359 Ga0501283_000664
1360 Ga0501283_027079
1361 Ga0501212_001224
1362 nmdc:mga05p37_121528_c1
1363 nmdc:mga05p37_38866_c1
1364 nmdc:mga05p37_43020_c1
1365 nmdc:mga05p37_503697_c1
1366 nmdc:mga05p37_51198_c1
1367 nmdc:mga05p37_84625_c1
1368 nmdc:mga09592_296931_c1
1369 nmdc:mga09592_519751_c1
1370 nmdc:mga09592_583238_c1
1371 nmdc:mga09592_65435_c1
1372 nmdc:mga0qj67_11815_c2
1373 nmdc:mga0qj67_60787_c1
1374 nmdc:mga06r32_203218_c1
1375 nmdc:mga06r32_592771_c1
1376 nmdc:mga08y16_150452_c1
1377 nmdc:mga08y16_306372_c1
1378 nmdc:mga08y16_310467_c1
1379 nmdc:mga08y16_5441_c1
1380 nmdc:mga0n895_24520_c1
1381 nmdc:mga0n895_36400_c1
1382 nmdc:mga0n895_427374_c1
1383 nmdc:mga0n895_433167_c1
1384 nmdc:mga0n895_83662_c1
1385 nmdc:mga0rr50_534062_c1
1386 nmdc:mga08x19_12_c1
1387 nmdc:mga08x19_3296_c1
1388 nmdc:mga0a205_158723_c1
1389 nmdc:mga0a205_25329_c1
1390 nmdc:mga0a205_273989_c1
1391 nmdc:mga0a205_41701_c1
1392 nmdc:mga0a205_677184_c1
1393 nmdc:mga0a205_96085_c1
1394 nmdc:mga0a205_9932_c1
1395 Ga0500577_0018049
1396 Ga0500616_0006873
1397 Ga0587111_0017192
1398 Ga0530510_0029243
1399 8054281465
1400 8057635186

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

86

179

0.95

PF08242

Methyltransf_12

Methyltransferase domain

86

177

0.95

PF13649

Methyltransf_25

Methyltransferase domain

85

175

0.95

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

26

261

0.92

PF13847

Methyltransf_31

Methyltransferase domain

79

240

0.88

PF13489

Methyltransf_23

Methyltransferase domain

59

245

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9024 5 219
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8754 5 219
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.84 26 205
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8204 28 218
3ofk-assembly2.cif.gz_B crystal structure of n-methyltransferase nods from bradyrhizobium japonicum wm9 in complex with s-adenosyl-l-homocysteine (sah) 0.8055 23 221
ID Description Score Start End Superfamily
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9639 6 220 3.40.50.150
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9505 6 220 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9434 5 219 3.40.50.150
af_A4IC78_24_256_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9299 5 219 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9292 5 219 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7I9YGS2-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9616 1 220 GO:0009234
GO:0032259
GO:0043770
AF-A0A1X6X8D4-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9599 2 220 GO:0009234
GO:0032259
GO:0043770
AF-A0A7V5FHF0-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9593 1 220 GO:0009234
GO:0032259
GO:0043770
AF-A0A832CZD7-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9586 2 221 GO:0009234
GO:0032259
GO:0043770
AF-A0A183AS31-F1-model_v4 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (EC 2.1.1.201) (Ubiquinone biosynthesis methyltransferase COQ5) 0.9576 91 220 GO:0008425
GO:0031314
GO:0032259

Map