F476062
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 699 | 399 | 658 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300049759|Ga0501262_000093|Ga0501262_000093_1819_2358 |
| Length | 179 |
| Sequence | VFSDPGFLTQNGAPIDLGAHGMAQYTAEILWQRGEQDFLGNSYSRRHSMRFDGGAEVPGSSSPHVVPLPFSDAAAVDPEEAFVASLSSCHMLWFLTMAVKRKFTVDRYFDAASGIMEKNAEGKLAMTVVTLRPEATFSGANLPTREQIEHMHHRAHEECFIANSVKTEVRCEPVFGSAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 4 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 5 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 6 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 7 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 8 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 9 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 10 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 11 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 12 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 13 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 14 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 15 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 16 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 17 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 18 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 19 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 20 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 21 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 22 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 23 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 24 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 25 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 26 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 27 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 28 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 29 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 30 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 31 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 32 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 33 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 34 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 35 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 36 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 37 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 38 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 39 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 40 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 41 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 42 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 43 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 44 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 45 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 46 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 47 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 48 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 49 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 50 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 51 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 52 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 53 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 54 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 55 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 56 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 63 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 65 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 69 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 70 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 71 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 76 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 80 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 96 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 101 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 102 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 107 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 109 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 110 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 111 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 112 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 113 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 114 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 115 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 116 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 117 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 118 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 119 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 120 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 121 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 122 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 123 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 125 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 126 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 130 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 131 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 132 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 133 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 134 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 135 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 136 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 137 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 138 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 139 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 140 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 151 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 155 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 156 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 164 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 168 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 169 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 235 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 245 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 246 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 247 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 248 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 249 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 250 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 251 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 252 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 253 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 254 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 255 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 256 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 257 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 258 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 259 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 260 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 261 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 262 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 263 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 264 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 265 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 266 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 267 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 268 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 269 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 270 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 271 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 272 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 277 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 278 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 279 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 280 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 281 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 282 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 283 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 284 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 285 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 286 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 287 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 336 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 337 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 338 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 339 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 340 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 341 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 342 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 343 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 344 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 345 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 346 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 347 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 348 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 351 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 352 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 353 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 354 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 356 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 357 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 358 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 360 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 369 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 370 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 371 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 372 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 373 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 374 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 375 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 376 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 377 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 378 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 379 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 381 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 382 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 384 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 386 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 387 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 388 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 389 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 390 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 391 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 392 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 395 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 397 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 398 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 399 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.13 |
| Metatranscriptomes | 0 |
| Isolates | 5.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 33.48 |
| Nodule | 2 |
| Rhizoplane | 2.29 |
| Rhizosphere | 51.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10148046 | 3300001989 | Bacteria | 695 |
| 2 | JGI25155J39150_1000106 | 3300002704 | Bacteria | 44262 |
| 3 | JGI25156J39149_1000024 | 3300002705 | Bacteria | 141748 |
| 4 | JGI25154J39366_1000043 | 3300002738 | Bacteria | 142417 |
| 5 | JGI25157J39369_1000031 | 3300002741 | Bacteria | 141953 |
| 6 | JGI25152J39213_1001121 | 3300002773 | Bacteria | 12491 |
| 7 | JGI25152J39213_1004181 | 3300002773 | Bacteria | 4649 |
| 8 | JGI25150J39212_1000556 | 3300002774 | Bacteria | 15009 |
| 9 | JGI25150J39212_1010834 | 3300002774 | Bacteria | 1678 |
| 10 | JGI25159J45721_1000583 | 3300002987 | Bacteria | 16414 |
| 11 | JGI25159J45721_1003958 | 3300002987 | Bacteria | 5055 |
| 12 | JGI25159J45721_1004621 | 3300002987 | Bacteria | 4514 |
| 13 | JGI25151J46595_10000983 | 3300003187 | Bacteria | 21613 |
| 14 | JGI25151J46595_10009784 | 3300003187 | Bacteria | 4514 |
| 15 | JGI25151J46595_10016862 | 3300003187 | Bacteria | 3185 |
| 16 | JGI25151J46595_10020552 | 3300003187 | Bacteria | 2780 |
| 17 | JGI25151J46595_10034889 | 3300003187 | Bacteria | 1917 |
| 18 | JGI25151J46595_10056962 | 3300003187 | Bacteria | 1278 |
| 19 | JGI25153J46596_10009924 | 3300003215 | Bacteria | 4362 |
| 20 | JGI25153J46596_10028831 | 3300003215 | Bacteria | 1917 |
| 21 | rootH1_10045273 | 3300003316 | Bacteria | 3151 |
| 22 | rootH2_10070709 | 3300003320 | Bacteria | 3872 |
| 23 | rootL2_10069764 | 3300003322 | Bacteria | 2517 |
| 24 | rootH1_10057228 | 3300003323 | Bacteria | 2149 |
| 25 | rootH1_10276335 | 3300003323 | Bacteria | 1224 |
| 26 | rootH1_10403597 | 3300003323 | Bacteria | 1115 |
| 27 | JGI25160J50197_1000276 | 3300003354 | Bacteria | 37602 |
| 28 | JGI25160J50197_1006922 | 3300003354 | Bacteria | 4514 |
| 29 | JGI25160J50197_1010866 | 3300003354 | Bacteria | 3266 |
| 30 | JGI25161J50226_1000021 | 3300003374 | Bacteria | 163584 |
| 31 | JGI25161J50226_1002668 | 3300003374 | Bacteria | 4449 |
| 32 | JGI25161J50226_1002758 | 3300003374 | Bacteria | 4332 |
| 33 | Ga0055535_1000507 | 3300003761 | Bacteria | 34514 |
| 34 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 35 | Ga0055526_1009371 | 3300003771 | Bacteria | 4719 |
| 36 | Ga0055526_1010324 | 3300003771 | Bacteria | 4362 |
| 37 | Ga0055526_1017805 | 3300003771 | Bacteria | 2691 |
| 38 | Ga0055526_1031110 | 3300003771 | Bacteria | 1539 |
| 39 | Ga0055526_1059645 | 3300003771 | Bacteria | 820 |
| 40 | Ga0055537_1000124 | 3300003773 | Bacteria | 58656 |
| 41 | Ga0055537_1000418 | 3300003773 | Bacteria | 27742 |
| 42 | Ga0055537_1000444 | 3300003773 | Bacteria | 26376 |
| 43 | Ga0055537_1003982 | 3300003773 | Bacteria | 4362 |
| 44 | Ga0055537_1013497 | 3300003773 | Bacteria | 1530 |
| 45 | Ga0055537_1021539 | 3300003773 | Bacteria | 956 |
| 46 | Ga0055524_1000039 | 3300003775 | Bacteria | 159897 |
| 47 | Ga0055524_1008191 | 3300003775 | Bacteria | 4362 |
| 48 | Ga0055524_1008253 | 3300003775 | Bacteria | 4340 |
| 49 | Ga0055536_1002065 | 3300003781 | Bacteria | 11464 |
| 50 | Ga0055536_1004573 | 3300003781 | Bacteria | 7024 |
| 51 | Ga0055536_1005447 | 3300003781 | Bacteria | 6221 |
| 52 | Ga0055536_1020823 | 3300003781 | Bacteria | 2011 |
| 53 | Ga0055536_1021460 | 3300003781 | Bacteria | 1959 |
| 54 | Ga0055534_1000117 | 3300003784 | Bacteria | 58656 |
| 55 | Ga0055534_1000417 | 3300003784 | Bacteria | 25632 |
| 56 | Ga0055534_1004074 | 3300003784 | Bacteria | 4362 |
| 57 | Ga0055534_1019110 | 3300003784 | Bacteria | 1181 |
| 58 | Ga0055528_1001025 | 3300003790 | Bacteria | 18500 |
| 59 | Ga0055528_1001402 | 3300003790 | Bacteria | 14774 |
| 60 | Ga0055528_1008560 | 3300003790 | Bacteria | 4362 |
| 61 | Ga0055528_1028650 | 3300003790 | Bacteria | 1530 |
| 62 | Ga0055528_1028651 | 3300003790 | Bacteria | 1530 |
| 63 | Ga0055530_10000457 | 3300003791 | Bacteria | 36104 |
| 64 | Ga0055530_10000547 | 3300003791 | Bacteria | 32606 |
| 65 | Ga0055530_10015173 | 3300003791 | Bacteria | 2532 |
| 66 | Ga0055530_10026962 | 3300003791 | Bacteria | 1576 |
| 67 | Ga0055540_1000047 | 3300003792 | Bacteria | 146914 |
| 68 | Ga0055540_1000950 | 3300003792 | Bacteria | 18814 |
| 69 | Ga0055540_1001514 | 3300003792 | Bacteria | 13758 |
| 70 | Ga0055540_1002602 | 3300003792 | Bacteria | 9393 |
| 71 | Ga0055540_1003418 | 3300003792 | Bacteria | 7682 |
| 72 | Ga0055540_1007972 | 3300003792 | Bacteria | 3889 |
| 73 | Ga0055540_1028387 | 3300003792 | Bacteria | 1324 |
| 74 | Ga0055531_10000433 | 3300003794 | Bacteria | 39688 |
| 75 | Ga0055531_10002080 | 3300003794 | Bacteria | 13758 |
| 76 | Ga0055531_10002810 | 3300003794 | Bacteria | 11424 |
| 77 | Ga0055531_10007878 | 3300003794 | Bacteria | 5726 |
| 78 | Ga0055543_1001013 | 3300004625 | Bacteria | 12503 |
| 79 | Ga0055543_1003692 | 3300004625 | Bacteria | 4400 |
| 80 | Ga0055543_1005079 | 3300004625 | Bacteria | 3430 |
| 81 | Ga0065165_1005063 | 3300005262 | Bacteria | 7672 |
| 82 | Ga0065165_1009376 | 3300005262 | Bacteria | 4400 |
| 83 | Ga0065165_1029098 | 3300005262 | Bacteria | 1774 |
| 84 | Ga0065165_1029128 | 3300005262 | Bacteria | 1773 |
| 85 | Ga0065712_10240137 | 3300005290 | Unclassified | 986 |
| 86 | Ga0065707_10844695 | 3300005295 | Unclassified | 584 |
| 87 | Ga0070658_10304935 | 3300005327 | Bacteria | 1358 |
| 88 | Ga0070676_10020801 | 3300005328 | Bacteria | 3667 |
| 89 | Ga0070676_10394333 | 3300005328 | Bacteria | 961 |
| 90 | Ga0070690_100482230 | 3300005330 | Unclassified | 925 |
| 91 | Ga0070670_100186401 | 3300005331 | Bacteria | 1801 |
| 92 | Ga0070670_100244491 | 3300005331 | Bacteria | 1562 |
| 93 | Ga0070670_100473472 | 3300005331 | Bacteria | 1112 |
| 94 | Ga0068869_100051079 | 3300005334 | Bacteria | 2999 |
| 95 | Ga0070666_10223264 | 3300005335 | Bacteria | 1329 |
| 96 | Ga0070680_100299329 | 3300005336 | Bacteria | 1364 |
| 97 | Ga0070682_101912147 | 3300005337 | Bacteria | 520 |
| 98 | Ga0068868_100481751 | 3300005338 | Bacteria | 1084 |
| 99 | Ga0070660_100020620 | 3300005339 | Bacteria | 4848 |
| 100 | Ga0070668_100189413 | 3300005347 | Unclassified | 1684 |
| 101 | Ga0070669_100002673 | 3300005353 | Bacteria | 12838 |
| 102 | Ga0070669_100091186 | 3300005353 | Unclassified | 2285 |
| 103 | Ga0070675_100488999 | 3300005354 | Bacteria | 1108 |
| 104 | Ga0070671_100112332 | 3300005355 | Bacteria | 2289 |
| 105 | Ga0070674_100153148 | 3300005356 | Bacteria | 1741 |
| 106 | Ga0070673_100017705 | 3300005364 | Bacteria | 5075 |
| 107 | Ga0070673_100570205 | 3300005364 | Bacteria | 1030 |
| 108 | Ga0070688_100330678 | 3300005365 | Bacteria | 1110 |
| 109 | Ga0070688_101173381 | 3300005365 | Bacteria | 616 |
| 110 | Ga0070667_100219115 | 3300005367 | Bacteria | 1694 |
| 111 | Ga0070667_100252040 | 3300005367 | Unclassified | 1578 |
| 112 | Ga0070705_100246218 | 3300005440 | Bacteria | 1252 |
| 113 | Ga0070705_100491861 | 3300005440 | Bacteria | 929 |
| 114 | Ga0070694_100319664 | 3300005444 | Bacteria | 1194 |
| 115 | Ga0070708_100347359 | 3300005445 | Bacteria | 1398 |
| 116 | Ga0070678_100199372 | 3300005456 | Bacteria | 1651 |
| 117 | Ga0070678_100998677 | 3300005456 | Bacteria | 769 |
| 118 | Ga0070662_100044539 | 3300005457 | Bacteria | 3179 |
| 119 | Ga0070662_100638014 | 3300005457 | Bacteria | 898 |
| 120 | Ga0070662_100763038 | 3300005457 | Bacteria | 821 |
| 121 | Ga0070681_10020571 | 3300005458 | Bacteria | 6613 |
| 122 | Ga0068867_100003586 | 3300005459 | Bacteria | 10917 |
| 123 | Ga0070706_100623891 | 3300005467 | Bacteria | 1001 |
| 124 | Ga0070707_100507861 | 3300005468 | Bacteria | 1167 |
| 125 | Ga0070699_100382334 | 3300005518 | Bacteria | 1271 |
| 126 | Ga0070679_100089580 | 3300005530 | Bacteria | 3064 |
| 127 | Ga0070684_100036197 | 3300005535 | Bacteria | 4229 |
| 128 | Ga0070684_100202075 | 3300005535 | Bacteria | 1810 |
| 129 | Ga0068853_100020424 | 3300005539 | Bacteria | 5508 |
| 130 | Ga0068853_100021089 | 3300005539 | Bacteria | 5425 |
| 131 | Ga0068853_100462693 | 3300005539 | Bacteria | 1194 |
| 132 | Ga0070672_100022223 | 3300005543 | Bacteria | 4654 |
| 133 | Ga0070696_100192760 | 3300005546 | Bacteria | 1517 |
| 134 | Ga0070665_100663247 | 3300005548 | Bacteria | 1056 |
| 135 | Ga0070665_101016357 | 3300005548 | Bacteria | 841 |
| 136 | Ga0070665_101074337 | 3300005548 | Bacteria | 816 |
| 137 | Ga0070704_100198713 | 3300005549 | Bacteria | 1617 |
| 138 | Ga0068855_100018937 | 3300005563 | Bacteria | 8276 |
| 139 | Ga0068855_100033927 | 3300005563 | Bacteria | 6088 |
| 140 | Ga0068855_100065866 | 3300005563 | Bacteria | 4224 |
| 141 | Ga0070664_100016355 | 3300005564 | Bacteria | 6082 |
| 142 | Ga0070664_100883057 | 3300005564 | Bacteria | 838 |
| 143 | Ga0068857_100100359 | 3300005577 | Bacteria | 2597 |
| 144 | Ga0068857_100269725 | 3300005577 | Bacteria | 1564 |
| 145 | Ga0068854_100167245 | 3300005578 | Bacteria | 1708 |
| 146 | Ga0068854_100755134 | 3300005578 | Bacteria | 844 |
| 147 | Ga0068856_100693512 | 3300005614 | Bacteria | 1039 |
| 148 | Ga0068852_100289453 | 3300005616 | Bacteria | 1582 |
| 149 | Ga0068864_100158173 | 3300005618 | Bacteria | 2058 |
| 150 | Ga0068861_100285353 | 3300005719 | Bacteria | 1423 |
| 151 | Ga0068851_10003627 | 3300005834 | Bacteria | 6888 |
| 152 | Ga0068863_100018659 | 3300005841 | Bacteria | 6637 |
| 153 | Ga0068858_100017427 | 3300005842 | Bacteria | 6738 |
| 154 | Ga0068862_100053515 | 3300005844 | Bacteria | 3456 |
| 155 | Ga0068862_100062095 | 3300005844 | Bacteria | 3213 |
| 156 | Ga0068862_100071146 | 3300005844 | Bacteria | 3004 |
| 157 | Ga0068862_100105181 | 3300005844 | Unclassified | 2474 |
| 158 | Ga0068862_100342033 | 3300005844 | Bacteria | 1386 |
| 159 | Ga0081538_10030266 | 3300005981 | Bacteria | 3679 |
| 160 | Ga0075365_10001430 | 3300006038 | Bacteria | 10792 |
| 161 | Ga0075365_10449419 | 3300006038 | Bacteria | 910 |
| 162 | Ga0075363_100075106 | 3300006048 | Bacteria | 1841 |
| 163 | Ga0075363_100404275 | 3300006048 | Bacteria | 803 |
| 164 | Ga0075364_10015136 | 3300006051 | Bacteria | 4776 |
| 165 | Ga0075364_10129589 | 3300006051 | Bacteria | 1692 |
| 166 | Ga0075364_10688418 | 3300006051 | Bacteria | 698 |
| 167 | Ga0075432_10024090 | 3300006058 | Bacteria | 2084 |
| 168 | Ga0075432_10461959 | 3300006058 | Bacteria | 559 |
| 169 | Ga0070716_100009970 | 3300006173 | Bacteria | 4752 |
| 170 | Ga0070716_100527196 | 3300006173 | Bacteria | 876 |
| 171 | Ga0070712_100965735 | 3300006175 | Bacteria | 736 |
| 172 | Ga0075362_10012179 | 3300006177 | Bacteria | 3410 |
| 173 | Ga0075362_10076850 | 3300006177 | Bacteria | 1533 |
| 174 | Ga0075369_10021689 | 3300006186 | Bacteria | 2643 |
| 175 | Ga0075366_10012391 | 3300006195 | Bacteria | 4836 |
| 176 | Ga0075366_10567782 | 3300006195 | Bacteria | 703 |
| 177 | Ga0097621_100881238 | 3300006237 | Bacteria | 833 |
| 178 | Ga0075370_10000897 | 3300006353 | Bacteria | 12203 |
| 179 | Ga0075370_10001266 | 3300006353 | Bacteria | 10762 |
| 180 | Ga0075370_10003966 | 3300006353 | Bacteria | 7110 |
| 181 | Ga0075370_10444226 | 3300006353 | Bacteria | 780 |
| 182 | Ga0075370_10615580 | 3300006353 | Bacteria | 658 |
| 183 | Ga0068871_100035745 | 3300006358 | Bacteria | 3950 |
| 184 | Ga0075428_100226017 | 3300006844 | Bacteria | 2020 |
| 185 | Ga0075433_10223844 | 3300006852 | Bacteria | 1671 |
| 186 | Ga0075433_10494954 | 3300006852 | Bacteria | 1076 |
| 187 | Ga0075434_100197407 | 3300006871 | Bacteria | 2032 |
| 188 | Ga0068865_100796125 | 3300006881 | Bacteria | 815 |
| 189 | Ga0075436_100008852 | 3300006914 | Bacteria | 6886 |
| 190 | Ga0079104_1035286 | 3300006946 | Bacteria | 1208 |
| 191 | Ga0099826_10000022 | 3300006948 | Bacteria | 159004 |
| 192 | Ga0099826_10002164 | 3300006948 | Bacteria | 12507 |
| 193 | Ga0099826_10018113 | 3300006948 | Bacteria | 5320 |
| 194 | Ga0099826_10074502 | 3300006948 | Bacteria | 2140 |
| 195 | Ga0099794_10032045 | 3300007265 | Bacteria | 2465 |
| 196 | Ga0099795_10068661 | 3300007788 | Bacteria | 1332 |
| 197 | Ga0105251_10008851 | 3300009011 | Bacteria | 6029 |
| 198 | Ga0105251_10040138 | 3300009011 | Bacteria | 2283 |
| 199 | Ga0105244_10001326 | 3300009036 | Bacteria | 20208 |
| 200 | Ga0105240_10018681 | 3300009093 | Bacteria | 9288 |
| 201 | Ga0105240_10197613 | 3300009093 | Bacteria | 2359 |
| 202 | Ga0105240_11410390 | 3300009093 | Bacteria | 732 |
| 203 | Ga0111539_10000919 | 3300009094 | Bacteria | 38463 |
| 204 | Ga0111539_10763236 | 3300009094 | Bacteria | 1125 |
| 205 | Ga0114129_10123519 | 3300009147 | Bacteria | 3560 |
| 206 | Ga0114129_10129546 | 3300009147 | Bacteria | 3467 |
| 207 | Ga0114129_11437120 | 3300009147 | Bacteria | 850 |
| 208 | Ga0105243_10000802 | 3300009148 | Bacteria | 30014 |
| 209 | Ga0105243_10001807 | 3300009148 | Bacteria | 18371 |
| 210 | Ga0105243_10022126 | 3300009148 | Bacteria | 4831 |
| 211 | Ga0105243_10266801 | 3300009148 | Bacteria | 1535 |
| 212 | Ga0105242_10691897 | 3300009176 | Bacteria | 996 |
| 213 | Ga0105242_11231168 | 3300009176 | Bacteria | 769 |
| 214 | Ga0105237_10434576 | 3300009545 | Bacteria | 1318 |
| 215 | Ga0105237_10512134 | 3300009545 | Bacteria | 1207 |
| 216 | Ga0105238_10051027 | 3300009551 | Bacteria | 4162 |
| 217 | Ga0105249_10177487 | 3300009553 | Bacteria | 2070 |
| 218 | Ga0105028_123472 | 3300009993 | Bacteria | 675 |
| 219 | Ga0099796_10060262 | 3300010159 | Bacteria | 1343 |
| 220 | Ga0099796_10132212 | 3300010159 | Bacteria | 968 |
| 221 | Ga0105239_10051418 | 3300010375 | Bacteria | 4517 |
| 222 | Ga0105239_10064586 | 3300010375 | Bacteria | 4018 |
| 223 | Ga0105239_10828218 | 3300010375 | Bacteria | 1061 |
| 224 | Ga0105239_11914033 | 3300010375 | Bacteria | 688 |
| 225 | Ga0105246_10010302 | 3300011119 | Bacteria | 5778 |
| 226 | Ga0105246_10131455 | 3300011119 | Bacteria | 1870 |
| 227 | Ga0157347_1002655 | 3300012502 | Bacteria | 1551 |
| 228 | Ga0157326_1000714 | 3300012513 | Bacteria | 3890 |
| 229 | Ga0157373_10012722 | 3300013100 | Bacteria | 6184 |
| 230 | Ga0157373_10204319 | 3300013100 | Bacteria | 1393 |
| 231 | Ga0157371_10549497 | 3300013102 | Bacteria | 856 |
| 232 | Ga0157370_10353125 | 3300013104 | Bacteria | 1355 |
| 233 | Ga0157369_10017003 | 3300013105 | Bacteria | 8175 |
| 234 | Ga0157378_10561956 | 3300013297 | Bacteria | 1148 |
| 235 | Ga0157375_10042119 | 3300013308 | Bacteria | 4417 |
| 236 | Ga0157380_10043291 | 3300014326 | Bacteria | 3524 |
| 237 | Ga0157380_10244759 | 3300014326 | Bacteria | 1619 |
| 238 | Ga0157380_10828388 | 3300014326 | Bacteria | 945 |
| 239 | Ga0157380_11311147 | 3300014326 | Bacteria | 772 |
| 240 | Ga0182008_10004833 | 3300014497 | Bacteria | 7787 |
| 241 | Ga0182008_10027531 | 3300014497 | Bacteria | 2878 |
| 242 | Ga0182006_1001517 | 3300015261 | Bacteria | 13902 |
| 243 | Ga0182006_1136057 | 3300015261 | Bacteria | 842 |
| 244 | Ga0182007_10001159 | 3300015262 | Bacteria | 14263 |
| 245 | Ga0182007_10026879 | 3300015262 | Bacteria | 1990 |
| 246 | Ga0163161_10000188 | 3300017792 | Bacteria | 56743 |
| 247 | Ga0163161_10017313 | 3300017792 | Bacteria | 5042 |
| 248 | Ga0163161_10052739 | 3300017792 | Bacteria | 2949 |
| 249 | Ga0213876_10049610 | 3300021384 | Bacteria | 2218 |
| 250 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 251 | Ga0209436_104400 | 3300025208 | Bacteria | 3491 |
| 252 | Ga0209436_107124 | 3300025208 | Bacteria | 2374 |
| 253 | Ga0209436_108431 | 3300025208 | Bacteria | 2053 |
| 254 | Ga0209672_101002 | 3300025228 | Bacteria | 12358 |
| 255 | Ga0209147_102838 | 3300025229 | Bacteria | 3847 |
| 256 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 257 | Ga0207425_1000154 | 3300025245 | Bacteria | 58601 |
| 258 | Ga0207425_1006563 | 3300025245 | Bacteria | 3168 |
| 259 | Ga0207425_1014604 | 3300025245 | Bacteria | 1779 |
| 260 | Ga0209646_1000079 | 3300025246 | Bacteria | 207677 |
| 261 | Ga0209026_1000067 | 3300025250 | Bacteria | 207677 |
| 262 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 263 | Ga0209759_1000056 | 3300025256 | Bacteria | 207677 |
| 264 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 265 | Ga0209129_1002197 | 3300025258 | Bacteria | 9806 |
| 266 | Ga0209129_1005330 | 3300025258 | Bacteria | 4598 |
| 267 | Ga0209129_1036212 | 3300025258 | Bacteria | 799 |
| 268 | Ga0209565_1000080 | 3300025263 | Bacteria | 156999 |
| 269 | Ga0209565_1000114 | 3300025263 | Bacteria | 116078 |
| 270 | Ga0209565_1000125 | 3300025263 | Bacteria | 110485 |
| 271 | Ga0209565_1002434 | 3300025263 | Bacteria | 6717 |
| 272 | Ga0209565_1017322 | 3300025263 | Bacteria | 1582 |
| 273 | Ga0209673_1000088 | 3300025273 | Bacteria | 204629 |
| 274 | Ga0209673_1000192 | 3300025273 | Bacteria | 123155 |
| 275 | Ga0209673_1000572 | 3300025273 | Bacteria | 58687 |
| 276 | Ga0209673_1000583 | 3300025273 | Bacteria | 57643 |
| 277 | Ga0209130_1000103 | 3300025284 | Bacteria | 137115 |
| 278 | Ga0209130_1000238 | 3300025284 | Bacteria | 70723 |
| 279 | Ga0209130_1001296 | 3300025284 | Bacteria | 17227 |
| 280 | Ga0209130_1012355 | 3300025284 | Bacteria | 2237 |
| 281 | Ga0209675_1000029 | 3300025291 | Bacteria | 281053 |
| 282 | Ga0209675_1000209 | 3300025291 | Bacteria | 61674 |
| 283 | Ga0209675_1000403 | 3300025291 | Bacteria | 35659 |
| 284 | Ga0209675_1000888 | 3300025291 | Bacteria | 19234 |
| 285 | Ga0209675_1002091 | 3300025291 | Bacteria | 10603 |
| 286 | Ga0209675_1032745 | 3300025291 | Bacteria | 1213 |
| 287 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 288 | Ga0209676_1000073 | 3300025292 | Bacteria | 305947 |
| 289 | Ga0209676_1000285 | 3300025292 | Bacteria | 104459 |
| 290 | Ga0209676_1000418 | 3300025292 | Bacteria | 75214 |
| 291 | Ga0209676_1001872 | 3300025292 | Bacteria | 17268 |
| 292 | Ga0209676_1003651 | 3300025292 | Bacteria | 9232 |
| 293 | Ga0209676_1003830 | 3300025292 | Bacteria | 8853 |
| 294 | Ga0209676_1043397 | 3300025292 | Bacteria | 1241 |
| 295 | Ga0209676_1057284 | 3300025292 | Bacteria | 988 |
| 296 | Ga0209025_1000531 | 3300025294 | Bacteria | 72578 |
| 297 | Ga0209025_1001378 | 3300025294 | Bacteria | 32585 |
| 298 | Ga0209025_1001659 | 3300025294 | Bacteria | 27402 |
| 299 | Ga0209025_1003871 | 3300025294 | Bacteria | 13550 |
| 300 | Ga0209025_1005820 | 3300025294 | Bacteria | 9877 |
| 301 | Ga0209025_1013190 | 3300025294 | Bacteria | 5217 |
| 302 | Ga0209564_1000270 | 3300025295 | Bacteria | 108503 |
| 303 | Ga0209564_1000817 | 3300025295 | Bacteria | 42412 |
| 304 | Ga0209564_1001646 | 3300025295 | Bacteria | 21553 |
| 305 | Ga0209564_1003481 | 3300025295 | Bacteria | 10728 |
| 306 | Ga0209564_1005469 | 3300025295 | Bacteria | 7240 |
| 307 | Ga0209758_1000064 | 3300025297 | Bacteria | 311812 |
| 308 | Ga0209758_1014110 | 3300025297 | Bacteria | 4283 |
| 309 | Ga0209758_1036488 | 3300025297 | Bacteria | 1917 |
| 310 | Ga0209758_1045022 | 3300025297 | Bacteria | 1606 |
| 311 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 312 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 313 | Ga0209050_1000570 | 3300025298 | Bacteria | 59779 |
| 314 | Ga0209050_1006518 | 3300025298 | Bacteria | 6882 |
| 315 | Ga0209050_1013365 | 3300025298 | Bacteria | 3653 |
| 316 | Ga0209050_1015357 | 3300025298 | Bacteria | 3220 |
| 317 | Ga0209050_1028845 | 3300025298 | Bacteria | 1790 |
| 318 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 319 | Ga0209256_1000096 | 3300025299 | Bacteria | 204629 |
| 320 | Ga0209256_1002874 | 3300025299 | Bacteria | 13081 |
| 321 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 322 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 323 | Ga0207426_1000731 | 3300025302 | Bacteria | 37628 |
| 324 | Ga0207426_1001996 | 3300025302 | Bacteria | 14430 |
| 325 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 326 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 327 | Ga0209051_1000327 | 3300025303 | Bacteria | 71493 |
| 328 | Ga0209051_1000363 | 3300025303 | Bacteria | 66432 |
| 329 | Ga0209051_1000564 | 3300025303 | Bacteria | 45000 |
| 330 | Ga0209051_1008199 | 3300025303 | Bacteria | 5566 |
| 331 | Ga0209051_1050011 | 3300025303 | Bacteria | 1403 |
| 332 | Ga0209051_1097704 | 3300025303 | Bacteria | 798 |
| 333 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 334 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 335 | Ga0209257_1000502 | 3300025304 | Bacteria | 69204 |
| 336 | Ga0209257_1001812 | 3300025304 | Bacteria | 23395 |
| 337 | Ga0209257_1003892 | 3300025304 | Bacteria | 12178 |
| 338 | Ga0209257_1017679 | 3300025304 | Bacteria | 2794 |
| 339 | Ga0207656_10008004 | 3300025321 | Bacteria | 3876 |
| 340 | Ga0207655_1001293 | 3300025728 | Bacteria | 23711 |
| 341 | Ga0207713_1055951 | 3300025735 | Bacteria | 1536 |
| 342 | Ga0207713_1119549 | 3300025735 | Bacteria | 885 |
| 343 | Ga0207688_10183145 | 3300025901 | Bacteria | 1250 |
| 344 | Ga0207645_10014539 | 3300025907 | Bacteria | 5265 |
| 345 | Ga0207643_10049551 | 3300025908 | Bacteria | 2380 |
| 346 | Ga0207705_10387058 | 3300025909 | Unclassified | 1081 |
| 347 | Ga0207695_10466267 | 3300025913 | Bacteria | 1146 |
| 348 | Ga0207695_10529008 | 3300025913 | Bacteria | 1060 |
| 349 | Ga0207671_10189642 | 3300025914 | Bacteria | 1603 |
| 350 | Ga0207671_10309713 | 3300025914 | Bacteria | 1248 |
| 351 | Ga0207693_10889028 | 3300025915 | Bacteria | 684 |
| 352 | Ga0207660_10408169 | 3300025917 | Bacteria | 1094 |
| 353 | Ga0207662_10894968 | 3300025918 | Bacteria | 628 |
| 354 | Ga0207657_10661012 | 3300025919 | Bacteria | 813 |
| 355 | Ga0207646_10601023 | 3300025922 | Bacteria | 987 |
| 356 | Ga0207681_10084034 | 3300025923 | Unclassified | 2255 |
| 357 | Ga0207681_10585547 | 3300025923 | Bacteria | 921 |
| 358 | Ga0207681_10732402 | 3300025923 | Bacteria | 823 |
| 359 | Ga0207694_10074131 | 3300025924 | Bacteria | 2664 |
| 360 | Ga0207694_10117824 | 3300025924 | Bacteria | 2117 |
| 361 | Ga0207694_10793965 | 3300025924 | Bacteria | 800 |
| 362 | Ga0207650_10032850 | 3300025925 | Bacteria | 3756 |
| 363 | Ga0207650_10966352 | 3300025925 | Bacteria | 724 |
| 364 | Ga0207659_10616280 | 3300025926 | Bacteria | 926 |
| 365 | Ga0207706_10017972 | 3300025933 | Bacteria | 6363 |
| 366 | Ga0207706_10158242 | 3300025933 | Bacteria | 1992 |
| 367 | Ga0207706_10192344 | 3300025933 | Bacteria | 1791 |
| 368 | Ga0207706_10421630 | 3300025933 | Bacteria | 1156 |
| 369 | Ga0207709_10000529 | 3300025935 | Bacteria | 33218 |
| 370 | Ga0207709_10000794 | 3300025935 | Bacteria | 24616 |
| 371 | Ga0207709_10024347 | 3300025935 | Bacteria | 3456 |
| 372 | Ga0207709_10539048 | 3300025935 | Bacteria | 916 |
| 373 | Ga0207669_10376295 | 3300025937 | Bacteria | 1105 |
| 374 | Ga0207665_10048106 | 3300025939 | Bacteria | 2861 |
| 375 | Ga0207665_10726703 | 3300025939 | Bacteria | 782 |
| 376 | Ga0207691_10057061 | 3300025940 | Bacteria | 3555 |
| 377 | Ga0207691_11140719 | 3300025940 | Bacteria | 648 |
| 378 | Ga0207689_10052706 | 3300025942 | Bacteria | 3352 |
| 379 | Ga0207661_10065286 | 3300025944 | Bacteria | 2954 |
| 380 | Ga0207661_10479494 | 3300025944 | Bacteria | 1135 |
| 381 | Ga0207679_10021190 | 3300025945 | Bacteria | 4401 |
| 382 | Ga0207679_11296676 | 3300025945 | Bacteria | 668 |
| 383 | Ga0207667_10140730 | 3300025949 | Bacteria | 2484 |
| 384 | Ga0207667_10247807 | 3300025949 | Bacteria | 1822 |
| 385 | Ga0207667_10257275 | 3300025949 | Bacteria | 1785 |
| 386 | Ga0207667_10549779 | 3300025949 | Bacteria | 1168 |
| 387 | Ga0207651_10076997 | 3300025960 | Bacteria | 2386 |
| 388 | Ga0207712_10068259 | 3300025961 | Bacteria | 2547 |
| 389 | Ga0207640_10095653 | 3300025981 | Bacteria | 2069 |
| 390 | Ga0207640_10453467 | 3300025981 | Bacteria | 1057 |
| 391 | Ga0207677_10015431 | 3300026023 | Bacteria | 4493 |
| 392 | Ga0207703_10021875 | 3300026035 | Bacteria | 5008 |
| 393 | Ga0207703_10617247 | 3300026035 | Unclassified | 1027 |
| 394 | Ga0207639_10034610 | 3300026041 | Bacteria | 3734 |
| 395 | Ga0207639_10446685 | 3300026041 | Bacteria | 1173 |
| 396 | Ga0207708_11575272 | 3300026075 | Bacteria | 577 |
| 397 | Ga0207702_10914514 | 3300026078 | Bacteria | 869 |
| 398 | Ga0207641_10022320 | 3300026088 | Bacteria | 5210 |
| 399 | Ga0207648_10011428 | 3300026089 | Bacteria | 8363 |
| 400 | Ga0207648_10222228 | 3300026089 | Bacteria | 1679 |
| 401 | Ga0207676_10171624 | 3300026095 | Bacteria | 1890 |
| 402 | Ga0207674_10046068 | 3300026116 | Bacteria | 4480 |
| 403 | Ga0207674_10735321 | 3300026116 | Bacteria | 952 |
| 404 | Ga0207674_10837649 | 3300026116 | Bacteria | 887 |
| 405 | Ga0207675_100029259 | 3300026118 | Bacteria | 5132 |
| 406 | Ga0207683_10598708 | 3300026121 | Bacteria | 1020 |
| 407 | Ga0207698_10518879 | 3300026142 | Bacteria | 1162 |
| 408 | Ga0209281_1038816 | 3300027111 | Bacteria | 811 |
| 409 | Ga0209179_1001018 | 3300027512 | Bacteria | 3213 |
| 410 | Ga0209282_1000485 | 3300027666 | Bacteria | 19354 |
| 411 | Ga0209282_1001104 | 3300027666 | Bacteria | 14352 |
| 412 | Ga0209971_1005249 | 3300027682 | Bacteria | 3078 |
| 413 | Ga0209974_10024906 | 3300027876 | Bacteria | 1980 |
| 414 | Ga0207428_10000152 | 3300027907 | Bacteria | 94307 |
| 415 | Ga0207428_10406388 | 3300027907 | Bacteria | 996 |
| 416 | Ga0207428_10927907 | 3300027907 | Bacteria | 614 |
| 417 | Ga0268266_10815232 | 3300028379 | Bacteria | 902 |
| 418 | Ga0268265_10067383 | 3300028380 | Unclassified | 2771 |
| 419 | Ga0268265_10178654 | 3300028380 | Bacteria | 1822 |
| 420 | Ga0307517_10052647 | 3300028786 | Bacteria | 4074 |
| 421 | Ga0307517_10333679 | 3300028786 | Bacteria | 832 |
| 422 | Ga0307515_10093141 | 3300028794 | Bacteria | 3740 |
| 423 | Ga0316177_1134579 | 3300030731 | Bacteria | 3860 |
| 424 | Ga0316176_1121982 | 3300030732 | Bacteria | 3563 |
| 425 | Ga0314311_1033639 | 3300030733 | Bacteria | 2014 |
| 426 | Ga0316178_1003154 | 3300030735 | Bacteria | 4530 |
| 427 | Ga0316180_1086033 | 3300030736 | Bacteria | 2071 |
| 428 | Ga0316183_1098709 | 3300030742 | Bacteria | 5705 |
| 429 | Ga0316181_1249780 | 3300030744 | Bacteria | 1214 |
| 430 | Ga0316182_1324443 | 3300030745 | Bacteria | 1593 |
| 431 | Ga0265330_10000014 | 3300031235 | Bacteria | 175673 |
| 432 | Ga0265332_10000011 | 3300031238 | Bacteria | 284299 |
| 433 | Ga0265331_10013364 | 3300031250 | Bacteria | 4418 |
| 434 | Ga0265327_10000027 | 3300031251 | Bacteria | 364541 |
| 435 | Ga0307513_10000256 | 3300031456 | Bacteria | 76296 |
| 436 | Ga0307513_10001864 | 3300031456 | Bacteria | 29946 |
| 437 | Ga0307408_100006292 | 3300031548 | Bacteria | 7881 |
| 438 | Ga0307408_100108899 | 3300031548 | Bacteria | 2124 |
| 439 | Ga0307408_100605224 | 3300031548 | Bacteria | 974 |
| 440 | Ga0307408_101193668 | 3300031548 | Bacteria | 709 |
| 441 | Ga0307408_101245130 | 3300031548 | Bacteria | 695 |
| 442 | Ga0307514_10027922 | 3300031649 | Bacteria | 4556 |
| 443 | Ga0307514_10067278 | 3300031649 | Bacteria | 2704 |
| 444 | Ga0265314_10000026 | 3300031711 | Bacteria | 284299 |
| 445 | Ga0307516_10187548 | 3300031730 | Bacteria | 1797 |
| 446 | Ga0307405_10083374 | 3300031731 | Bacteria | 2095 |
| 447 | Ga0307405_10177300 | 3300031731 | Bacteria | 1526 |
| 448 | Ga0307405_10334692 | 3300031731 | Bacteria | 1161 |
| 449 | Ga0307405_11473646 | 3300031731 | Bacteria | 597 |
| 450 | Ga0307413_10132383 | 3300031824 | Bacteria | 1709 |
| 451 | Ga0307406_10010740 | 3300031901 | Bacteria | 5174 |
| 452 | Ga0307406_10030715 | 3300031901 | Bacteria | 3264 |
| 453 | Ga0307412_10008603 | 3300031911 | Bacteria | 5833 |
| 454 | Ga0307412_10118809 | 3300031911 | Bacteria | 1900 |
| 455 | Ga0307412_10166553 | 3300031911 | Bacteria | 1643 |
| 456 | Ga0307412_10253645 | 3300031911 | Bacteria | 1367 |
| 457 | Ga0307412_10348713 | 3300031911 | Bacteria | 1188 |
| 458 | Ga0307412_11214830 | 3300031911 | Bacteria | 675 |
| 459 | Ga0307412_11495132 | 3300031911 | Bacteria | 614 |
| 460 | Ga0307409_100437721 | 3300031995 | Bacteria | 1259 |
| 461 | Ga0307409_100474480 | 3300031995 | Bacteria | 1212 |
| 462 | Ga0307416_100017223 | 3300032002 | Bacteria | 5048 |
| 463 | Ga0307416_100104627 | 3300032002 | Bacteria | 2475 |
| 464 | Ga0307416_100108755 | 3300032002 | Bacteria | 2437 |
| 465 | Ga0307416_100539735 | 3300032002 | Bacteria | 1238 |
| 466 | Ga0307416_101660968 | 3300032002 | Bacteria | 744 |
| 467 | Ga0307414_10027853 | 3300032004 | Bacteria | 3657 |
| 468 | Ga0307414_11175424 | 3300032004 | Bacteria | 710 |
| 469 | Ga0307411_10011105 | 3300032005 | Bacteria | 4840 |
| 470 | Ga0307411_10056918 | 3300032005 | Bacteria | 2580 |
| 471 | Ga0307411_10198553 | 3300032005 | Bacteria | 1538 |
| 472 | Ga0436365_0851258 | 3300039437 | Bacteria | 8268 |
| 473 | Ga0436363_0688494 | 3300039450 | Bacteria | 3520 |
| 474 | Ga0439465_0067288 | 3300041413 | Bacteria | 1195 |
| 475 | Ga0451789_1328374 | 3300041443 | Bacteria | 1240 |
| 476 | Ga0451793_0253438 | 3300041452 | Bacteria | 1813 |
| 477 | Ga0451793_0518933 | 3300041452 | Bacteria | 1110 |
| 478 | Ga0451800_0093157 | 3300041459 | Bacteria | 1280 |
| 479 | Ga0451807_1087274 | 3300041486 | Bacteria | 1060 |
| 480 | Ga0451807_2468035 | 3300041486 | Bacteria | 1171 |
| 481 | Ga0451853_0087738 | 3300041512 | Bacteria | 1140 |
| 482 | Ga0451853_1360737 | 3300041512 | Bacteria | 885 |
| 483 | Ga0439445_0013272 | 3300042004 | Bacteria | 1993 |
| 484 | Ga0439456_105095 | 3300042013 | Bacteria | 641 |
| 485 | Ga0450923_024679 | 3300042125 | Bacteria | 1194 |
| 486 | Ga0450906_047766 | 3300042145 | Bacteria | 755 |
| 487 | Ga0450910_030375 | 3300042147 | Bacteria | 847 |
| 488 | Ga0439446_0044737 | 3300042156 | Bacteria | 1311 |
| 489 | Ga0450908_000847 | 3300042184 | Bacteria | 5898 |
| 490 | Ga0439435_0328648 | 3300042436 | Bacteria | 528 |
| 491 | Ga0450918_001787 | 3300042531 | Bacteria | 4192 |
| 492 | Ga0453683_0968597 | 3300044673 | Bacteria | 564 |
| 493 | Ga0466965_0050921 | 3300044683 | Bacteria | 2054 |
| 494 | Ga0466959_0003718 | 3300045049 | Bacteria | 10076 |
| 495 | Ga0495627_054274 | 3300046453 | Bacteria | 1198 |
| 496 | Ga0495638_0024154 | 3300046460 | Bacteria | 3967 |
| 497 | Ga0495580_0136857 | 3300046472 | Bacteria | 1698 |
| 498 | Ga0495582_0441599 | 3300046473 | Bacteria | 751 |
| 499 | Ga0495605_0080587 | 3300046474 | Bacteria | 1523 |
| 500 | Ga0495584_0102625 | 3300046491 | Bacteria | 1446 |
| 501 | Ga0495594_0197728 | 3300046499 | Bacteria | 1146 |
| 502 | Ga0495596_0007565 | 3300046500 | Bacteria | 4895 |
| 503 | Ga0495607_0016279 | 3300046501 | Bacteria | 4801 |
| 504 | Ga0495606_0140150 | 3300046507 | Bacteria | 1429 |
| 505 | Ga0495610_0013283 | 3300046512 | Bacteria | 4900 |
| 506 | Ga0495616_0002711 | 3300046513 | Bacteria | 11601 |
| 507 | Ga0495616_0011172 | 3300046513 | Bacteria | 5155 |
| 508 | Ga0495620_0061517 | 3300046515 | Bacteria | 1562 |
| 509 | Ga0495620_0135363 | 3300046515 | Bacteria | 965 |
| 510 | Ga0495620_0163329 | 3300046515 | Bacteria | 865 |
| 511 | Ga0495631_0009101 | 3300046518 | Bacteria | 4973 |
| 512 | Ga0495637_0076686 | 3300046520 | Bacteria | 1339 |
| 513 | Ga0495648_0055299 | 3300046524 | Bacteria | 2393 |
| 514 | Ga0495666_0065402 | 3300046526 | Bacteria | 1734 |
| 515 | Ga0495642_0385180 | 3300046528 | Bacteria | 618 |
| 516 | Ga0495654_0006805 | 3300046530 | Bacteria | 6455 |
| 517 | Ga0495609_0008892 | 3300046538 | Bacteria | 4887 |
| 518 | Ga0495621_0069346 | 3300046539 | Bacteria | 1295 |
| 519 | Ga0495597_0027982 | 3300046542 | Bacteria | 2582 |
| 520 | Ga0495597_0213681 | 3300046542 | Bacteria | 768 |
| 521 | Ga0495656_0018259 | 3300046615 | Bacteria | 2690 |
| 522 | Ga0495611_0058799 | 3300046648 | Bacteria | 1744 |
| 523 | Ga0495625_0001291 | 3300046660 | Bacteria | 31462 |
| 524 | Ga0495625_0029783 | 3300046660 | Bacteria | 4079 |
| 525 | Ga0495625_0145774 | 3300046660 | Bacteria | 1594 |
| 526 | Ga0495625_0174108 | 3300046660 | Bacteria | 1435 |
| 527 | Ga0495661_0047949 | 3300046665 | Bacteria | 2598 |
| 528 | Ga0495588_0019339 | 3300046674 | Bacteria | 3335 |
| 529 | Ga0495588_0119983 | 3300046674 | Bacteria | 1386 |
| 530 | Ga0495588_0158083 | 3300046674 | Bacteria | 1198 |
| 531 | Ga0495588_0174565 | 3300046674 | Bacteria | 1136 |
| 532 | Ga0495658_0009172 | 3300046683 | Bacteria | 4919 |
| 533 | Ga0495669_0056376 | 3300046684 | Bacteria | 1771 |
| 534 | Ga0495624_0311035 | 3300046690 | Bacteria | 949 |
| 535 | Ga0495670_0042837 | 3300046691 | Bacteria | 2259 |
| 536 | Ga0495671_0002240 | 3300046692 | Bacteria | 12292 |
| 537 | Ga0495671_0010757 | 3300046692 | Bacteria | 5058 |
| 538 | Ga0495649_0036620 | 3300046694 | Bacteria | 2695 |
| 539 | Ga0495589_0041347 | 3300046794 | Bacteria | 2301 |
| 540 | Ga0495660_0060417 | 3300046810 | Bacteria | 2036 |
| 541 | Ga0495636_0004542 | 3300047318 | Bacteria | 5440 |
| 542 | Ga0495672_0017607 | 3300047320 | Bacteria | 4776 |
| 543 | Ga0495676_0026837 | 3300047321 | Bacteria | 4949 |
| 544 | Ga0495681_0261790 | 3300047470 | Bacteria | 680 |
| 545 | Ga0495593_0194653 | 3300047673 | Bacteria | 1019 |
| 546 | Ga0495614_0013915 | 3300048089 | Bacteria | 3526 |
| 547 | Ga0495615_0212751 | 3300048090 | Bacteria | 601 |
| 548 | Ga0496101_0019042 | 3300048904 | Bacteria | 4677 |
| 549 | Ga0496102_1012620 | 3300048905 | Bacteria | 751 |
| 550 | Ga0496106_0840096 | 3300048909 | Bacteria | 727 |
| 551 | Ga0496108_0564510 | 3300048911 | Bacteria | 992 |
| 552 | Ga0496110_1239158 | 3300048913 | Bacteria | 655 |
| 553 | Ga0496111_0094160 | 3300048914 | Unclassified | 2197 |
| 554 | Ga0496112_0255566 | 3300048915 | Bacteria | 1702 |
| 555 | Ga0496116_0013551 | 3300048919 | Bacteria | 6562 |
| 556 | Ga0496116_0044869 | 3300048919 | Bacteria | 2997 |
| 557 | Ga0496116_0085004 | 3300048919 | Bacteria | 1946 |
| 558 | Ga0496116_0304018 | 3300048919 | Bacteria | 757 |
| 559 | Ga0496117_0018544 | 3300048920 | Bacteria | 5757 |
| 560 | Ga0496117_0036460 | 3300048920 | Bacteria | 3679 |
| 561 | Ga0496118_0103225 | 3300048921 | Bacteria | 1918 |
| 562 | Ga0496119_0165653 | 3300048922 | Bacteria | 1171 |
| 563 | Ga0496121_0028066 | 3300048924 | Bacteria | 5248 |
| 564 | Ga0496121_0064366 | 3300048924 | Bacteria | 2990 |
| 565 | Ga0496121_0091533 | 3300048924 | Bacteria | 2374 |
| 566 | Ga0496121_0276714 | 3300048924 | Bacteria | 1150 |
| 567 | Ga0496122_0059980 | 3300048925 | Bacteria | 2805 |
| 568 | Ga0496122_0068659 | 3300048925 | Bacteria | 2543 |
| 569 | Ga0496122_0086028 | 3300048925 | Bacteria | 2166 |
| 570 | Ga0496122_0300964 | 3300048925 | Bacteria | 865 |
| 571 | Ga0496123_0020792 | 3300048926 | Bacteria | 5122 |
| 572 | Ga0496123_0030622 | 3300048926 | Bacteria | 3936 |
| 573 | Ga0496123_0041787 | 3300048926 | Bacteria | 3173 |
| 574 | Ga0496123_0044060 | 3300048926 | Bacteria | 3055 |
| 575 | Ga0496123_0190109 | 3300048926 | Bacteria | 1063 |
| 576 | Ga0496124_0008899 | 3300048927 | Bacteria | 10412 |
| 577 | Ga0496124_0025510 | 3300048927 | Bacteria | 5353 |
| 578 | Ga0496125_0037422 | 3300048928 | Bacteria | 4219 |
| 579 | Ga0496125_0054440 | 3300048928 | Bacteria | 3269 |
| 580 | Ga0496125_0104312 | 3300048928 | Bacteria | 2077 |
| 581 | Ga0496125_0164985 | 3300048928 | Bacteria | 1498 |
| 582 | Ga0496125_0235485 | 3300048928 | Bacteria | 1167 |
| 583 | Ga0496126_0487552 | 3300048929 | Bacteria | 987 |
| 584 | Ga0495678_158516 | 3300049459 | Bacteria | 725 |
| 585 | Ga0501037_0038947 | 3300049573 | Bacteria | 3501 |
| 586 | Ga0501249_000867 | 3300049679 | Bacteria | 6684 |
| 587 | Ga0501257_119607 | 3300049686 | Bacteria | 704 |
| 588 | Ga0501225_0019327 | 3300049705 | Bacteria | 1886 |
| 589 | Ga0501262_000093 | 3300049759 | Bacteria | 11090 |
| 590 | Ga0501035_0578099 | 3300049822 | Bacteria | 918 |
| 591 | nmdc:mga03683_22005_c1 | 3300050489 | Bacteria | 2466 |
| 592 | nmdc:mga03683_313736_c1 | 3300050489 | Bacteria | 737 |
| 593 | nmdc:mga03683_56351_c1 | 3300050489 | Bacteria | 1652 |
| 594 | nmdc:mga03n38_20693_c1 | 3300050490 | Bacteria | 2637 |
| 595 | nmdc:mga03n38_318906_c1 | 3300050490 | Bacteria | 839 |
| 596 | nmdc:mga03n38_45643_c1 | 3300050490 | Bacteria | 1930 |
| 597 | nmdc:mga00v17_10064_c1 | 3300050491 | Bacteria | 5149 |
| 598 | nmdc:mga00v17_246763_c1 | 3300050491 | Bacteria | 1158 |
| 599 | nmdc:mga00v17_80922_c1 | 3300050491 | Bacteria | 2028 |
| 600 | nmdc:mga0yw44_13446_c1 | 3300050492 | Bacteria | 4311 |
| 601 | nmdc:mga0yw44_899936_c1 | 3300050492 | Bacteria | 600 |
| 602 | nmdc:mga0k408_157450_c1 | 3300050493 | Bacteria | 1353 |
| 603 | nmdc:mga0k408_186712_c1 | 3300050493 | Bacteria | 1236 |
| 604 | nmdc:mga0k408_7234_c1 | 3300050493 | Bacteria | 5932 |
| 605 | nmdc:mga07m45_375981_c1 | 3300050496 | Bacteria | 825 |
| 606 | nmdc:mga07m45_389937_c1 | 3300050496 | Bacteria | 808 |
| 607 | nmdc:mga07m45_4118_c1 | 3300050496 | Bacteria | 7097 |
| 608 | nmdc:mga07m45_8950_c1 | 3300050496 | Bacteria | 5170 |
| 609 | nmdc:mga07m45_9938_c1 | 3300050496 | Bacteria | 4952 |
| 610 | nmdc:mga05p37_321327_c1 | 3300050507 | Bacteria | 1832 |
| 611 | nmdc:mga05p37_347711_c2 | 3300050507 | Bacteria | 1345 |
| 612 | nmdc:mga05p37_918535_c1 | 3300050507 | Bacteria | 941 |
| 613 | nmdc:mga06r32_1194049_c1 | 3300050510 | Bacteria | 707 |
| 614 | nmdc:mga06r32_1361325_c1 | 3300050510 | Bacteria | 652 |
| 615 | nmdc:mga08y16_474866_c1 | 3300050511 | Bacteria | 1273 |
| 616 | nmdc:mga08y16_54_c1 | 3300050511 | Bacteria | 102957 |
| 617 | nmdc:mga0n895_167478_c1 | 3300050512 | Bacteria | 2229 |
| 618 | nmdc:mga08x19_64770_c1 | 3300050514 | Bacteria | 2373 |
| 619 | nmdc:mga0a205_530846_c1 | 3300050515 | Bacteria | 1033 |
| 620 | nmdc:mga0sz30_179802_c1 | 3300050516 | Bacteria | 938 |
| 621 | Ga0500610_0001085 | 3300053079 | Bacteria | 8937 |
| 622 | Ga0500610_0001382 | 3300053079 | Bacteria | 8228 |
| 623 | Ga0500643_002259 | 3300053087 | Bacteria | 10132 |
| 624 | Ga0500644_0008163 | 3300053088 | Bacteria | 2755 |
| 625 | Ga0500647_0235253 | 3300053091 | Bacteria | 813 |
| 626 | Ga0500651_0000263 | 3300053093 | Bacteria | 31317 |
| 627 | Ga0500566_0013376 | 3300053094 | Bacteria | 4833 |
| 628 | Ga0500566_0164633 | 3300053094 | Bacteria | 1152 |
| 629 | Ga0500650_0085302 | 3300053098 | Bacteria | 1478 |
| 630 | Ga0500560_018400 | 3300053107 | Bacteria | 1947 |
| 631 | Ga0500571_000529 | 3300053110 | Bacteria | 15703 |
| 632 | Ga0500593_000756 | 3300053117 | Bacteria | 12138 |
| 633 | Ga0500593_001588 | 3300053117 | Bacteria | 8179 |
| 634 | Ga0500594_0000967 | 3300053118 | Bacteria | 6176 |
| 635 | Ga0500597_031758 | 3300053120 | Bacteria | 2177 |
| 636 | Ga0500607_001975 | 3300053121 | Bacteria | 17413 |
| 637 | Ga0500607_094037 | 3300053121 | Bacteria | 1502 |
| 638 | Ga0500614_151984 | 3300053123 | Bacteria | 697 |
| 639 | Ga0500626_162313 | 3300053128 | Bacteria | 917 |
| 640 | Ga0500655_000174 | 3300053133 | Bacteria | 15748 |
| 641 | Ga0500658_0000517 | 3300053134 | Bacteria | 16395 |
| 642 | Ga0500658_0000583 | 3300053134 | Bacteria | 15377 |
| 643 | Ga0500559_0002747 | 3300053136 | Bacteria | 8928 |
| 644 | Ga0500561_0049622 | 3300053137 | Bacteria | 1140 |
| 645 | Ga0500564_025460 | 3300053138 | Bacteria | 2717 |
| 646 | Ga0500568_0001222 | 3300053139 | Bacteria | 17151 |
| 647 | Ga0500574_002592 | 3300053141 | Bacteria | 3010 |
| 648 | Ga0500619_195616 | 3300053154 | Bacteria | 680 |
| 649 | Ga0500620_249953 | 3300053155 | Bacteria | 590 |
| 650 | Ga0500627_0005114 | 3300053158 | Bacteria | 4312 |
| 651 | Ga0500634_0015120 | 3300053161 | Bacteria | 4091 |
| 652 | Ga0500634_0015329 | 3300053161 | Bacteria | 4068 |
| 653 | Ga0500638_008052 | 3300053162 | Bacteria | 4466 |
| 654 | Ga0500636_0308497 | 3300053177 | Bacteria | 775 |
| 655 | Ga0500625_098473 | 3300053729 | Bacteria | 1232 |
| 656 | Ga0500645_002194 | 3300053730 | Bacteria | 8924 |
| 657 | Ga0500645_003711 | 3300053730 | Bacteria | 6086 |
| 658 | Ga0500645_009996 | 3300053730 | Bacteria | 3160 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042436 | Ga0439435_0328648 | Ga0439435_0328648_114_509 | 131 |
| 2 | 3300006173 | Ga0070716_100527196 | Ga0070716_1005271962 | 137 |
| 3 | 3300007265 | Ga0099794_10032045 | Ga0099794_100320452 | 137 |
| 4 | 3300010159 | Ga0099796_10132212 | Ga0099796_101322122 | 137 |
| 5 | 3300025939 | Ga0207665_10726703 | Ga0207665_107267032 | 137 |
| 6 | 3300026075 | Ga0207708_11575272 | Ga0207708_115752722 | 137 |
| 7 | 3300047318 | Ga0495636_0004542 | Ga0495636_0004542_2289_2702 | 137 |
| 8 | 3300050514 | nmdc:mga08x19_64770_c1 | nmdc:mga08x19_64770_c1_1277_1690 | 137 |
| 9 | 3300041486 | Ga0451807_1087274 | Ga0451807_1087274_25_465 | 144 |
| 10 | 3300053161 | Ga0500634_0015329 | Ga0500634_0015329_293_817 | 148 |
| 11 | 3300005535 | Ga0070684_100202075 | Ga0070684_1002020752 | 149 |
| 12 | 3300048090 | Ga0495615_0212751 | Ga0495615_0212751_104_553 | 149 |
| 13 | iso_pu_bacteria | 2513020051 | 2513231023 | 149 |
| 14 | iso_pu_bacteria | 2643221658 | 2644328037 | 149 |
| 15 | iso_pu_bacteria | 2643221672 | 2644398656 | 149 |
| 16 | iso_pu_bacteria | 2599185214 | 2599624468 | 150 |
| 17 | iso_pu_bacteria | 2599185226 | 2599672670 | 150 |
| 18 | iso_pu_bacteria | 2599185227 | 2599683670 | 150 |
| 19 | iso_pu_bacteria | 2599185229 | 2599694279 | 150 |
| 20 | iso_pu_bacteria | 2643221683 | 2644468548 | 150 |
| 21 | iso_pu_bacteria | 2738541307 | 2738881771 | 150 |
| 22 | iso_pu_bacteria | 2818991446 | 2819595882 | 150 |
| 23 | iso_pu_bacteria | 2831265667 | 2831266969 | 150 |
| 24 | iso_pu_bacteria | 2885198086 | 2885198973 | 150 |
| 25 | iso_pu_bacteria | 2885211737 | 2885212764 | 150 |
| 26 | iso_pu_bacteria | 2899924645 | 2899925230 | 150 |
| 27 | iso_pu_bacteria | 2928037797 | 2928038647 | 150 |
| 28 | iso_pu_bacteria | 2928044640 | 2928045748 | 150 |
| 29 | iso_pu_bacteria | 2928051484 | 2928053365 | 150 |
| 30 | iso_pu_bacteria | 2928064002 | 2928066970 | 150 |
| 31 | iso_pu_bacteria | 2928070936 | 2928071132 | 150 |
| 32 | iso_pu_bacteria | 2928084124 | 2928084924 | 150 |
| 33 | 3300003323 | rootH1_10403597 | rootH1_104035972 | 151 |
| 34 | 3300005468 | Ga0070707_100507861 | Ga0070707_1005078612 | 151 |
| 35 | 3300005518 | Ga0070699_100382334 | Ga0070699_1003823342 | 151 |
| 36 | 3300005563 | Ga0068855_100018937 | Ga0068855_1000189371 | 151 |
| 37 | 3300006173 | Ga0070716_100009970 | Ga0070716_1000099704 | 151 |
| 38 | 3300006914 | Ga0075436_100008852 | Ga0075436_1000088522 | 151 |
| 39 | 3300007788 | Ga0099795_10068661 | Ga0099795_100686612 | 151 |
| 40 | 3300010159 | Ga0099796_10060262 | Ga0099796_100602622 | 151 |
| 41 | 3300025909 | Ga0207705_10387058 | Ga0207705_103870581 | 151 |
| 42 | 3300025922 | Ga0207646_10601023 | Ga0207646_106010232 | 151 |
| 43 | 3300025939 | Ga0207665_10048106 | Ga0207665_100481062 | 151 |
| 44 | 3300025949 | Ga0207667_10257275 | Ga0207667_102572751 | 151 |
| 45 | 3300027512 | Ga0209179_1001018 | Ga0209179_10010183 | 151 |
| 46 | iso_pu_bacteria | 2791355260 | 2793324348 | 151 |
| 47 | iso_pu_bacteria | 2838022645 | 2838025396 | 151 |
| 48 | iso_pu_bacteria | 2842198810 | 2842200964 | 151 |
| 49 | iso_pu_bacteria | 2842677519 | 2842678834 | 151 |
| 50 | iso_pu_bacteria | 2919462493 | 2919465885 | 151 |
| 51 | 3300003323 | rootH1_10276335 | rootH1_102763352 | 152 |
| 52 | 3300005548 | Ga0070665_100663247 | Ga0070665_1006632472 | 152 |
| 53 | 3300005842 | Ga0068858_100017427 | Ga0068858_1000174274 | 152 |
| 54 | 3300026035 | Ga0207703_10021875 | Ga0207703_100218754 | 152 |
| 55 | iso_pu_bacteria | 2765235841 | 2765583753 | 152 |
| 56 | iso_pu_bacteria | 2945909444 | 2945912389 | 152 |
| 57 | iso_pu_bacteria | 2945984333 | 2945985297 | 152 |
| 58 | iso_pu_bacteria | 8054929484 | 8054931465 | 152 |
| 59 | 3300003781 | Ga0055536_1020823 | Ga0055536_10208232 | 153 |
| 60 | 3300003791 | Ga0055530_10026962 | Ga0055530_100269623 | 153 |
| 61 | 3300003792 | Ga0055540_1001514 | Ga0055540_10015148 | 153 |
| 62 | 3300003794 | Ga0055531_10002080 | Ga0055531_100020808 | 153 |
| 63 | 3300005331 | Ga0070670_100473472 | Ga0070670_1004734722 | 153 |
| 64 | 3300005335 | Ga0070666_10223264 | Ga0070666_102232642 | 153 |
| 65 | 3300005354 | Ga0070675_100488999 | Ga0070675_1004889992 | 153 |
| 66 | 3300005356 | Ga0070674_100153148 | Ga0070674_1001531482 | 153 |
| 67 | 3300005440 | Ga0070705_100246218 | Ga0070705_1002462182 | 153 |
| 68 | 3300005444 | Ga0070694_100319664 | Ga0070694_1003196641 | 153 |
| 69 | 3300005457 | Ga0070662_100638014 | Ga0070662_1006380142 | 153 |
| 70 | 3300005546 | Ga0070696_100192760 | Ga0070696_1001927602 | 153 |
| 71 | 3300005549 | Ga0070704_100198713 | Ga0070704_1001987133 | 153 |
| 72 | 3300005564 | Ga0070664_100016355 | Ga0070664_1000163557 | 153 |
| 73 | 3300005577 | Ga0068857_100100359 | Ga0068857_1001003593 | 153 |
| 74 | 3300006237 | Ga0097621_100881238 | Ga0097621_1008812382 | 153 |
| 75 | 3300006353 | Ga0075370_10003966 | Ga0075370_100039665 | 153 |
| 76 | 3300009036 | Ga0105244_10001326 | Ga0105244_1000132611 | 153 |
| 77 | 3300009148 | Ga0105243_10001807 | Ga0105243_100018075 | 153 |
| 78 | 3300009176 | Ga0105242_10691897 | Ga0105242_106918971 | 153 |
| 79 | 3300009545 | Ga0105237_10512134 | Ga0105237_105121342 | 153 |
| 80 | 3300011119 | Ga0105246_10010302 | Ga0105246_100103022 | 153 |
| 81 | 3300014326 | Ga0157380_10828388 | Ga0157380_108283881 | 153 |
| 82 | 3300014497 | Ga0182008_10004833 | Ga0182008_100048336 | 153 |
| 83 | 3300015261 | Ga0182006_1001517 | Ga0182006_10015175 | 153 |
| 84 | 3300015262 | Ga0182007_10001159 | Ga0182007_100011595 | 153 |
| 85 | 3300025292 | Ga0209676_1001872 | Ga0209676_10018725 | 153 |
| 86 | 3300025298 | Ga0209050_1000570 | Ga0209050_100057053 | 153 |
| 87 | 3300025303 | Ga0209051_1000564 | Ga0209051_100056440 | 153 |
| 88 | 3300025304 | Ga0209257_1000502 | Ga0209257_100050256 | 153 |
| 89 | 3300025728 | Ga0207655_1001293 | Ga0207655_100129315 | 153 |
| 90 | 3300025901 | Ga0207688_10183145 | Ga0207688_101831451 | 153 |
| 91 | 3300025923 | Ga0207681_10585547 | Ga0207681_105855471 | 153 |
| 92 | 3300025924 | Ga0207694_10074131 | Ga0207694_100741312 | 153 |
| 93 | 3300025926 | Ga0207659_10616280 | Ga0207659_106162802 | 153 |
| 94 | 3300025933 | Ga0207706_10017972 | Ga0207706_100179727 | 153 |
| 95 | 3300025933 | Ga0207706_10421630 | Ga0207706_104216302 | 153 |
| 96 | 3300025935 | Ga0207709_10000794 | Ga0207709_1000079414 | 153 |
| 97 | 3300025940 | Ga0207691_11140719 | Ga0207691_111407192 | 153 |
| 98 | 3300025945 | Ga0207679_10021190 | Ga0207679_100211905 | 153 |
| 99 | 3300025949 | Ga0207667_10549779 | Ga0207667_105497792 | 153 |
| 100 | 3300026116 | Ga0207674_10046068 | Ga0207674_100460682 | 153 |
| 101 | 3300032002 | Ga0307416_101660968 | Ga0307416_1016609681 | 153 |
| 102 | 3300048905 | Ga0496102_1012620 | Ga0496102_1012620_109_570 | 153 |
| 103 | 3300048913 | Ga0496110_1239158 | Ga0496110_1239158_97_558 | 153 |
| 104 | 3300048919 | Ga0496116_0013551 | Ga0496116_0013551_4089_4550 | 153 |
| 105 | 3300048920 | Ga0496117_0036460 | Ga0496117_0036460_1221_1682 | 153 |
| 106 | 3300048921 | Ga0496118_0103225 | Ga0496118_0103225_130_591 | 153 |
| 107 | 3300048924 | Ga0496121_0091533 | Ga0496121_0091533_463_924 | 153 |
| 108 | 3300048928 | Ga0496125_0164985 | Ga0496125_0164985_172_633 | 153 |
| 109 | 3300050490 | nmdc:mga03n38_45643_c1 | nmdc:mga03n38_45643_c1_512_973 | 153 |
| 110 | 3300050496 | nmdc:mga07m45_8950_c1 | nmdc:mga07m45_8950_c1_619_1080 | 153 |
| 111 | iso_pu_bacteria | 2511231002 | 2511246299 | 153 |
| 112 | iso_pu_bacteria | 2513237150 | 2513957013 | 153 |
| 113 | iso_pu_bacteria | 2513237165 | 2514043175 | 153 |
| 114 | iso_pu_bacteria | 2738541277 | 2738720231 | 153 |
| 115 | iso_pu_bacteria | 2738543019 | 2739279430 | 153 |
| 116 | iso_pu_bacteria | 644736347 | 644749404 | 153 |
| 117 | 3300002773 | JGI25152J39213_1001121 | JGI25152J39213_10011214 | 154 |
| 118 | 3300002773 | JGI25152J39213_1004181 | JGI25152J39213_10041816 | 154 |
| 119 | 3300002774 | JGI25150J39212_1000556 | JGI25150J39212_10005564 | 154 |
| 120 | 3300002774 | JGI25150J39212_1010834 | JGI25150J39212_10108342 | 154 |
| 121 | 3300002987 | JGI25159J45721_1004621 | JGI25159J45721_10046214 | 154 |
| 122 | 3300003187 | JGI25151J46595_10009784 | JGI25151J46595_100097844 | 154 |
| 123 | 3300003187 | JGI25151J46595_10034889 | JGI25151J46595_100348892 | 154 |
| 124 | 3300003215 | JGI25153J46596_10009924 | JGI25153J46596_100099243 | 154 |
| 125 | 3300003215 | JGI25153J46596_10028831 | JGI25153J46596_100288312 | 154 |
| 126 | 3300003316 | rootH1_10045273 | rootH1_100452735 | 154 |
| 127 | 3300003320 | rootH2_10070709 | rootH2_100707096 | 154 |
| 128 | 3300003322 | rootL2_10069764 | rootL2_100697642 | 154 |
| 129 | 3300003323 | rootH1_10057228 | rootH1_100572283 | 154 |
| 130 | 3300003354 | JGI25160J50197_1006922 | JGI25160J50197_10069224 | 154 |
| 131 | 3300003354 | JGI25160J50197_1010866 | JGI25160J50197_10108663 | 154 |
| 132 | 3300003374 | JGI25161J50226_1002668 | JGI25161J50226_10026683 | 154 |
| 133 | 3300003374 | JGI25161J50226_1002758 | JGI25161J50226_10027584 | 154 |
| 134 | 3300003761 | Ga0055535_1000507 | Ga0055535_100050714 | 154 |
| 135 | 3300003762 | Ga0055542_1000004 | Ga0055542_100000489 | 154 |
| 136 | 3300003771 | Ga0055526_1010324 | Ga0055526_10103243 | 154 |
| 137 | 3300003771 | Ga0055526_1031110 | Ga0055526_10311102 | 154 |
| 138 | 3300003773 | Ga0055537_1003982 | Ga0055537_10039823 | 154 |
| 139 | 3300003773 | Ga0055537_1013497 | Ga0055537_10134972 | 154 |
| 140 | 3300003775 | Ga0055524_1008191 | Ga0055524_10081913 | 154 |
| 141 | 3300003775 | Ga0055524_1008253 | Ga0055524_10082533 | 154 |
| 142 | 3300003781 | Ga0055536_1004573 | Ga0055536_10045733 | 154 |
| 143 | 3300003781 | Ga0055536_1021460 | Ga0055536_10214603 | 154 |
| 144 | 3300003784 | Ga0055534_1004074 | Ga0055534_10040743 | 154 |
| 145 | 3300003784 | Ga0055534_1019110 | Ga0055534_10191102 | 154 |
| 146 | 3300003790 | Ga0055528_1008560 | Ga0055528_10085603 | 154 |
| 147 | 3300003790 | Ga0055528_1028650 | Ga0055528_10286502 | 154 |
| 148 | 3300003790 | Ga0055528_1028651 | Ga0055528_10286512 | 154 |
| 149 | 3300003791 | Ga0055530_10000547 | Ga0055530_100005476 | 154 |
| 150 | 3300003792 | Ga0055540_1002602 | Ga0055540_10026026 | 154 |
| 151 | 3300003792 | Ga0055540_1007972 | Ga0055540_10079722 | 154 |
| 152 | 3300003792 | Ga0055540_1028387 | Ga0055540_10283872 | 154 |
| 153 | 3300003794 | Ga0055531_10002810 | Ga0055531_100028106 | 154 |
| 154 | 3300003794 | Ga0055531_10007878 | Ga0055531_100078786 | 154 |
| 155 | 3300004625 | Ga0055543_1003692 | Ga0055543_10036924 | 154 |
| 156 | 3300004625 | Ga0055543_1005079 | Ga0055543_10050793 | 154 |
| 157 | 3300005262 | Ga0065165_1009376 | Ga0065165_10093764 | 154 |
| 158 | 3300005328 | Ga0070676_10394333 | Ga0070676_103943332 | 154 |
| 159 | 3300005337 | Ga0070682_101912147 | Ga0070682_1019121471 | 154 |
| 160 | 3300005457 | Ga0070662_100763038 | Ga0070662_1007630382 | 154 |
| 161 | 3300005539 | Ga0068853_100021089 | Ga0068853_1000210895 | 154 |
| 162 | 3300005539 | Ga0068853_100462693 | Ga0068853_1004626932 | 154 |
| 163 | 3300005548 | Ga0070665_101016357 | Ga0070665_1010163572 | 154 |
| 164 | 3300005548 | Ga0070665_101074337 | Ga0070665_1010743371 | 154 |
| 165 | 3300005563 | Ga0068855_100065866 | Ga0068855_1000658663 | 154 |
| 166 | 3300005564 | Ga0070664_100883057 | Ga0070664_1008830572 | 154 |
| 167 | 3300005577 | Ga0068857_100269725 | Ga0068857_1002697252 | 154 |
| 168 | 3300005578 | Ga0068854_100167245 | Ga0068854_1001672452 | 154 |
| 169 | 3300005616 | Ga0068852_100289453 | Ga0068852_1002894532 | 154 |
| 170 | 3300005834 | Ga0068851_10003627 | Ga0068851_100036273 | 154 |
| 171 | 3300006051 | Ga0075364_10688418 | Ga0075364_106884181 | 154 |
| 172 | 3300009093 | Ga0105240_11410390 | Ga0105240_114103902 | 154 |
| 173 | 3300009148 | Ga0105243_10000802 | Ga0105243_1000080227 | 154 |
| 174 | 3300009545 | Ga0105237_10434576 | Ga0105237_104345763 | 154 |
| 175 | 3300010375 | Ga0105239_10051418 | Ga0105239_100514186 | 154 |
| 176 | 3300010375 | Ga0105239_10064586 | Ga0105239_100645864 | 154 |
| 177 | 3300010375 | Ga0105239_10828218 | Ga0105239_108282182 | 154 |
| 178 | 3300010375 | Ga0105239_11914033 | Ga0105239_119140331 | 154 |
| 179 | 3300013100 | Ga0157373_10204319 | Ga0157373_102043192 | 154 |
| 180 | 3300013102 | Ga0157371_10549497 | Ga0157371_105494971 | 154 |
| 181 | 3300013104 | Ga0157370_10353125 | Ga0157370_103531252 | 154 |
| 182 | 3300013105 | Ga0157369_10017003 | Ga0157369_100170037 | 154 |
| 183 | 3300017792 | Ga0163161_10017313 | Ga0163161_100173135 | 154 |
| 184 | 3300025208 | Ga0209436_104400 | Ga0209436_1044003 | 154 |
| 185 | 3300025208 | Ga0209436_107124 | Ga0209436_1071243 | 154 |
| 186 | 3300025228 | Ga0209672_101002 | Ga0209672_1010026 | 154 |
| 187 | 3300025229 | Ga0209147_102838 | Ga0209147_1028384 | 154 |
| 188 | 3300025242 | Ga0209258_100022 | Ga0209258_10002289 | 154 |
| 189 | 3300025245 | Ga0207425_1000154 | Ga0207425_100015436 | 154 |
| 190 | 3300025245 | Ga0207425_1014604 | Ga0207425_10146043 | 154 |
| 191 | 3300025254 | Ga0209148_1000034 | Ga0209148_100003489 | 154 |
| 192 | 3300025258 | Ga0209129_1000023 | Ga0209129_1000023168 | 154 |
| 193 | 3300025258 | Ga0209129_1005330 | Ga0209129_10053305 | 154 |
| 194 | 3300025263 | Ga0209565_1000125 | Ga0209565_100012536 | 154 |
| 195 | 3300025263 | Ga0209565_1017322 | Ga0209565_10173222 | 154 |
| 196 | 3300025273 | Ga0209673_1000192 | Ga0209673_100019241 | 154 |
| 197 | 3300025273 | Ga0209673_1000583 | Ga0209673_100058336 | 154 |
| 198 | 3300025284 | Ga0209130_1001296 | Ga0209130_10012966 | 154 |
| 199 | 3300025284 | Ga0209130_1012355 | Ga0209130_10123552 | 154 |
| 200 | 3300025291 | Ga0209675_1000403 | Ga0209675_100040328 | 154 |
| 201 | 3300025291 | Ga0209675_1002091 | Ga0209675_10020919 | 154 |
| 202 | 3300025291 | Ga0209675_1032745 | Ga0209675_10327452 | 154 |
| 203 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005634 | 154 |
| 204 | 3300025292 | Ga0209676_1000285 | Ga0209676_100028541 | 154 |
| 205 | 3300025292 | Ga0209676_1003651 | Ga0209676_10036514 | 154 |
| 206 | 3300025292 | Ga0209676_1043397 | Ga0209676_10433972 | 154 |
| 207 | 3300025294 | Ga0209025_1001378 | Ga0209025_10013786 | 154 |
| 208 | 3300025294 | Ga0209025_1005820 | Ga0209025_10058207 | 154 |
| 209 | 3300025295 | Ga0209564_1000270 | Ga0209564_100027062 | 154 |
| 210 | 3300025295 | Ga0209564_1000817 | Ga0209564_100081736 | 154 |
| 211 | 3300025297 | Ga0209758_1000064 | Ga0209758_100006469 | 154 |
| 212 | 3300025297 | Ga0209758_1036488 | Ga0209758_10364882 | 154 |
| 213 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007463 | 154 |
| 214 | 3300025298 | Ga0209050_1006518 | Ga0209050_10065183 | 154 |
| 215 | 3300025299 | Ga0209256_1000020 | Ga0209256_1000020440 | 154 |
| 216 | 3300025299 | Ga0209256_1002874 | Ga0209256_10028746 | 154 |
| 217 | 3300025302 | Ga0207426_1000001 | Ga0207426_10000011075 | 154 |
| 218 | 3300025302 | Ga0207426_1000031 | Ga0207426_1000031152 | 154 |
| 219 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009634 | 154 |
| 220 | 3300025303 | Ga0209051_1008199 | Ga0209051_10081996 | 154 |
| 221 | 3300025303 | Ga0209051_1050011 | Ga0209051_10500112 | 154 |
| 222 | 3300025303 | Ga0209051_1097704 | Ga0209051_10977041 | 154 |
| 223 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011608 | 154 |
| 224 | 3300025304 | Ga0209257_1001812 | Ga0209257_10018126 | 154 |
| 225 | 3300025321 | Ga0207656_10008004 | Ga0207656_100080041 | 154 |
| 226 | 3300025913 | Ga0207695_10529008 | Ga0207695_105290082 | 154 |
| 227 | 3300025914 | Ga0207671_10189642 | Ga0207671_101896422 | 154 |
| 228 | 3300025914 | Ga0207671_10309713 | Ga0207671_103097132 | 154 |
| 229 | 3300025924 | Ga0207694_10793965 | Ga0207694_107939652 | 154 |
| 230 | 3300025933 | Ga0207706_10158242 | Ga0207706_101582422 | 154 |
| 231 | 3300025935 | Ga0207709_10000529 | Ga0207709_1000052921 | 154 |
| 232 | 3300025949 | Ga0207667_10140730 | Ga0207667_101407302 | 154 |
| 233 | 3300025981 | Ga0207640_10095653 | Ga0207640_100956532 | 154 |
| 234 | 3300026041 | Ga0207639_10034610 | Ga0207639_100346103 | 154 |
| 235 | 3300026041 | Ga0207639_10446685 | Ga0207639_104466852 | 154 |
| 236 | 3300026116 | Ga0207674_10837649 | Ga0207674_108376492 | 154 |
| 237 | 3300026142 | Ga0207698_10518879 | Ga0207698_105188791 | 154 |
| 238 | 3300028379 | Ga0268266_10815232 | Ga0268266_108152321 | 154 |
| 239 | 3300028794 | Ga0307515_10093141 | Ga0307515_100931412 | 154 |
| 240 | 3300032002 | Ga0307416_100108755 | Ga0307416_1001087552 | 154 |
| 241 | 3300032005 | Ga0307411_10056918 | Ga0307411_100569182 | 154 |
| 242 | 3300041443 | Ga0451789_1328374 | Ga0451789_1328374_402_866 | 154 |
| 243 | 3300041452 | Ga0451793_0253438 | Ga0451793_0253438_848_1384 | 154 |
| 244 | 3300041486 | Ga0451807_2468035 | Ga0451807_2468035_258_722 | 154 |
| 245 | 3300041512 | Ga0451853_1360737 | Ga0451853_1360737_60_596 | 154 |
| 246 | 3300046453 | Ga0495627_054274 | Ga0495627_054274_127_591 | 154 |
| 247 | 3300046460 | Ga0495638_0024154 | Ga0495638_0024154_660_1124 | 154 |
| 248 | 3300046473 | Ga0495582_0441599 | Ga0495582_0441599_123_587 | 154 |
| 249 | 3300046513 | Ga0495616_0002711 | Ga0495616_0002711_6901_7365 | 154 |
| 250 | 3300046515 | Ga0495620_0061517 | Ga0495620_0061517_552_1016 | 154 |
| 251 | 3300046518 | Ga0495631_0009101 | Ga0495631_0009101_79_543 | 154 |
| 252 | 3300046520 | Ga0495637_0076686 | Ga0495637_0076686_699_1163 | 154 |
| 253 | 3300046530 | Ga0495654_0006805 | Ga0495654_0006805_2090_2554 | 154 |
| 254 | 3300046539 | Ga0495621_0069346 | Ga0495621_0069346_640_1104 | 154 |
| 255 | 3300046660 | Ga0495625_0029783 | Ga0495625_0029783_1368_1832 | 154 |
| 256 | 3300046674 | Ga0495588_0019339 | Ga0495588_0019339_1389_1853 | 154 |
| 257 | 3300046674 | Ga0495588_0174565 | Ga0495588_0174565_606_1070 | 154 |
| 258 | 3300046683 | Ga0495658_0009172 | Ga0495658_0009172_2188_2652 | 154 |
| 259 | 3300047321 | Ga0495676_0026837 | Ga0495676_0026837_3174_3638 | 154 |
| 260 | 3300047673 | Ga0495593_0194653 | Ga0495593_0194653_478_942 | 154 |
| 261 | 3300048089 | Ga0495614_0013915 | Ga0495614_0013915_1716_2180 | 154 |
| 262 | 3300048909 | Ga0496106_0840096 | Ga0496106_0840096_190_660 | 154 |
| 263 | 3300048919 | Ga0496116_0044869 | Ga0496116_0044869_1105_1569 | 154 |
| 264 | 3300048920 | Ga0496117_0018544 | Ga0496117_0018544_1312_1776 | 154 |
| 265 | 3300048922 | Ga0496119_0165653 | Ga0496119_0165653_608_1072 | 154 |
| 266 | 3300048924 | Ga0496121_0028066 | Ga0496121_0028066_418_882 | 154 |
| 267 | 3300048924 | Ga0496121_0276714 | Ga0496121_0276714_599_1063 | 154 |
| 268 | 3300048925 | Ga0496122_0068659 | Ga0496122_0068659_1140_1604 | 154 |
| 269 | 3300048925 | Ga0496122_0086028 | Ga0496122_0086028_1459_1923 | 154 |
| 270 | 3300048925 | Ga0496122_0300964 | Ga0496122_0300964_391_855 | 154 |
| 271 | 3300048926 | Ga0496123_0030622 | Ga0496123_0030622_432_896 | 154 |
| 272 | 3300048926 | Ga0496123_0041787 | Ga0496123_0041787_1437_1901 | 154 |
| 273 | 3300048926 | Ga0496123_0044060 | Ga0496123_0044060_1051_1515 | 154 |
| 274 | 3300048926 | Ga0496123_0190109 | Ga0496123_0190109_405_869 | 154 |
| 275 | 3300048927 | Ga0496124_0025510 | Ga0496124_0025510_393_857 | 154 |
| 276 | 3300048928 | Ga0496125_0037422 | Ga0496125_0037422_3106_3570 | 154 |
| 277 | 3300048928 | Ga0496125_0235485 | Ga0496125_0235485_433_897 | 154 |
| 278 | 3300048929 | Ga0496126_0487552 | Ga0496126_0487552_396_860 | 154 |
| 279 | 3300049459 | Ga0495678_158516 | Ga0495678_158516_164_628 | 154 |
| 280 | 3300050491 | nmdc:mga00v17_10064_c1 | nmdc:mga00v17_10064_c1_4367_4831 | 154 |
| 281 | 3300053087 | Ga0500643_002259 | Ga0500643_002259_4205_4669 | 154 |
| 282 | 3300053093 | Ga0500651_0000263 | Ga0500651_0000263_5327_5791 | 154 |
| 283 | 3300053094 | Ga0500566_0013376 | Ga0500566_0013376_1036_1500 | 154 |
| 284 | 3300053107 | Ga0500560_018400 | Ga0500560_018400_82_546 | 154 |
| 285 | 3300053110 | Ga0500571_000529 | Ga0500571_000529_9963_10427 | 154 |
| 286 | 3300053118 | Ga0500594_0000967 | Ga0500594_0000967_1958_2422 | 154 |
| 287 | 3300053120 | Ga0500597_031758 | Ga0500597_031758_176_640 | 154 |
| 288 | 3300053123 | Ga0500614_151984 | Ga0500614_151984_215_679 | 154 |
| 289 | 3300053128 | Ga0500626_162313 | Ga0500626_162313_101_565 | 154 |
| 290 | 3300053133 | Ga0500655_000174 | Ga0500655_000174_5277_5741 | 154 |
| 291 | 3300053134 | Ga0500658_0000517 | Ga0500658_0000517_14596_15060 | 154 |
| 292 | 3300053134 | Ga0500658_0000583 | Ga0500658_0000583_410_874 | 154 |
| 293 | 3300053136 | Ga0500559_0002747 | Ga0500559_0002747_787_1251 | 154 |
| 294 | 3300053137 | Ga0500561_0049622 | Ga0500561_0049622_363_827 | 154 |
| 295 | 3300053138 | Ga0500564_025460 | Ga0500564_025460_1403_1867 | 154 |
| 296 | 3300053139 | Ga0500568_0001222 | Ga0500568_0001222_4356_4820 | 154 |
| 297 | 3300053141 | Ga0500574_002592 | Ga0500574_002592_2174_2638 | 154 |
| 298 | 3300053154 | Ga0500619_195616 | Ga0500619_195616_200_664 | 154 |
| 299 | 3300053155 | Ga0500620_249953 | Ga0500620_249953_82_546 | 154 |
| 300 | 3300053161 | Ga0500634_0015120 | Ga0500634_0015120_2650_3114 | 154 |
| 301 | 3300053162 | Ga0500638_008052 | Ga0500638_008052_2264_2728 | 154 |
| 302 | 3300053177 | Ga0500636_0308497 | Ga0500636_0308497_38_502 | 154 |
| 303 | iso_pu_bacteria | 2643221628 | 2644159476 | 154 |
| 304 | iso_pu_bacteria | 2904449895 | 2904454551 | 154 |
| 305 | iso_pu_bacteria | 2904456579 | 2904461006 | 154 |
| 306 | iso_pu_bacteria | 2929520902 | 2929526890 | 154 |
| 307 | iso_pu_bacteria | 2945945610 | 2945948309 | 154 |
| 308 | iso_pu_bacteria | 2945972063 | 2945977048 | 154 |
| 309 | 3300005364 | Ga0070673_100570205 | Ga0070673_1005702052 | 155 |
| 310 | 3300005365 | Ga0070688_101173381 | Ga0070688_1011733811 | 155 |
| 311 | 3300005367 | Ga0070667_100219115 | Ga0070667_1002191152 | 155 |
| 312 | 3300005445 | Ga0070708_100347359 | Ga0070708_1003473592 | 155 |
| 313 | 3300006946 | Ga0079104_1035286 | Ga0079104_10352862 | 155 |
| 314 | 3300014326 | Ga0157380_11311147 | Ga0157380_113111471 | 155 |
| 315 | 3300015261 | Ga0182006_1136057 | Ga0182006_11360571 | 155 |
| 316 | 3300025937 | Ga0207669_10376295 | Ga0207669_103762952 | 155 |
| 317 | 3300027111 | Ga0209281_1038816 | Ga0209281_10388161 | 155 |
| 318 | 3300028786 | Ga0307517_10052647 | Ga0307517_100526472 | 155 |
| 319 | 3300030731 | Ga0316177_1134579 | Ga0316177_11345792 | 155 |
| 320 | 3300030732 | Ga0316176_1121982 | Ga0316176_11219822 | 155 |
| 321 | 3300030733 | Ga0314311_1033639 | Ga0314311_10336392 | 155 |
| 322 | 3300030735 | Ga0316178_1003154 | Ga0316178_10031544 | 155 |
| 323 | 3300030736 | Ga0316180_1086033 | Ga0316180_10860332 | 155 |
| 324 | 3300030742 | Ga0316183_1098709 | Ga0316183_10987095 | 155 |
| 325 | 3300030744 | Ga0316181_1249780 | Ga0316181_12497801 | 155 |
| 326 | 3300030745 | Ga0316182_1324443 | Ga0316182_13244433 | 155 |
| 327 | 3300031548 | Ga0307408_101245130 | Ga0307408_1012451302 | 155 |
| 328 | 3300031649 | Ga0307514_10067278 | Ga0307514_100672781 | 155 |
| 329 | 3300031731 | Ga0307405_10334692 | Ga0307405_103346922 | 155 |
| 330 | 3300031911 | Ga0307412_10166553 | Ga0307412_101665532 | 155 |
| 331 | 3300041452 | Ga0451793_0518933 | Ga0451793_0518933_605_1072 | 155 |
| 332 | 3300049679 | Ga0501249_000867 | Ga0501249_000867_4882_5412 | 155 |
| 333 | 3300049705 | Ga0501225_0019327 | Ga0501225_0019327_710_1240 | 155 |
| 334 | 3300003781 | Ga0055536_1002065 | Ga0055536_10020658 | 156 |
| 335 | 3300003792 | Ga0055540_1000950 | Ga0055540_100095011 | 156 |
| 336 | 3300005290 | Ga0065712_10240137 | Ga0065712_102401372 | 156 |
| 337 | 3300005295 | Ga0065707_10844695 | Ga0065707_108446951 | 156 |
| 338 | 3300005330 | Ga0070690_100482230 | Ga0070690_1004822302 | 156 |
| 339 | 3300005347 | Ga0070668_100189413 | Ga0070668_1001894133 | 156 |
| 340 | 3300005353 | Ga0070669_100091186 | Ga0070669_1000911862 | 156 |
| 341 | 3300005367 | Ga0070667_100252040 | Ga0070667_1002520402 | 156 |
| 342 | 3300005440 | Ga0070705_100491861 | Ga0070705_1004918611 | 156 |
| 343 | 3300005458 | Ga0070681_10020571 | Ga0070681_100205715 | 156 |
| 344 | 3300005467 | Ga0070706_100623891 | Ga0070706_1006238912 | 156 |
| 345 | 3300005535 | Ga0070684_100036197 | Ga0070684_1000361973 | 156 |
| 346 | 3300005614 | Ga0068856_100693512 | Ga0068856_1006935122 | 156 |
| 347 | 3300005618 | Ga0068864_100158173 | Ga0068864_1001581733 | 156 |
| 348 | 3300005719 | Ga0068861_100285353 | Ga0068861_1002853532 | 156 |
| 349 | 3300005841 | Ga0068863_100018659 | Ga0068863_1000186599 | 156 |
| 350 | 3300005844 | Ga0068862_100105181 | Ga0068862_1001051812 | 156 |
| 351 | 3300006175 | Ga0070712_100965735 | Ga0070712_1009657352 | 156 |
| 352 | 3300006852 | Ga0075433_10223844 | Ga0075433_102238444 | 156 |
| 353 | 3300006871 | Ga0075434_100197407 | Ga0075434_1001974072 | 156 |
| 354 | 3300006948 | Ga0099826_10000022 | Ga0099826_10000022120 | 156 |
| 355 | 3300009011 | Ga0105251_10008851 | Ga0105251_100088514 | 156 |
| 356 | 3300009011 | Ga0105251_10040138 | Ga0105251_100401382 | 156 |
| 357 | 3300009147 | Ga0114129_10123519 | Ga0114129_101235194 | 156 |
| 358 | 3300013297 | Ga0157378_10561956 | Ga0157378_105619562 | 156 |
| 359 | 3300017792 | Ga0163161_10000188 | Ga0163161_1000018836 | 156 |
| 360 | 3300021384 | Ga0213876_10049610 | Ga0213876_100496102 | 156 |
| 361 | 3300025292 | Ga0209676_1000418 | Ga0209676_100041855 | 156 |
| 362 | 3300025298 | Ga0209050_1028845 | Ga0209050_10288452 | 156 |
| 363 | 3300025303 | Ga0209051_1000327 | Ga0209051_100032736 | 156 |
| 364 | 3300025304 | Ga0209257_1003892 | Ga0209257_10038927 | 156 |
| 365 | 3300025735 | Ga0207713_1055951 | Ga0207713_10559512 | 156 |
| 366 | 3300025735 | Ga0207713_1119549 | Ga0207713_11195492 | 156 |
| 367 | 3300025908 | Ga0207643_10049551 | Ga0207643_100495513 | 156 |
| 368 | 3300025915 | Ga0207693_10889028 | Ga0207693_108890281 | 156 |
| 369 | 3300025917 | Ga0207660_10408169 | Ga0207660_104081692 | 156 |
| 370 | 3300025923 | Ga0207681_10084034 | Ga0207681_100840342 | 156 |
| 371 | 3300025944 | Ga0207661_10065286 | Ga0207661_100652863 | 156 |
| 372 | 3300025944 | Ga0207661_10479494 | Ga0207661_104794942 | 156 |
| 373 | 3300025961 | Ga0207712_10068259 | Ga0207712_100682593 | 156 |
| 374 | 3300026035 | Ga0207703_10617247 | Ga0207703_106172471 | 156 |
| 375 | 3300026078 | Ga0207702_10914514 | Ga0207702_109145142 | 156 |
| 376 | 3300026088 | Ga0207641_10022320 | Ga0207641_100223205 | 156 |
| 377 | 3300026095 | Ga0207676_10171624 | Ga0207676_101716243 | 156 |
| 378 | 3300027666 | Ga0209282_1000485 | Ga0209282_10004855 | 156 |
| 379 | 3300027682 | Ga0209971_1005249 | Ga0209971_10052493 | 156 |
| 380 | 3300027876 | Ga0209974_10024906 | Ga0209974_100249062 | 156 |
| 381 | 3300028380 | Ga0268265_10067383 | Ga0268265_100673835 | 156 |
| 382 | 3300031731 | Ga0307405_10083374 | Ga0307405_100833744 | 156 |
| 383 | 3300031911 | Ga0307412_10008603 | Ga0307412_100086032 | 156 |
| 384 | 3300032004 | Ga0307414_10027853 | Ga0307414_100278533 | 156 |
| 385 | 3300039437 | Ga0436365_0851258 | Ga0436365_0851258_2648_3124 | 156 |
| 386 | 3300039450 | Ga0436363_0688494 | Ga0436363_0688494_508_984 | 156 |
| 387 | 3300044683 | Ga0466965_0050921 | Ga0466965_0050921_631_1101 | 156 |
| 388 | 3300045049 | Ga0466959_0003718 | Ga0466959_0003718_2442_2912 | 156 |
| 389 | 3300046474 | Ga0495605_0080587 | Ga0495605_0080587_714_1184 | 156 |
| 390 | 3300046491 | Ga0495584_0102625 | Ga0495584_0102625_397_867 | 156 |
| 391 | 3300046500 | Ga0495596_0007565 | Ga0495596_0007565_1286_1756 | 156 |
| 392 | 3300046501 | Ga0495607_0016279 | Ga0495607_0016279_3274_3744 | 156 |
| 393 | 3300046507 | Ga0495606_0140150 | Ga0495606_0140150_724_1194 | 156 |
| 394 | 3300046512 | Ga0495610_0013283 | Ga0495610_0013283_3278_3748 | 156 |
| 395 | 3300046513 | Ga0495616_0011172 | Ga0495616_0011172_1366_1836 | 156 |
| 396 | 3300046515 | Ga0495620_0163329 | Ga0495620_0163329_49_519 | 156 |
| 397 | 3300046524 | Ga0495648_0055299 | Ga0495648_0055299_1018_1488 | 156 |
| 398 | 3300046528 | Ga0495642_0385180 | Ga0495642_0385180_101_574 | 156 |
| 399 | 3300046538 | Ga0495609_0008892 | Ga0495609_0008892_3261_3731 | 156 |
| 400 | 3300046542 | Ga0495597_0027982 | Ga0495597_0027982_798_1268 | 156 |
| 401 | 3300046542 | Ga0495597_0213681 | Ga0495597_0213681_282_752 | 156 |
| 402 | 3300046615 | Ga0495656_0018259 | Ga0495656_0018259_1302_1772 | 156 |
| 403 | 3300046648 | Ga0495611_0058799 | Ga0495611_0058799_886_1356 | 156 |
| 404 | 3300046665 | Ga0495661_0047949 | Ga0495661_0047949_964_1434 | 156 |
| 405 | 3300046684 | Ga0495669_0056376 | Ga0495669_0056376_373_843 | 156 |
| 406 | 3300046691 | Ga0495670_0042837 | Ga0495670_0042837_1006_1476 | 156 |
| 407 | 3300046692 | Ga0495671_0010757 | Ga0495671_0010757_3331_3801 | 156 |
| 408 | 3300046694 | Ga0495649_0036620 | Ga0495649_0036620_1214_1684 | 156 |
| 409 | 3300046794 | Ga0495589_0041347 | Ga0495589_0041347_1148_1618 | 156 |
| 410 | 3300047320 | Ga0495672_0017607 | Ga0495672_0017607_3246_3716 | 156 |
| 411 | 3300048911 | Ga0496108_0564510 | Ga0496108_0564510_199_669 | 156 |
| 412 | 3300048914 | Ga0496111_0094160 | Ga0496111_0094160_1406_1876 | 156 |
| 413 | 3300048915 | Ga0496112_0255566 | Ga0496112_0255566_530_1000 | 156 |
| 414 | 3300048919 | Ga0496116_0085004 | Ga0496116_0085004_1266_1736 | 156 |
| 415 | 3300048919 | Ga0496116_0304018 | Ga0496116_0304018_220_690 | 156 |
| 416 | 3300048924 | Ga0496121_0064366 | Ga0496121_0064366_1215_1685 | 156 |
| 417 | 3300048925 | Ga0496122_0059980 | Ga0496122_0059980_1073_1543 | 156 |
| 418 | 3300048926 | Ga0496123_0020792 | Ga0496123_0020792_1255_1725 | 156 |
| 419 | 3300048927 | Ga0496124_0008899 | Ga0496124_0008899_8244_8714 | 156 |
| 420 | 3300048928 | Ga0496125_0054440 | Ga0496125_0054440_1429_1899 | 156 |
| 421 | 3300048928 | Ga0496125_0104312 | Ga0496125_0104312_491_961 | 156 |
| 422 | 3300049573 | Ga0501037_0038947 | Ga0501037_0038947_2559_3032 | 156 |
| 423 | 3300049822 | Ga0501035_0578099 | Ga0501035_0578099_151_621 | 156 |
| 424 | 3300050507 | nmdc:mga05p37_321327_c1 | nmdc:mga05p37_321327_c1_1030_1500 | 156 |
| 425 | 3300050512 | nmdc:mga0n895_167478_c1 | nmdc:mga0n895_167478_c1_375_845 | 156 |
| 426 | 3300053091 | Ga0500647_0235253 | Ga0500647_0235253_176_646 | 156 |
| 427 | 3300053121 | Ga0500607_094037 | Ga0500607_094037_744_1214 | 156 |
| 428 | 3300053729 | Ga0500625_098473 | Ga0500625_098473_499_969 | 156 |
| 429 | 3300002704 | JGI25155J39150_1000106 | JGI25155J39150_100010617 | 157 |
| 430 | 3300002705 | JGI25156J39149_1000024 | JGI25156J39149_100002497 | 157 |
| 431 | 3300002738 | JGI25154J39366_1000043 | JGI25154J39366_100004398 | 157 |
| 432 | 3300002741 | JGI25157J39369_1000031 | JGI25157J39369_100003131 | 157 |
| 433 | 3300002987 | JGI25159J45721_1000583 | JGI25159J45721_100058312 | 157 |
| 434 | 3300002987 | JGI25159J45721_1003958 | JGI25159J45721_10039587 | 157 |
| 435 | 3300003187 | JGI25151J46595_10000983 | JGI25151J46595_1000098318 | 157 |
| 436 | 3300003187 | JGI25151J46595_10016862 | JGI25151J46595_100168623 | 157 |
| 437 | 3300003187 | JGI25151J46595_10020552 | JGI25151J46595_100205523 | 157 |
| 438 | 3300003187 | JGI25151J46595_10056962 | JGI25151J46595_100569622 | 157 |
| 439 | 3300003354 | JGI25160J50197_1000276 | JGI25160J50197_100027612 | 157 |
| 440 | 3300003374 | JGI25161J50226_1000021 | JGI25161J50226_100002132 | 157 |
| 441 | 3300003771 | Ga0055526_1009371 | Ga0055526_10093712 | 157 |
| 442 | 3300003771 | Ga0055526_1017805 | Ga0055526_10178052 | 157 |
| 443 | 3300003771 | Ga0055526_1059645 | Ga0055526_10596452 | 157 |
| 444 | 3300003773 | Ga0055537_1000418 | Ga0055537_100041831 | 157 |
| 445 | 3300003773 | Ga0055537_1000444 | Ga0055537_100044411 | 157 |
| 446 | 3300003773 | Ga0055537_1021539 | Ga0055537_10215392 | 157 |
| 447 | 3300003775 | Ga0055524_1000039 | Ga0055524_1000039120 | 157 |
| 448 | 3300003781 | Ga0055536_1005447 | Ga0055536_10054475 | 157 |
| 449 | 3300003784 | Ga0055534_1000417 | Ga0055534_100041718 | 157 |
| 450 | 3300003790 | Ga0055528_1001025 | Ga0055528_10010256 | 157 |
| 451 | 3300003791 | Ga0055530_10000457 | Ga0055530_1000045719 | 157 |
| 452 | 3300003791 | Ga0055530_10015173 | Ga0055530_100151732 | 157 |
| 453 | 3300003792 | Ga0055540_1000047 | Ga0055540_1000047110 | 157 |
| 454 | 3300003794 | Ga0055531_10000433 | Ga0055531_1000043319 | 157 |
| 455 | 3300004625 | Ga0055543_1001013 | Ga0055543_10010132 | 157 |
| 456 | 3300005262 | Ga0065165_1005063 | Ga0065165_10050632 | 157 |
| 457 | 3300005262 | Ga0065165_1029098 | Ga0065165_10290982 | 157 |
| 458 | 3300005262 | Ga0065165_1029128 | Ga0065165_10291282 | 157 |
| 459 | 3300005327 | Ga0070658_10304935 | Ga0070658_103049352 | 157 |
| 460 | 3300005328 | Ga0070676_10020801 | Ga0070676_100208012 | 157 |
| 461 | 3300005331 | Ga0070670_100186401 | Ga0070670_1001864012 | 157 |
| 462 | 3300005334 | Ga0068869_100051079 | Ga0068869_1000510794 | 157 |
| 463 | 3300005336 | Ga0070680_100299329 | Ga0070680_1002993291 | 157 |
| 464 | 3300005338 | Ga0068868_100481751 | Ga0068868_1004817512 | 157 |
| 465 | 3300005339 | Ga0070660_100020620 | Ga0070660_1000206202 | 157 |
| 466 | 3300005353 | Ga0070669_100002673 | Ga0070669_1000026737 | 157 |
| 467 | 3300005355 | Ga0070671_100112332 | Ga0070671_1001123322 | 157 |
| 468 | 3300005364 | Ga0070673_100017705 | Ga0070673_1000177054 | 157 |
| 469 | 3300005365 | Ga0070688_100330678 | Ga0070688_1003306782 | 157 |
| 470 | 3300005456 | Ga0070678_100199372 | Ga0070678_1001993722 | 157 |
| 471 | 3300005457 | Ga0070662_100044539 | Ga0070662_1000445394 | 157 |
| 472 | 3300005459 | Ga0068867_100003586 | Ga0068867_1000035867 | 157 |
| 473 | 3300005530 | Ga0070679_100089580 | Ga0070679_1000895803 | 157 |
| 474 | 3300005539 | Ga0068853_100020424 | Ga0068853_1000204244 | 157 |
| 475 | 3300005543 | Ga0070672_100022223 | Ga0070672_1000222234 | 157 |
| 476 | 3300005563 | Ga0068855_100033927 | Ga0068855_1000339275 | 157 |
| 477 | 3300005578 | Ga0068854_100755134 | Ga0068854_1007551342 | 157 |
| 478 | 3300005844 | Ga0068862_100053515 | Ga0068862_1000535153 | 157 |
| 479 | 3300005844 | Ga0068862_100062095 | Ga0068862_1000620951 | 157 |
| 480 | 3300005844 | Ga0068862_100342033 | Ga0068862_1003420332 | 157 |
| 481 | 3300005981 | Ga0081538_10030266 | Ga0081538_100302662 | 157 |
| 482 | 3300006038 | Ga0075365_10449419 | Ga0075365_104494192 | 157 |
| 483 | 3300006051 | Ga0075364_10015136 | Ga0075364_100151364 | 157 |
| 484 | 3300006058 | Ga0075432_10461959 | Ga0075432_104619591 | 157 |
| 485 | 3300006177 | Ga0075362_10012179 | Ga0075362_100121793 | 157 |
| 486 | 3300006195 | Ga0075366_10567782 | Ga0075366_105677822 | 157 |
| 487 | 3300006353 | Ga0075370_10001266 | Ga0075370_100012663 | 157 |
| 488 | 3300006353 | Ga0075370_10444226 | Ga0075370_104442262 | 157 |
| 489 | 3300006353 | Ga0075370_10615580 | Ga0075370_106155801 | 157 |
| 490 | 3300006844 | Ga0075428_100226017 | Ga0075428_1002260173 | 157 |
| 491 | 3300006852 | Ga0075433_10494954 | Ga0075433_104949542 | 157 |
| 492 | 3300006881 | Ga0068865_100796125 | Ga0068865_1007961251 | 157 |
| 493 | 3300006948 | Ga0099826_10018113 | Ga0099826_100181132 | 157 |
| 494 | 3300009093 | Ga0105240_10018681 | Ga0105240_100186813 | 157 |
| 495 | 3300009094 | Ga0111539_10000919 | Ga0111539_100009194 | 157 |
| 496 | 3300009094 | Ga0111539_10763236 | Ga0111539_107632361 | 157 |
| 497 | 3300009147 | Ga0114129_10129546 | Ga0114129_101295464 | 157 |
| 498 | 3300009147 | Ga0114129_11437120 | Ga0114129_114371201 | 157 |
| 499 | 3300009148 | Ga0105243_10022126 | Ga0105243_100221263 | 157 |
| 500 | 3300009148 | Ga0105243_10266801 | Ga0105243_102668012 | 157 |
| 501 | 3300009551 | Ga0105238_10051027 | Ga0105238_100510272 | 157 |
| 502 | 3300009553 | Ga0105249_10177487 | Ga0105249_101774872 | 157 |
| 503 | 3300009993 | Ga0105028_123472 | Ga0105028_1234721 | 157 |
| 504 | 3300011119 | Ga0105246_10131455 | Ga0105246_101314553 | 157 |
| 505 | 3300012513 | Ga0157326_1000714 | Ga0157326_10007143 | 157 |
| 506 | 3300013308 | Ga0157375_10042119 | Ga0157375_100421192 | 157 |
| 507 | 3300014326 | Ga0157380_10043291 | Ga0157380_100432914 | 157 |
| 508 | 3300014326 | Ga0157380_10244759 | Ga0157380_102447592 | 157 |
| 509 | 3300025206 | Ga0209435_100008 | Ga0209435_100008427 | 157 |
| 510 | 3300025208 | Ga0209436_108431 | Ga0209436_1084313 | 157 |
| 511 | 3300025245 | Ga0207425_1006563 | Ga0207425_10065633 | 157 |
| 512 | 3300025246 | Ga0209646_1000079 | Ga0209646_1000079150 | 157 |
| 513 | 3300025250 | Ga0209026_1000067 | Ga0209026_1000067150 | 157 |
| 514 | 3300025256 | Ga0209759_1000056 | Ga0209759_1000056150 | 157 |
| 515 | 3300025258 | Ga0209129_1002197 | Ga0209129_10021978 | 157 |
| 516 | 3300025258 | Ga0209129_1036212 | Ga0209129_10362122 | 157 |
| 517 | 3300025263 | Ga0209565_1000080 | Ga0209565_1000080115 | 157 |
| 518 | 3300025263 | Ga0209565_1002434 | Ga0209565_10024342 | 157 |
| 519 | 3300025273 | Ga0209673_1000088 | Ga0209673_100008831 | 157 |
| 520 | 3300025284 | Ga0209130_1000103 | Ga0209130_1000103132 | 157 |
| 521 | 3300025284 | Ga0209130_1000238 | Ga0209130_100023860 | 157 |
| 522 | 3300025291 | Ga0209675_1000209 | Ga0209675_100020918 | 157 |
| 523 | 3300025291 | Ga0209675_1000888 | Ga0209675_100088815 | 157 |
| 524 | 3300025292 | Ga0209676_1000073 | Ga0209676_1000073141 | 157 |
| 525 | 3300025292 | Ga0209676_1003830 | Ga0209676_10038302 | 157 |
| 526 | 3300025294 | Ga0209025_1000531 | Ga0209025_10005315 | 157 |
| 527 | 3300025294 | Ga0209025_1001659 | Ga0209025_10016599 | 157 |
| 528 | 3300025294 | Ga0209025_1003871 | Ga0209025_100387111 | 157 |
| 529 | 3300025294 | Ga0209025_1013190 | Ga0209025_10131907 | 157 |
| 530 | 3300025295 | Ga0209564_1001646 | Ga0209564_100164616 | 157 |
| 531 | 3300025295 | Ga0209564_1003481 | Ga0209564_10034814 | 157 |
| 532 | 3300025295 | Ga0209564_1005469 | Ga0209564_10054699 | 157 |
| 533 | 3300025297 | Ga0209758_1014110 | Ga0209758_10141103 | 157 |
| 534 | 3300025297 | Ga0209758_1045022 | Ga0209758_10450222 | 157 |
| 535 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008922 | 157 |
| 536 | 3300025298 | Ga0209050_1013365 | Ga0209050_10133653 | 157 |
| 537 | 3300025298 | Ga0209050_1015357 | Ga0209050_10153573 | 157 |
| 538 | 3300025299 | Ga0209256_1000096 | Ga0209256_1000096176 | 157 |
| 539 | 3300025302 | Ga0207426_1000731 | Ga0207426_100073133 | 157 |
| 540 | 3300025302 | Ga0207426_1001996 | Ga0207426_100199611 | 157 |
| 541 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005922 | 157 |
| 542 | 3300025304 | Ga0209257_1000031 | Ga0209257_1000031512 | 157 |
| 543 | 3300025304 | Ga0209257_1017679 | Ga0209257_10176791 | 157 |
| 544 | 3300025907 | Ga0207645_10014539 | Ga0207645_100145394 | 157 |
| 545 | 3300025913 | Ga0207695_10466267 | Ga0207695_104662672 | 157 |
| 546 | 3300025918 | Ga0207662_10894968 | Ga0207662_108949681 | 157 |
| 547 | 3300025919 | Ga0207657_10661012 | Ga0207657_106610121 | 157 |
| 548 | 3300025923 | Ga0207681_10732402 | Ga0207681_107324022 | 157 |
| 549 | 3300025924 | Ga0207694_10117824 | Ga0207694_101178242 | 157 |
| 550 | 3300025925 | Ga0207650_10966352 | Ga0207650_109663522 | 157 |
| 551 | 3300025933 | Ga0207706_10192344 | Ga0207706_101923442 | 157 |
| 552 | 3300025935 | Ga0207709_10024347 | Ga0207709_100243474 | 157 |
| 553 | 3300025935 | Ga0207709_10539048 | Ga0207709_105390482 | 157 |
| 554 | 3300025940 | Ga0207691_10057061 | Ga0207691_100570612 | 157 |
| 555 | 3300025942 | Ga0207689_10052706 | Ga0207689_100527064 | 157 |
| 556 | 3300025945 | Ga0207679_11296676 | Ga0207679_112966761 | 157 |
| 557 | 3300025949 | Ga0207667_10247807 | Ga0207667_102478072 | 157 |
| 558 | 3300025960 | Ga0207651_10076997 | Ga0207651_100769972 | 157 |
| 559 | 3300025981 | Ga0207640_10453467 | Ga0207640_104534672 | 157 |
| 560 | 3300026023 | Ga0207677_10015431 | Ga0207677_100154312 | 157 |
| 561 | 3300026089 | Ga0207648_10011428 | Ga0207648_100114285 | 157 |
| 562 | 3300026116 | Ga0207674_10735321 | Ga0207674_107353212 | 157 |
| 563 | 3300026118 | Ga0207675_100029259 | Ga0207675_1000292594 | 157 |
| 564 | 3300026121 | Ga0207683_10598708 | Ga0207683_105987082 | 157 |
| 565 | 3300027907 | Ga0207428_10000152 | Ga0207428_1000015215 | 157 |
| 566 | 3300027907 | Ga0207428_10406388 | Ga0207428_104063882 | 157 |
| 567 | 3300028380 | Ga0268265_10178654 | Ga0268265_101786543 | 157 |
| 568 | 3300028786 | Ga0307517_10333679 | Ga0307517_103336791 | 157 |
| 569 | 3300031456 | Ga0307513_10001864 | Ga0307513_100018641 | 157 |
| 570 | 3300031548 | Ga0307408_100006292 | Ga0307408_1000062928 | 157 |
| 571 | 3300031548 | Ga0307408_100605224 | Ga0307408_1006052242 | 157 |
| 572 | 3300031730 | Ga0307516_10187548 | Ga0307516_101875482 | 157 |
| 573 | 3300031901 | Ga0307406_10030715 | Ga0307406_100307152 | 157 |
| 574 | 3300031911 | Ga0307412_10348713 | Ga0307412_103487132 | 157 |
| 575 | 3300031995 | Ga0307409_100474480 | Ga0307409_1004744801 | 157 |
| 576 | 3300032002 | Ga0307416_100539735 | Ga0307416_1005397352 | 157 |
| 577 | 3300032004 | Ga0307414_11175424 | Ga0307414_111754242 | 157 |
| 578 | 3300032005 | Ga0307411_10198553 | Ga0307411_101985531 | 157 |
| 579 | 3300041459 | Ga0451800_0093157 | Ga0451800_0093157_201_674 | 157 |
| 580 | 3300041512 | Ga0451853_0087738 | Ga0451853_0087738_629_1102 | 157 |
| 581 | 3300042013 | Ga0439456_105095 | Ga0439456_105095_139_615 | 157 |
| 582 | 3300046515 | Ga0495620_0135363 | Ga0495620_0135363_417_890 | 157 |
| 583 | 3300046660 | Ga0495625_0145774 | Ga0495625_0145774_841_1314 | 157 |
| 584 | 3300046660 | Ga0495625_0174108 | Ga0495625_0174108_687_1160 | 157 |
| 585 | 3300046674 | Ga0495588_0158083 | Ga0495588_0158083_291_764 | 157 |
| 586 | 3300046692 | Ga0495671_0002240 | Ga0495671_0002240_11532_12005 | 157 |
| 587 | 3300046810 | Ga0495660_0060417 | Ga0495660_0060417_1079_1552 | 157 |
| 588 | 3300047470 | Ga0495681_0261790 | Ga0495681_0261790_104_577 | 157 |
| 589 | 3300048904 | Ga0496101_0019042 | Ga0496101_0019042_3959_4432 | 157 |
| 590 | 3300050489 | nmdc:mga03683_56351_c1 | nmdc:mga03683_56351_c1_377_850 | 157 |
| 591 | 3300050491 | nmdc:mga00v17_246763_c1 | nmdc:mga00v17_246763_c1_187_660 | 157 |
| 592 | 3300050492 | nmdc:mga0yw44_899936_c1 | nmdc:mga0yw44_899936_c1_101_574 | 157 |
| 593 | 3300050493 | nmdc:mga0k408_157450_c1 | nmdc:mga0k408_157450_c1_543_1016 | 157 |
| 594 | 3300050493 | nmdc:mga0k408_186712_c1 | nmdc:mga0k408_186712_c1_618_1091 | 157 |
| 595 | 3300050496 | nmdc:mga07m45_375981_c1 | nmdc:mga07m45_375981_c1_331_807 | 157 |
| 596 | 3300050496 | nmdc:mga07m45_389937_c1 | nmdc:mga07m45_389937_c1_266_739 | 157 |
| 597 | 3300050496 | nmdc:mga07m45_4118_c1 | nmdc:mga07m45_4118_c1_1359_1832 | 157 |
| 598 | 3300050507 | nmdc:mga05p37_347711_c2 | nmdc:mga05p37_347711_c2_45_521 | 157 |
| 599 | 3300050507 | nmdc:mga05p37_918535_c1 | nmdc:mga05p37_918535_c1_313_786 | 157 |
| 600 | 3300050510 | nmdc:mga06r32_1194049_c1 | nmdc:mga06r32_1194049_c1_211_687 | 157 |
| 601 | 3300050510 | nmdc:mga06r32_1361325_c1 | nmdc:mga06r32_1361325_c1_97_573 | 157 |
| 602 | 3300050511 | nmdc:mga08y16_474866_c1 | nmdc:mga08y16_474866_c1_556_1032 | 157 |
| 603 | 3300050511 | nmdc:mga08y16_54_c1 | nmdc:mga08y16_54_c1_57270_57746 | 157 |
| 604 | 3300050515 | nmdc:mga0a205_530846_c1 | nmdc:mga0a205_530846_c1_291_767 | 157 |
| 605 | 3300053079 | Ga0500610_0001085 | Ga0500610_0001085_2014_2487 | 157 |
| 606 | 3300053079 | Ga0500610_0001382 | Ga0500610_0001382_1675_2148 | 157 |
| 607 | 3300053088 | Ga0500644_0008163 | Ga0500644_0008163_1885_2358 | 157 |
| 608 | 3300053094 | Ga0500566_0164633 | Ga0500566_0164633_345_818 | 157 |
| 609 | 3300053098 | Ga0500650_0085302 | Ga0500650_0085302_725_1198 | 157 |
| 610 | 3300053117 | Ga0500593_000756 | Ga0500593_000756_11564_12037 | 157 |
| 611 | 3300053117 | Ga0500593_001588 | Ga0500593_001588_7015_7488 | 157 |
| 612 | 3300053121 | Ga0500607_001975 | Ga0500607_001975_5327_5800 | 157 |
| 613 | 3300053158 | Ga0500627_0005114 | Ga0500627_0005114_276_749 | 157 |
| 614 | 3300053730 | Ga0500645_002194 | Ga0500645_002194_3608_4081 | 157 |
| 615 | 3300053730 | Ga0500645_003711 | Ga0500645_003711_321_794 | 157 |
| 616 | 3300053730 | Ga0500645_009996 | Ga0500645_009996_800_1273 | 157 |
| 617 | 3300001989 | JGI24739J22299_10148046 | JGI24739J22299_101480462 | 158 |
| 618 | 3300003773 | Ga0055537_1000124 | Ga0055537_100012428 | 158 |
| 619 | 3300003784 | Ga0055534_1000117 | Ga0055534_100011733 | 158 |
| 620 | 3300003790 | Ga0055528_1001402 | Ga0055528_10014024 | 158 |
| 621 | 3300003792 | Ga0055540_1003418 | Ga0055540_10034186 | 158 |
| 622 | 3300005331 | Ga0070670_100244491 | Ga0070670_1002444912 | 158 |
| 623 | 3300005456 | Ga0070678_100998677 | Ga0070678_1009986772 | 158 |
| 624 | 3300005844 | Ga0068862_100071146 | Ga0068862_1000711462 | 158 |
| 625 | 3300006038 | Ga0075365_10001430 | Ga0075365_100014308 | 158 |
| 626 | 3300006048 | Ga0075363_100075106 | Ga0075363_1000751062 | 158 |
| 627 | 3300006048 | Ga0075363_100404275 | Ga0075363_1004042752 | 158 |
| 628 | 3300006051 | Ga0075364_10129589 | Ga0075364_101295892 | 158 |
| 629 | 3300006058 | Ga0075432_10024090 | Ga0075432_100240902 | 158 |
| 630 | 3300006177 | Ga0075362_10076850 | Ga0075362_100768502 | 158 |
| 631 | 3300006186 | Ga0075369_10021689 | Ga0075369_100216892 | 158 |
| 632 | 3300006195 | Ga0075366_10012391 | Ga0075366_100123912 | 158 |
| 633 | 3300006353 | Ga0075370_10000897 | Ga0075370_100008972 | 158 |
| 634 | 3300006358 | Ga0068871_100035745 | Ga0068871_1000357455 | 158 |
| 635 | 3300006948 | Ga0099826_10002164 | Ga0099826_1000216414 | 158 |
| 636 | 3300006948 | Ga0099826_10074502 | Ga0099826_100745022 | 158 |
| 637 | 3300009093 | Ga0105240_10197613 | Ga0105240_101976133 | 158 |
| 638 | 3300009176 | Ga0105242_11231168 | Ga0105242_112311682 | 158 |
| 639 | 3300012502 | Ga0157347_1002655 | Ga0157347_10026552 | 158 |
| 640 | 3300013100 | Ga0157373_10012722 | Ga0157373_100127222 | 158 |
| 641 | 3300014497 | Ga0182008_10027531 | Ga0182008_100275312 | 158 |
| 642 | 3300015262 | Ga0182007_10026879 | Ga0182007_100268792 | 158 |
| 643 | 3300017792 | Ga0163161_10052739 | Ga0163161_100527393 | 158 |
| 644 | 3300025263 | Ga0209565_1000114 | Ga0209565_100011489 | 158 |
| 645 | 3300025273 | Ga0209673_1000572 | Ga0209673_100057232 | 158 |
| 646 | 3300025291 | Ga0209675_1000029 | Ga0209675_1000029254 | 158 |
| 647 | 3300025292 | Ga0209676_1057284 | Ga0209676_10572841 | 158 |
| 648 | 3300025303 | Ga0209051_1000363 | Ga0209051_100036329 | 158 |
| 649 | 3300025925 | Ga0207650_10032850 | Ga0207650_100328503 | 158 |
| 650 | 3300026089 | Ga0207648_10222228 | Ga0207648_102222282 | 158 |
| 651 | 3300027666 | Ga0209282_1001104 | Ga0209282_100110417 | 158 |
| 652 | 3300027907 | Ga0207428_10927907 | Ga0207428_109279071 | 158 |
| 653 | 3300031235 | Ga0265330_10000014 | Ga0265330_10000014100 | 158 |
| 654 | 3300031238 | Ga0265332_10000011 | Ga0265332_10000011139 | 158 |
| 655 | 3300031250 | Ga0265331_10013364 | Ga0265331_100133643 | 158 |
| 656 | 3300031251 | Ga0265327_10000027 | Ga0265327_1000002736 | 158 |
| 657 | 3300031456 | Ga0307513_10000256 | Ga0307513_1000025620 | 158 |
| 658 | 3300031548 | Ga0307408_100108899 | Ga0307408_1001088992 | 158 |
| 659 | 3300031548 | Ga0307408_101193668 | Ga0307408_1011936681 | 158 |
| 660 | 3300031649 | Ga0307514_10027922 | Ga0307514_100279222 | 158 |
| 661 | 3300031711 | Ga0265314_10000026 | Ga0265314_10000026129 | 158 |
| 662 | 3300031731 | Ga0307405_10177300 | Ga0307405_101773002 | 158 |
| 663 | 3300031731 | Ga0307405_11473646 | Ga0307405_114736461 | 158 |
| 664 | 3300031824 | Ga0307413_10132383 | Ga0307413_101323832 | 158 |
| 665 | 3300031901 | Ga0307406_10010740 | Ga0307406_100107402 | 158 |
| 666 | 3300031911 | Ga0307412_10118809 | Ga0307412_101188092 | 158 |
| 667 | 3300031911 | Ga0307412_10253645 | Ga0307412_102536452 | 158 |
| 668 | 3300031911 | Ga0307412_11214830 | Ga0307412_112148302 | 158 |
| 669 | 3300031911 | Ga0307412_11495132 | Ga0307412_114951321 | 158 |
| 670 | 3300031995 | Ga0307409_100437721 | Ga0307409_1004377212 | 158 |
| 671 | 3300032002 | Ga0307416_100017223 | Ga0307416_1000172234 | 158 |
| 672 | 3300032002 | Ga0307416_100104627 | Ga0307416_1001046272 | 158 |
| 673 | 3300032005 | Ga0307411_10011105 | Ga0307411_100111056 | 158 |
| 674 | 3300041413 | Ga0439465_0067288 | Ga0439465_0067288_661_1137 | 158 |
| 675 | 3300042004 | Ga0439445_0013272 | Ga0439445_0013272_1396_1872 | 158 |
| 676 | 3300042125 | Ga0450923_024679 | Ga0450923_024679_573_1049 | 158 |
| 677 | 3300042145 | Ga0450906_047766 | Ga0450906_047766_86_562 | 158 |
| 678 | 3300042147 | Ga0450910_030375 | Ga0450910_030375_266_742 | 158 |
| 679 | 3300042156 | Ga0439446_0044737 | Ga0439446_0044737_588_1064 | 158 |
| 680 | 3300042184 | Ga0450908_000847 | Ga0450908_000847_1591_2067 | 158 |
| 681 | 3300042531 | Ga0450918_001787 | Ga0450918_001787_2278_2754 | 158 |
| 682 | 3300044673 | Ga0453683_0968597 | Ga0453683_0968597_14_490 | 158 |
| 683 | 3300046472 | Ga0495580_0136857 | Ga0495580_0136857_453_932 | 158 |
| 684 | 3300046499 | Ga0495594_0197728 | Ga0495594_0197728_290_769 | 158 |
| 685 | 3300046526 | Ga0495666_0065402 | Ga0495666_0065402_434_913 | 158 |
| 686 | 3300046660 | Ga0495625_0001291 | Ga0495625_0001291_5589_6098 | 158 |
| 687 | 3300046674 | Ga0495588_0119983 | Ga0495588_0119983_654_1130 | 158 |
| 688 | 3300046690 | Ga0495624_0311035 | Ga0495624_0311035_172_651 | 158 |
| 689 | 3300049686 | Ga0501257_119607 | Ga0501257_119607_18_494 | 158 |
| 690 | 3300049759 | Ga0501262_000093 | Ga0501262_000093_1819_2358 | 158 |
| 691 | 3300050489 | nmdc:mga03683_22005_c1 | nmdc:mga03683_22005_c1_1535_2044 | 158 |
| 692 | 3300050489 | nmdc:mga03683_313736_c1 | nmdc:mga03683_313736_c1_118_615 | 158 |
| 693 | 3300050490 | nmdc:mga03n38_20693_c1 | nmdc:mga03n38_20693_c1_1705_2214 | 158 |
| 694 | 3300050490 | nmdc:mga03n38_318906_c1 | nmdc:mga03n38_318906_c1_139_615 | 158 |
| 695 | 3300050491 | nmdc:mga00v17_80922_c1 | nmdc:mga00v17_80922_c1_1151_1660 | 158 |
| 696 | 3300050492 | nmdc:mga0yw44_13446_c1 | nmdc:mga0yw44_13446_c1_3601_4110 | 158 |
| 697 | 3300050493 | nmdc:mga0k408_7234_c1 | nmdc:mga0k408_7234_c1_1171_1680 | 158 |
| 698 | 3300050496 | nmdc:mga07m45_9938_c1 | nmdc:mga07m45_9938_c1_903_1400 | 158 |
| 699 | 3300050516 | nmdc:mga0sz30_179802_c1 | nmdc:mga0sz30_179802_c1_331_807 | 158 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d7v-assembly1.cif.gz_B | structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 | 0.9776 | 1 | 151 |
| 2d7v-assembly1.cif.gz_B | structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 | 0.9528 | 1 | 151 |
| 2onf-assembly1.cif.gz_B | crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution | 0.8579 | 1 | 153 |
| 2onf-assembly1.cif.gz_B | crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution | 0.8467 | 1 | 153 |
| 2pn2-assembly1.cif.gz_A-2 | crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution | 0.8117 | 1 | 153 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d7vB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9647 | 2 | 151 | 3.30.300.20 |
| 2d7vB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9522 | 2 | 151 | 3.30.300.20 |
| 2onfB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8493 | 7 | 153 | 3.30.300.20 |
| 2onfB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8319 | 7 | 153 | 3.30.300.20 |
| af_Q2G1T3_42_139_3.30.300.20 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8278 | 55 | 153 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534GYJ0-F1-model_v4 | OsmC family peroxiredoxin | 0.9977 | 52 | 153 |
|
| AF-A0A534FSH6-F1-model_v4 | OsmC family peroxiredoxin | 0.9943 | 34 | 153 |
|
| AF-A0A3N7CUJ4-F1-model_v4 | Peroxiredoxin | 0.9936 | 1 | 151 |
|
| AF-A0A1E4J6V7-F1-model_v4 | Peroxiredoxin | 0.9919 | 1 | 151 |
|
| AF-A0A0J1GHH4-F1-model_v4 | Peroxiredoxin | 0.9899 | 49 | 151 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar