F476062

General Info

Members Datasets Scaffolds Average Seq Length
699 399 658 156

Family's Representative Sequence

Representative Sequence 3300049759|Ga0501262_000093|Ga0501262_000093_1819_2358
Length 179
Sequence VFSDPGFLTQNGAPIDLGAHGMAQYTAEILWQRGEQDFLGNSYSRRHSMRFDGGAEVPGSSSPHVVPLPFSDAAAVDPEEAFVASLSSCHMLWFLTMAVKRKFTVDRYFDAASGIMEKNAEGKLAMTVVTLRPEATFSGANLPTREQIEHMHHRAHEECFIANSVKTEVRCEPVFGSAE

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
10 2643221658 Variovorax sp. Root411 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2643221683 Variovorax sp. Root473 Isolate Unclassified
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738541307 Variovorax sp. GV008 Isolate Unclassified
15 2738543019 Variovorax sp. GV040 Isolate Unclassified
16 2765235841 Pseudomonas putida AA7 Isolate Unclassified
17 2791355260 Rhizobium sp. L9 Isolate Nodule
18 2818991446 Variovorax sp. 1180 Isolate Unclassified
19 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
20 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
21 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
22 2842677519 Variovorax sp. R-72495 Isolate Unclassified
23 2885198086 Variovorax sp. 679 Isolate Unclassified
24 2885211737 Variovorax sp. 553 Isolate Unclassified
25 2899924645 Variovorax sp. 369 Isolate Unclassified
26 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
27 2904456579 Variovorax sp. 2002 Isolate Unclassified
28 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
29 2928037797 Variovorax sp. 1126 Isolate Unclassified
30 2928044640 Variovorax sp. 1128 Isolate Unclassified
31 2928051484 Variovorax sp. 1133 Isolate Unclassified
32 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
33 2928070936 Variovorax gossypii 1167 Isolate Unclassified
34 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
35 2929520902 Variovorax beijingensis 502 Isolate Unclassified
36 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
37 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
38 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
39 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
40 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
41 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
42 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
43 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
44 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
45 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
46 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
47 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
48 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
49 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
50 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
53 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
54 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
55 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
56 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
70 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
71 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
72 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
73 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
74 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
75 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
76 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
77 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
78 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
79 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
80 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
81 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
82 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
83 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
86 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
87 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
88 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
89 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
90 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
91 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
97 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
98 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
99 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
100 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
106 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
109 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
110 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
114 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
115 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
118 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
119 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
123 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
124 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
130 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
131 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
137 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
138 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
139 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
140 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
141 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
151 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
155 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
163 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
168 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
169 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
174 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
175 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
178 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
179 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
187 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
235 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
237 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
245 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
246 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
247 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
248 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
249 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
250 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
251 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
252 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
253 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
254 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
255 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
256 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
257 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
258 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
259 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
260 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
261 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
262 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
263 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
266 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
267 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
268 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
269 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
270 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
271 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
272 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
273 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
274 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
275 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
276 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
277 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
278 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
279 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
280 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
281 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
282 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
283 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
284 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
285 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
286 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
287 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
297 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
298 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
299 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
300 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
301 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
304 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
305 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
306 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
307 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
308 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
309 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
310 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
313 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
319 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
320 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
321 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
322 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
323 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
324 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
328 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
329 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
330 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
336 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
337 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
343 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
344 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
345 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
346 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
347 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
348 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
349 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
351 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
352 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
353 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
354 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
355 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
356 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
357 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
358 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
359 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
364 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
365 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
366 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
369 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
370 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
371 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
372 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
373 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
374 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
375 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
376 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
377 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
378 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
379 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
380 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
381 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
382 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
383 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
384 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
385 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
386 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
387 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
388 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
389 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
390 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
391 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
392 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
393 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
395 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
396 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
397 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
398 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
399 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.13
Metatranscriptomes 0
Isolates 5.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.48
Nodule 2
Rhizoplane 2.29
Rhizosphere 51.36
Stem 0
Stem Tuber 0
Unclassified 10.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10148046 3300001989 Bacteria 695
2 JGI25155J39150_1000106 3300002704 Bacteria 44262
3 JGI25156J39149_1000024 3300002705 Bacteria 141748
4 JGI25154J39366_1000043 3300002738 Bacteria 142417
5 JGI25157J39369_1000031 3300002741 Bacteria 141953
6 JGI25152J39213_1001121 3300002773 Bacteria 12491
7 JGI25152J39213_1004181 3300002773 Bacteria 4649
8 JGI25150J39212_1000556 3300002774 Bacteria 15009
9 JGI25150J39212_1010834 3300002774 Bacteria 1678
10 JGI25159J45721_1000583 3300002987 Bacteria 16414
11 JGI25159J45721_1003958 3300002987 Bacteria 5055
12 JGI25159J45721_1004621 3300002987 Bacteria 4514
13 JGI25151J46595_10000983 3300003187 Bacteria 21613
14 JGI25151J46595_10009784 3300003187 Bacteria 4514
15 JGI25151J46595_10016862 3300003187 Bacteria 3185
16 JGI25151J46595_10020552 3300003187 Bacteria 2780
17 JGI25151J46595_10034889 3300003187 Bacteria 1917
18 JGI25151J46595_10056962 3300003187 Bacteria 1278
19 JGI25153J46596_10009924 3300003215 Bacteria 4362
20 JGI25153J46596_10028831 3300003215 Bacteria 1917
21 rootH1_10045273 3300003316 Bacteria 3151
22 rootH2_10070709 3300003320 Bacteria 3872
23 rootL2_10069764 3300003322 Bacteria 2517
24 rootH1_10057228 3300003323 Bacteria 2149
25 rootH1_10276335 3300003323 Bacteria 1224
26 rootH1_10403597 3300003323 Bacteria 1115
27 JGI25160J50197_1000276 3300003354 Bacteria 37602
28 JGI25160J50197_1006922 3300003354 Bacteria 4514
29 JGI25160J50197_1010866 3300003354 Bacteria 3266
30 JGI25161J50226_1000021 3300003374 Bacteria 163584
31 JGI25161J50226_1002668 3300003374 Bacteria 4449
32 JGI25161J50226_1002758 3300003374 Bacteria 4332
33 Ga0055535_1000507 3300003761 Bacteria 34514
34 Ga0055542_1000004 3300003762 Bacteria 553532
35 Ga0055526_1009371 3300003771 Bacteria 4719
36 Ga0055526_1010324 3300003771 Bacteria 4362
37 Ga0055526_1017805 3300003771 Bacteria 2691
38 Ga0055526_1031110 3300003771 Bacteria 1539
39 Ga0055526_1059645 3300003771 Bacteria 820
40 Ga0055537_1000124 3300003773 Bacteria 58656
41 Ga0055537_1000418 3300003773 Bacteria 27742
42 Ga0055537_1000444 3300003773 Bacteria 26376
43 Ga0055537_1003982 3300003773 Bacteria 4362
44 Ga0055537_1013497 3300003773 Bacteria 1530
45 Ga0055537_1021539 3300003773 Bacteria 956
46 Ga0055524_1000039 3300003775 Bacteria 159897
47 Ga0055524_1008191 3300003775 Bacteria 4362
48 Ga0055524_1008253 3300003775 Bacteria 4340
49 Ga0055536_1002065 3300003781 Bacteria 11464
50 Ga0055536_1004573 3300003781 Bacteria 7024
51 Ga0055536_1005447 3300003781 Bacteria 6221
52 Ga0055536_1020823 3300003781 Bacteria 2011
53 Ga0055536_1021460 3300003781 Bacteria 1959
54 Ga0055534_1000117 3300003784 Bacteria 58656
55 Ga0055534_1000417 3300003784 Bacteria 25632
56 Ga0055534_1004074 3300003784 Bacteria 4362
57 Ga0055534_1019110 3300003784 Bacteria 1181
58 Ga0055528_1001025 3300003790 Bacteria 18500
59 Ga0055528_1001402 3300003790 Bacteria 14774
60 Ga0055528_1008560 3300003790 Bacteria 4362
61 Ga0055528_1028650 3300003790 Bacteria 1530
62 Ga0055528_1028651 3300003790 Bacteria 1530
63 Ga0055530_10000457 3300003791 Bacteria 36104
64 Ga0055530_10000547 3300003791 Bacteria 32606
65 Ga0055530_10015173 3300003791 Bacteria 2532
66 Ga0055530_10026962 3300003791 Bacteria 1576
67 Ga0055540_1000047 3300003792 Bacteria 146914
68 Ga0055540_1000950 3300003792 Bacteria 18814
69 Ga0055540_1001514 3300003792 Bacteria 13758
70 Ga0055540_1002602 3300003792 Bacteria 9393
71 Ga0055540_1003418 3300003792 Bacteria 7682
72 Ga0055540_1007972 3300003792 Bacteria 3889
73 Ga0055540_1028387 3300003792 Bacteria 1324
74 Ga0055531_10000433 3300003794 Bacteria 39688
75 Ga0055531_10002080 3300003794 Bacteria 13758
76 Ga0055531_10002810 3300003794 Bacteria 11424
77 Ga0055531_10007878 3300003794 Bacteria 5726
78 Ga0055543_1001013 3300004625 Bacteria 12503
79 Ga0055543_1003692 3300004625 Bacteria 4400
80 Ga0055543_1005079 3300004625 Bacteria 3430
81 Ga0065165_1005063 3300005262 Bacteria 7672
82 Ga0065165_1009376 3300005262 Bacteria 4400
83 Ga0065165_1029098 3300005262 Bacteria 1774
84 Ga0065165_1029128 3300005262 Bacteria 1773
85 Ga0065712_10240137 3300005290 Unclassified 986
86 Ga0065707_10844695 3300005295 Unclassified 584
87 Ga0070658_10304935 3300005327 Bacteria 1358
88 Ga0070676_10020801 3300005328 Bacteria 3667
89 Ga0070676_10394333 3300005328 Bacteria 961
90 Ga0070690_100482230 3300005330 Unclassified 925
91 Ga0070670_100186401 3300005331 Bacteria 1801
92 Ga0070670_100244491 3300005331 Bacteria 1562
93 Ga0070670_100473472 3300005331 Bacteria 1112
94 Ga0068869_100051079 3300005334 Bacteria 2999
95 Ga0070666_10223264 3300005335 Bacteria 1329
96 Ga0070680_100299329 3300005336 Bacteria 1364
97 Ga0070682_101912147 3300005337 Bacteria 520
98 Ga0068868_100481751 3300005338 Bacteria 1084
99 Ga0070660_100020620 3300005339 Bacteria 4848
100 Ga0070668_100189413 3300005347 Unclassified 1684
101 Ga0070669_100002673 3300005353 Bacteria 12838
102 Ga0070669_100091186 3300005353 Unclassified 2285
103 Ga0070675_100488999 3300005354 Bacteria 1108
104 Ga0070671_100112332 3300005355 Bacteria 2289
105 Ga0070674_100153148 3300005356 Bacteria 1741
106 Ga0070673_100017705 3300005364 Bacteria 5075
107 Ga0070673_100570205 3300005364 Bacteria 1030
108 Ga0070688_100330678 3300005365 Bacteria 1110
109 Ga0070688_101173381 3300005365 Bacteria 616
110 Ga0070667_100219115 3300005367 Bacteria 1694
111 Ga0070667_100252040 3300005367 Unclassified 1578
112 Ga0070705_100246218 3300005440 Bacteria 1252
113 Ga0070705_100491861 3300005440 Bacteria 929
114 Ga0070694_100319664 3300005444 Bacteria 1194
115 Ga0070708_100347359 3300005445 Bacteria 1398
116 Ga0070678_100199372 3300005456 Bacteria 1651
117 Ga0070678_100998677 3300005456 Bacteria 769
118 Ga0070662_100044539 3300005457 Bacteria 3179
119 Ga0070662_100638014 3300005457 Bacteria 898
120 Ga0070662_100763038 3300005457 Bacteria 821
121 Ga0070681_10020571 3300005458 Bacteria 6613
122 Ga0068867_100003586 3300005459 Bacteria 10917
123 Ga0070706_100623891 3300005467 Bacteria 1001
124 Ga0070707_100507861 3300005468 Bacteria 1167
125 Ga0070699_100382334 3300005518 Bacteria 1271
126 Ga0070679_100089580 3300005530 Bacteria 3064
127 Ga0070684_100036197 3300005535 Bacteria 4229
128 Ga0070684_100202075 3300005535 Bacteria 1810
129 Ga0068853_100020424 3300005539 Bacteria 5508
130 Ga0068853_100021089 3300005539 Bacteria 5425
131 Ga0068853_100462693 3300005539 Bacteria 1194
132 Ga0070672_100022223 3300005543 Bacteria 4654
133 Ga0070696_100192760 3300005546 Bacteria 1517
134 Ga0070665_100663247 3300005548 Bacteria 1056
135 Ga0070665_101016357 3300005548 Bacteria 841
136 Ga0070665_101074337 3300005548 Bacteria 816
137 Ga0070704_100198713 3300005549 Bacteria 1617
138 Ga0068855_100018937 3300005563 Bacteria 8276
139 Ga0068855_100033927 3300005563 Bacteria 6088
140 Ga0068855_100065866 3300005563 Bacteria 4224
141 Ga0070664_100016355 3300005564 Bacteria 6082
142 Ga0070664_100883057 3300005564 Bacteria 838
143 Ga0068857_100100359 3300005577 Bacteria 2597
144 Ga0068857_100269725 3300005577 Bacteria 1564
145 Ga0068854_100167245 3300005578 Bacteria 1708
146 Ga0068854_100755134 3300005578 Bacteria 844
147 Ga0068856_100693512 3300005614 Bacteria 1039
148 Ga0068852_100289453 3300005616 Bacteria 1582
149 Ga0068864_100158173 3300005618 Bacteria 2058
150 Ga0068861_100285353 3300005719 Bacteria 1423
151 Ga0068851_10003627 3300005834 Bacteria 6888
152 Ga0068863_100018659 3300005841 Bacteria 6637
153 Ga0068858_100017427 3300005842 Bacteria 6738
154 Ga0068862_100053515 3300005844 Bacteria 3456
155 Ga0068862_100062095 3300005844 Bacteria 3213
156 Ga0068862_100071146 3300005844 Bacteria 3004
157 Ga0068862_100105181 3300005844 Unclassified 2474
158 Ga0068862_100342033 3300005844 Bacteria 1386
159 Ga0081538_10030266 3300005981 Bacteria 3679
160 Ga0075365_10001430 3300006038 Bacteria 10792
161 Ga0075365_10449419 3300006038 Bacteria 910
162 Ga0075363_100075106 3300006048 Bacteria 1841
163 Ga0075363_100404275 3300006048 Bacteria 803
164 Ga0075364_10015136 3300006051 Bacteria 4776
165 Ga0075364_10129589 3300006051 Bacteria 1692
166 Ga0075364_10688418 3300006051 Bacteria 698
167 Ga0075432_10024090 3300006058 Bacteria 2084
168 Ga0075432_10461959 3300006058 Bacteria 559
169 Ga0070716_100009970 3300006173 Bacteria 4752
170 Ga0070716_100527196 3300006173 Bacteria 876
171 Ga0070712_100965735 3300006175 Bacteria 736
172 Ga0075362_10012179 3300006177 Bacteria 3410
173 Ga0075362_10076850 3300006177 Bacteria 1533
174 Ga0075369_10021689 3300006186 Bacteria 2643
175 Ga0075366_10012391 3300006195 Bacteria 4836
176 Ga0075366_10567782 3300006195 Bacteria 703
177 Ga0097621_100881238 3300006237 Bacteria 833
178 Ga0075370_10000897 3300006353 Bacteria 12203
179 Ga0075370_10001266 3300006353 Bacteria 10762
180 Ga0075370_10003966 3300006353 Bacteria 7110
181 Ga0075370_10444226 3300006353 Bacteria 780
182 Ga0075370_10615580 3300006353 Bacteria 658
183 Ga0068871_100035745 3300006358 Bacteria 3950
184 Ga0075428_100226017 3300006844 Bacteria 2020
185 Ga0075433_10223844 3300006852 Bacteria 1671
186 Ga0075433_10494954 3300006852 Bacteria 1076
187 Ga0075434_100197407 3300006871 Bacteria 2032
188 Ga0068865_100796125 3300006881 Bacteria 815
189 Ga0075436_100008852 3300006914 Bacteria 6886
190 Ga0079104_1035286 3300006946 Bacteria 1208
191 Ga0099826_10000022 3300006948 Bacteria 159004
192 Ga0099826_10002164 3300006948 Bacteria 12507
193 Ga0099826_10018113 3300006948 Bacteria 5320
194 Ga0099826_10074502 3300006948 Bacteria 2140
195 Ga0099794_10032045 3300007265 Bacteria 2465
196 Ga0099795_10068661 3300007788 Bacteria 1332
197 Ga0105251_10008851 3300009011 Bacteria 6029
198 Ga0105251_10040138 3300009011 Bacteria 2283
199 Ga0105244_10001326 3300009036 Bacteria 20208
200 Ga0105240_10018681 3300009093 Bacteria 9288
201 Ga0105240_10197613 3300009093 Bacteria 2359
202 Ga0105240_11410390 3300009093 Bacteria 732
203 Ga0111539_10000919 3300009094 Bacteria 38463
204 Ga0111539_10763236 3300009094 Bacteria 1125
205 Ga0114129_10123519 3300009147 Bacteria 3560
206 Ga0114129_10129546 3300009147 Bacteria 3467
207 Ga0114129_11437120 3300009147 Bacteria 850
208 Ga0105243_10000802 3300009148 Bacteria 30014
209 Ga0105243_10001807 3300009148 Bacteria 18371
210 Ga0105243_10022126 3300009148 Bacteria 4831
211 Ga0105243_10266801 3300009148 Bacteria 1535
212 Ga0105242_10691897 3300009176 Bacteria 996
213 Ga0105242_11231168 3300009176 Bacteria 769
214 Ga0105237_10434576 3300009545 Bacteria 1318
215 Ga0105237_10512134 3300009545 Bacteria 1207
216 Ga0105238_10051027 3300009551 Bacteria 4162
217 Ga0105249_10177487 3300009553 Bacteria 2070
218 Ga0105028_123472 3300009993 Bacteria 675
219 Ga0099796_10060262 3300010159 Bacteria 1343
220 Ga0099796_10132212 3300010159 Bacteria 968
221 Ga0105239_10051418 3300010375 Bacteria 4517
222 Ga0105239_10064586 3300010375 Bacteria 4018
223 Ga0105239_10828218 3300010375 Bacteria 1061
224 Ga0105239_11914033 3300010375 Bacteria 688
225 Ga0105246_10010302 3300011119 Bacteria 5778
226 Ga0105246_10131455 3300011119 Bacteria 1870
227 Ga0157347_1002655 3300012502 Bacteria 1551
228 Ga0157326_1000714 3300012513 Bacteria 3890
229 Ga0157373_10012722 3300013100 Bacteria 6184
230 Ga0157373_10204319 3300013100 Bacteria 1393
231 Ga0157371_10549497 3300013102 Bacteria 856
232 Ga0157370_10353125 3300013104 Bacteria 1355
233 Ga0157369_10017003 3300013105 Bacteria 8175
234 Ga0157378_10561956 3300013297 Bacteria 1148
235 Ga0157375_10042119 3300013308 Bacteria 4417
236 Ga0157380_10043291 3300014326 Bacteria 3524
237 Ga0157380_10244759 3300014326 Bacteria 1619
238 Ga0157380_10828388 3300014326 Bacteria 945
239 Ga0157380_11311147 3300014326 Bacteria 772
240 Ga0182008_10004833 3300014497 Bacteria 7787
241 Ga0182008_10027531 3300014497 Bacteria 2878
242 Ga0182006_1001517 3300015261 Bacteria 13902
243 Ga0182006_1136057 3300015261 Bacteria 842
244 Ga0182007_10001159 3300015262 Bacteria 14263
245 Ga0182007_10026879 3300015262 Bacteria 1990
246 Ga0163161_10000188 3300017792 Bacteria 56743
247 Ga0163161_10017313 3300017792 Bacteria 5042
248 Ga0163161_10052739 3300017792 Bacteria 2949
249 Ga0213876_10049610 3300021384 Bacteria 2218
250 Ga0209435_100008 3300025206 Bacteria 503644
251 Ga0209436_104400 3300025208 Bacteria 3491
252 Ga0209436_107124 3300025208 Bacteria 2374
253 Ga0209436_108431 3300025208 Bacteria 2053
254 Ga0209672_101002 3300025228 Bacteria 12358
255 Ga0209147_102838 3300025229 Bacteria 3847
256 Ga0209258_100022 3300025242 Bacteria 553584
257 Ga0207425_1000154 3300025245 Bacteria 58601
258 Ga0207425_1006563 3300025245 Bacteria 3168
259 Ga0207425_1014604 3300025245 Bacteria 1779
260 Ga0209646_1000079 3300025246 Bacteria 207677
261 Ga0209026_1000067 3300025250 Bacteria 207677
262 Ga0209148_1000034 3300025254 Bacteria 553584
263 Ga0209759_1000056 3300025256 Bacteria 207677
264 Ga0209129_1000023 3300025258 Bacteria 420646
265 Ga0209129_1002197 3300025258 Bacteria 9806
266 Ga0209129_1005330 3300025258 Bacteria 4598
267 Ga0209129_1036212 3300025258 Bacteria 799
268 Ga0209565_1000080 3300025263 Bacteria 156999
269 Ga0209565_1000114 3300025263 Bacteria 116078
270 Ga0209565_1000125 3300025263 Bacteria 110485
271 Ga0209565_1002434 3300025263 Bacteria 6717
272 Ga0209565_1017322 3300025263 Bacteria 1582
273 Ga0209673_1000088 3300025273 Bacteria 204629
274 Ga0209673_1000192 3300025273 Bacteria 123155
275 Ga0209673_1000572 3300025273 Bacteria 58687
276 Ga0209673_1000583 3300025273 Bacteria 57643
277 Ga0209130_1000103 3300025284 Bacteria 137115
278 Ga0209130_1000238 3300025284 Bacteria 70723
279 Ga0209130_1001296 3300025284 Bacteria 17227
280 Ga0209130_1012355 3300025284 Bacteria 2237
281 Ga0209675_1000029 3300025291 Bacteria 281053
282 Ga0209675_1000209 3300025291 Bacteria 61674
283 Ga0209675_1000403 3300025291 Bacteria 35659
284 Ga0209675_1000888 3300025291 Bacteria 19234
285 Ga0209675_1002091 3300025291 Bacteria 10603
286 Ga0209675_1032745 3300025291 Bacteria 1213
287 Ga0209676_1000005 3300025292 Bacteria 1076001
288 Ga0209676_1000073 3300025292 Bacteria 305947
289 Ga0209676_1000285 3300025292 Bacteria 104459
290 Ga0209676_1000418 3300025292 Bacteria 75214
291 Ga0209676_1001872 3300025292 Bacteria 17268
292 Ga0209676_1003651 3300025292 Bacteria 9232
293 Ga0209676_1003830 3300025292 Bacteria 8853
294 Ga0209676_1043397 3300025292 Bacteria 1241
295 Ga0209676_1057284 3300025292 Bacteria 988
296 Ga0209025_1000531 3300025294 Bacteria 72578
297 Ga0209025_1001378 3300025294 Bacteria 32585
298 Ga0209025_1001659 3300025294 Bacteria 27402
299 Ga0209025_1003871 3300025294 Bacteria 13550
300 Ga0209025_1005820 3300025294 Bacteria 9877
301 Ga0209025_1013190 3300025294 Bacteria 5217
302 Ga0209564_1000270 3300025295 Bacteria 108503
303 Ga0209564_1000817 3300025295 Bacteria 42412
304 Ga0209564_1001646 3300025295 Bacteria 21553
305 Ga0209564_1003481 3300025295 Bacteria 10728
306 Ga0209564_1005469 3300025295 Bacteria 7240
307 Ga0209758_1000064 3300025297 Bacteria 311812
308 Ga0209758_1014110 3300025297 Bacteria 4283
309 Ga0209758_1036488 3300025297 Bacteria 1917
310 Ga0209758_1045022 3300025297 Bacteria 1606
311 Ga0209050_1000007 3300025298 Bacteria 1187891
312 Ga0209050_1000008 3300025298 Bacteria 1144179
313 Ga0209050_1000570 3300025298 Bacteria 59779
314 Ga0209050_1006518 3300025298 Bacteria 6882
315 Ga0209050_1013365 3300025298 Bacteria 3653
316 Ga0209050_1015357 3300025298 Bacteria 3220
317 Ga0209050_1028845 3300025298 Bacteria 1790
318 Ga0209256_1000020 3300025299 Bacteria 542402
319 Ga0209256_1000096 3300025299 Bacteria 204629
320 Ga0209256_1002874 3300025299 Bacteria 13081
321 Ga0207426_1000001 3300025302 Bacteria 1341301
322 Ga0207426_1000031 3300025302 Bacteria 460699
323 Ga0207426_1000731 3300025302 Bacteria 37628
324 Ga0207426_1001996 3300025302 Bacteria 14430
325 Ga0209051_1000005 3300025303 Bacteria 1142353
326 Ga0209051_1000009 3300025303 Bacteria 706778
327 Ga0209051_1000327 3300025303 Bacteria 71493
328 Ga0209051_1000363 3300025303 Bacteria 66432
329 Ga0209051_1000564 3300025303 Bacteria 45000
330 Ga0209051_1008199 3300025303 Bacteria 5566
331 Ga0209051_1050011 3300025303 Bacteria 1403
332 Ga0209051_1097704 3300025303 Bacteria 798
333 Ga0209257_1000011 3300025304 Bacteria 1112630
334 Ga0209257_1000031 3300025304 Bacteria 688770
335 Ga0209257_1000502 3300025304 Bacteria 69204
336 Ga0209257_1001812 3300025304 Bacteria 23395
337 Ga0209257_1003892 3300025304 Bacteria 12178
338 Ga0209257_1017679 3300025304 Bacteria 2794
339 Ga0207656_10008004 3300025321 Bacteria 3876
340 Ga0207655_1001293 3300025728 Bacteria 23711
341 Ga0207713_1055951 3300025735 Bacteria 1536
342 Ga0207713_1119549 3300025735 Bacteria 885
343 Ga0207688_10183145 3300025901 Bacteria 1250
344 Ga0207645_10014539 3300025907 Bacteria 5265
345 Ga0207643_10049551 3300025908 Bacteria 2380
346 Ga0207705_10387058 3300025909 Unclassified 1081
347 Ga0207695_10466267 3300025913 Bacteria 1146
348 Ga0207695_10529008 3300025913 Bacteria 1060
349 Ga0207671_10189642 3300025914 Bacteria 1603
350 Ga0207671_10309713 3300025914 Bacteria 1248
351 Ga0207693_10889028 3300025915 Bacteria 684
352 Ga0207660_10408169 3300025917 Bacteria 1094
353 Ga0207662_10894968 3300025918 Bacteria 628
354 Ga0207657_10661012 3300025919 Bacteria 813
355 Ga0207646_10601023 3300025922 Bacteria 987
356 Ga0207681_10084034 3300025923 Unclassified 2255
357 Ga0207681_10585547 3300025923 Bacteria 921
358 Ga0207681_10732402 3300025923 Bacteria 823
359 Ga0207694_10074131 3300025924 Bacteria 2664
360 Ga0207694_10117824 3300025924 Bacteria 2117
361 Ga0207694_10793965 3300025924 Bacteria 800
362 Ga0207650_10032850 3300025925 Bacteria 3756
363 Ga0207650_10966352 3300025925 Bacteria 724
364 Ga0207659_10616280 3300025926 Bacteria 926
365 Ga0207706_10017972 3300025933 Bacteria 6363
366 Ga0207706_10158242 3300025933 Bacteria 1992
367 Ga0207706_10192344 3300025933 Bacteria 1791
368 Ga0207706_10421630 3300025933 Bacteria 1156
369 Ga0207709_10000529 3300025935 Bacteria 33218
370 Ga0207709_10000794 3300025935 Bacteria 24616
371 Ga0207709_10024347 3300025935 Bacteria 3456
372 Ga0207709_10539048 3300025935 Bacteria 916
373 Ga0207669_10376295 3300025937 Bacteria 1105
374 Ga0207665_10048106 3300025939 Bacteria 2861
375 Ga0207665_10726703 3300025939 Bacteria 782
376 Ga0207691_10057061 3300025940 Bacteria 3555
377 Ga0207691_11140719 3300025940 Bacteria 648
378 Ga0207689_10052706 3300025942 Bacteria 3352
379 Ga0207661_10065286 3300025944 Bacteria 2954
380 Ga0207661_10479494 3300025944 Bacteria 1135
381 Ga0207679_10021190 3300025945 Bacteria 4401
382 Ga0207679_11296676 3300025945 Bacteria 668
383 Ga0207667_10140730 3300025949 Bacteria 2484
384 Ga0207667_10247807 3300025949 Bacteria 1822
385 Ga0207667_10257275 3300025949 Bacteria 1785
386 Ga0207667_10549779 3300025949 Bacteria 1168
387 Ga0207651_10076997 3300025960 Bacteria 2386
388 Ga0207712_10068259 3300025961 Bacteria 2547
389 Ga0207640_10095653 3300025981 Bacteria 2069
390 Ga0207640_10453467 3300025981 Bacteria 1057
391 Ga0207677_10015431 3300026023 Bacteria 4493
392 Ga0207703_10021875 3300026035 Bacteria 5008
393 Ga0207703_10617247 3300026035 Unclassified 1027
394 Ga0207639_10034610 3300026041 Bacteria 3734
395 Ga0207639_10446685 3300026041 Bacteria 1173
396 Ga0207708_11575272 3300026075 Bacteria 577
397 Ga0207702_10914514 3300026078 Bacteria 869
398 Ga0207641_10022320 3300026088 Bacteria 5210
399 Ga0207648_10011428 3300026089 Bacteria 8363
400 Ga0207648_10222228 3300026089 Bacteria 1679
401 Ga0207676_10171624 3300026095 Bacteria 1890
402 Ga0207674_10046068 3300026116 Bacteria 4480
403 Ga0207674_10735321 3300026116 Bacteria 952
404 Ga0207674_10837649 3300026116 Bacteria 887
405 Ga0207675_100029259 3300026118 Bacteria 5132
406 Ga0207683_10598708 3300026121 Bacteria 1020
407 Ga0207698_10518879 3300026142 Bacteria 1162
408 Ga0209281_1038816 3300027111 Bacteria 811
409 Ga0209179_1001018 3300027512 Bacteria 3213
410 Ga0209282_1000485 3300027666 Bacteria 19354
411 Ga0209282_1001104 3300027666 Bacteria 14352
412 Ga0209971_1005249 3300027682 Bacteria 3078
413 Ga0209974_10024906 3300027876 Bacteria 1980
414 Ga0207428_10000152 3300027907 Bacteria 94307
415 Ga0207428_10406388 3300027907 Bacteria 996
416 Ga0207428_10927907 3300027907 Bacteria 614
417 Ga0268266_10815232 3300028379 Bacteria 902
418 Ga0268265_10067383 3300028380 Unclassified 2771
419 Ga0268265_10178654 3300028380 Bacteria 1822
420 Ga0307517_10052647 3300028786 Bacteria 4074
421 Ga0307517_10333679 3300028786 Bacteria 832
422 Ga0307515_10093141 3300028794 Bacteria 3740
423 Ga0316177_1134579 3300030731 Bacteria 3860
424 Ga0316176_1121982 3300030732 Bacteria 3563
425 Ga0314311_1033639 3300030733 Bacteria 2014
426 Ga0316178_1003154 3300030735 Bacteria 4530
427 Ga0316180_1086033 3300030736 Bacteria 2071
428 Ga0316183_1098709 3300030742 Bacteria 5705
429 Ga0316181_1249780 3300030744 Bacteria 1214
430 Ga0316182_1324443 3300030745 Bacteria 1593
431 Ga0265330_10000014 3300031235 Bacteria 175673
432 Ga0265332_10000011 3300031238 Bacteria 284299
433 Ga0265331_10013364 3300031250 Bacteria 4418
434 Ga0265327_10000027 3300031251 Bacteria 364541
435 Ga0307513_10000256 3300031456 Bacteria 76296
436 Ga0307513_10001864 3300031456 Bacteria 29946
437 Ga0307408_100006292 3300031548 Bacteria 7881
438 Ga0307408_100108899 3300031548 Bacteria 2124
439 Ga0307408_100605224 3300031548 Bacteria 974
440 Ga0307408_101193668 3300031548 Bacteria 709
441 Ga0307408_101245130 3300031548 Bacteria 695
442 Ga0307514_10027922 3300031649 Bacteria 4556
443 Ga0307514_10067278 3300031649 Bacteria 2704
444 Ga0265314_10000026 3300031711 Bacteria 284299
445 Ga0307516_10187548 3300031730 Bacteria 1797
446 Ga0307405_10083374 3300031731 Bacteria 2095
447 Ga0307405_10177300 3300031731 Bacteria 1526
448 Ga0307405_10334692 3300031731 Bacteria 1161
449 Ga0307405_11473646 3300031731 Bacteria 597
450 Ga0307413_10132383 3300031824 Bacteria 1709
451 Ga0307406_10010740 3300031901 Bacteria 5174
452 Ga0307406_10030715 3300031901 Bacteria 3264
453 Ga0307412_10008603 3300031911 Bacteria 5833
454 Ga0307412_10118809 3300031911 Bacteria 1900
455 Ga0307412_10166553 3300031911 Bacteria 1643
456 Ga0307412_10253645 3300031911 Bacteria 1367
457 Ga0307412_10348713 3300031911 Bacteria 1188
458 Ga0307412_11214830 3300031911 Bacteria 675
459 Ga0307412_11495132 3300031911 Bacteria 614
460 Ga0307409_100437721 3300031995 Bacteria 1259
461 Ga0307409_100474480 3300031995 Bacteria 1212
462 Ga0307416_100017223 3300032002 Bacteria 5048
463 Ga0307416_100104627 3300032002 Bacteria 2475
464 Ga0307416_100108755 3300032002 Bacteria 2437
465 Ga0307416_100539735 3300032002 Bacteria 1238
466 Ga0307416_101660968 3300032002 Bacteria 744
467 Ga0307414_10027853 3300032004 Bacteria 3657
468 Ga0307414_11175424 3300032004 Bacteria 710
469 Ga0307411_10011105 3300032005 Bacteria 4840
470 Ga0307411_10056918 3300032005 Bacteria 2580
471 Ga0307411_10198553 3300032005 Bacteria 1538
472 Ga0436365_0851258 3300039437 Bacteria 8268
473 Ga0436363_0688494 3300039450 Bacteria 3520
474 Ga0439465_0067288 3300041413 Bacteria 1195
475 Ga0451789_1328374 3300041443 Bacteria 1240
476 Ga0451793_0253438 3300041452 Bacteria 1813
477 Ga0451793_0518933 3300041452 Bacteria 1110
478 Ga0451800_0093157 3300041459 Bacteria 1280
479 Ga0451807_1087274 3300041486 Bacteria 1060
480 Ga0451807_2468035 3300041486 Bacteria 1171
481 Ga0451853_0087738 3300041512 Bacteria 1140
482 Ga0451853_1360737 3300041512 Bacteria 885
483 Ga0439445_0013272 3300042004 Bacteria 1993
484 Ga0439456_105095 3300042013 Bacteria 641
485 Ga0450923_024679 3300042125 Bacteria 1194
486 Ga0450906_047766 3300042145 Bacteria 755
487 Ga0450910_030375 3300042147 Bacteria 847
488 Ga0439446_0044737 3300042156 Bacteria 1311
489 Ga0450908_000847 3300042184 Bacteria 5898
490 Ga0439435_0328648 3300042436 Bacteria 528
491 Ga0450918_001787 3300042531 Bacteria 4192
492 Ga0453683_0968597 3300044673 Bacteria 564
493 Ga0466965_0050921 3300044683 Bacteria 2054
494 Ga0466959_0003718 3300045049 Bacteria 10076
495 Ga0495627_054274 3300046453 Bacteria 1198
496 Ga0495638_0024154 3300046460 Bacteria 3967
497 Ga0495580_0136857 3300046472 Bacteria 1698
498 Ga0495582_0441599 3300046473 Bacteria 751
499 Ga0495605_0080587 3300046474 Bacteria 1523
500 Ga0495584_0102625 3300046491 Bacteria 1446
501 Ga0495594_0197728 3300046499 Bacteria 1146
502 Ga0495596_0007565 3300046500 Bacteria 4895
503 Ga0495607_0016279 3300046501 Bacteria 4801
504 Ga0495606_0140150 3300046507 Bacteria 1429
505 Ga0495610_0013283 3300046512 Bacteria 4900
506 Ga0495616_0002711 3300046513 Bacteria 11601
507 Ga0495616_0011172 3300046513 Bacteria 5155
508 Ga0495620_0061517 3300046515 Bacteria 1562
509 Ga0495620_0135363 3300046515 Bacteria 965
510 Ga0495620_0163329 3300046515 Bacteria 865
511 Ga0495631_0009101 3300046518 Bacteria 4973
512 Ga0495637_0076686 3300046520 Bacteria 1339
513 Ga0495648_0055299 3300046524 Bacteria 2393
514 Ga0495666_0065402 3300046526 Bacteria 1734
515 Ga0495642_0385180 3300046528 Bacteria 618
516 Ga0495654_0006805 3300046530 Bacteria 6455
517 Ga0495609_0008892 3300046538 Bacteria 4887
518 Ga0495621_0069346 3300046539 Bacteria 1295
519 Ga0495597_0027982 3300046542 Bacteria 2582
520 Ga0495597_0213681 3300046542 Bacteria 768
521 Ga0495656_0018259 3300046615 Bacteria 2690
522 Ga0495611_0058799 3300046648 Bacteria 1744
523 Ga0495625_0001291 3300046660 Bacteria 31462
524 Ga0495625_0029783 3300046660 Bacteria 4079
525 Ga0495625_0145774 3300046660 Bacteria 1594
526 Ga0495625_0174108 3300046660 Bacteria 1435
527 Ga0495661_0047949 3300046665 Bacteria 2598
528 Ga0495588_0019339 3300046674 Bacteria 3335
529 Ga0495588_0119983 3300046674 Bacteria 1386
530 Ga0495588_0158083 3300046674 Bacteria 1198
531 Ga0495588_0174565 3300046674 Bacteria 1136
532 Ga0495658_0009172 3300046683 Bacteria 4919
533 Ga0495669_0056376 3300046684 Bacteria 1771
534 Ga0495624_0311035 3300046690 Bacteria 949
535 Ga0495670_0042837 3300046691 Bacteria 2259
536 Ga0495671_0002240 3300046692 Bacteria 12292
537 Ga0495671_0010757 3300046692 Bacteria 5058
538 Ga0495649_0036620 3300046694 Bacteria 2695
539 Ga0495589_0041347 3300046794 Bacteria 2301
540 Ga0495660_0060417 3300046810 Bacteria 2036
541 Ga0495636_0004542 3300047318 Bacteria 5440
542 Ga0495672_0017607 3300047320 Bacteria 4776
543 Ga0495676_0026837 3300047321 Bacteria 4949
544 Ga0495681_0261790 3300047470 Bacteria 680
545 Ga0495593_0194653 3300047673 Bacteria 1019
546 Ga0495614_0013915 3300048089 Bacteria 3526
547 Ga0495615_0212751 3300048090 Bacteria 601
548 Ga0496101_0019042 3300048904 Bacteria 4677
549 Ga0496102_1012620 3300048905 Bacteria 751
550 Ga0496106_0840096 3300048909 Bacteria 727
551 Ga0496108_0564510 3300048911 Bacteria 992
552 Ga0496110_1239158 3300048913 Bacteria 655
553 Ga0496111_0094160 3300048914 Unclassified 2197
554 Ga0496112_0255566 3300048915 Bacteria 1702
555 Ga0496116_0013551 3300048919 Bacteria 6562
556 Ga0496116_0044869 3300048919 Bacteria 2997
557 Ga0496116_0085004 3300048919 Bacteria 1946
558 Ga0496116_0304018 3300048919 Bacteria 757
559 Ga0496117_0018544 3300048920 Bacteria 5757
560 Ga0496117_0036460 3300048920 Bacteria 3679
561 Ga0496118_0103225 3300048921 Bacteria 1918
562 Ga0496119_0165653 3300048922 Bacteria 1171
563 Ga0496121_0028066 3300048924 Bacteria 5248
564 Ga0496121_0064366 3300048924 Bacteria 2990
565 Ga0496121_0091533 3300048924 Bacteria 2374
566 Ga0496121_0276714 3300048924 Bacteria 1150
567 Ga0496122_0059980 3300048925 Bacteria 2805
568 Ga0496122_0068659 3300048925 Bacteria 2543
569 Ga0496122_0086028 3300048925 Bacteria 2166
570 Ga0496122_0300964 3300048925 Bacteria 865
571 Ga0496123_0020792 3300048926 Bacteria 5122
572 Ga0496123_0030622 3300048926 Bacteria 3936
573 Ga0496123_0041787 3300048926 Bacteria 3173
574 Ga0496123_0044060 3300048926 Bacteria 3055
575 Ga0496123_0190109 3300048926 Bacteria 1063
576 Ga0496124_0008899 3300048927 Bacteria 10412
577 Ga0496124_0025510 3300048927 Bacteria 5353
578 Ga0496125_0037422 3300048928 Bacteria 4219
579 Ga0496125_0054440 3300048928 Bacteria 3269
580 Ga0496125_0104312 3300048928 Bacteria 2077
581 Ga0496125_0164985 3300048928 Bacteria 1498
582 Ga0496125_0235485 3300048928 Bacteria 1167
583 Ga0496126_0487552 3300048929 Bacteria 987
584 Ga0495678_158516 3300049459 Bacteria 725
585 Ga0501037_0038947 3300049573 Bacteria 3501
586 Ga0501249_000867 3300049679 Bacteria 6684
587 Ga0501257_119607 3300049686 Bacteria 704
588 Ga0501225_0019327 3300049705 Bacteria 1886
589 Ga0501262_000093 3300049759 Bacteria 11090
590 Ga0501035_0578099 3300049822 Bacteria 918
591 nmdc:mga03683_22005_c1 3300050489 Bacteria 2466
592 nmdc:mga03683_313736_c1 3300050489 Bacteria 737
593 nmdc:mga03683_56351_c1 3300050489 Bacteria 1652
594 nmdc:mga03n38_20693_c1 3300050490 Bacteria 2637
595 nmdc:mga03n38_318906_c1 3300050490 Bacteria 839
596 nmdc:mga03n38_45643_c1 3300050490 Bacteria 1930
597 nmdc:mga00v17_10064_c1 3300050491 Bacteria 5149
598 nmdc:mga00v17_246763_c1 3300050491 Bacteria 1158
599 nmdc:mga00v17_80922_c1 3300050491 Bacteria 2028
600 nmdc:mga0yw44_13446_c1 3300050492 Bacteria 4311
601 nmdc:mga0yw44_899936_c1 3300050492 Bacteria 600
602 nmdc:mga0k408_157450_c1 3300050493 Bacteria 1353
603 nmdc:mga0k408_186712_c1 3300050493 Bacteria 1236
604 nmdc:mga0k408_7234_c1 3300050493 Bacteria 5932
605 nmdc:mga07m45_375981_c1 3300050496 Bacteria 825
606 nmdc:mga07m45_389937_c1 3300050496 Bacteria 808
607 nmdc:mga07m45_4118_c1 3300050496 Bacteria 7097
608 nmdc:mga07m45_8950_c1 3300050496 Bacteria 5170
609 nmdc:mga07m45_9938_c1 3300050496 Bacteria 4952
610 nmdc:mga05p37_321327_c1 3300050507 Bacteria 1832
611 nmdc:mga05p37_347711_c2 3300050507 Bacteria 1345
612 nmdc:mga05p37_918535_c1 3300050507 Bacteria 941
613 nmdc:mga06r32_1194049_c1 3300050510 Bacteria 707
614 nmdc:mga06r32_1361325_c1 3300050510 Bacteria 652
615 nmdc:mga08y16_474866_c1 3300050511 Bacteria 1273
616 nmdc:mga08y16_54_c1 3300050511 Bacteria 102957
617 nmdc:mga0n895_167478_c1 3300050512 Bacteria 2229
618 nmdc:mga08x19_64770_c1 3300050514 Bacteria 2373
619 nmdc:mga0a205_530846_c1 3300050515 Bacteria 1033
620 nmdc:mga0sz30_179802_c1 3300050516 Bacteria 938
621 Ga0500610_0001085 3300053079 Bacteria 8937
622 Ga0500610_0001382 3300053079 Bacteria 8228
623 Ga0500643_002259 3300053087 Bacteria 10132
624 Ga0500644_0008163 3300053088 Bacteria 2755
625 Ga0500647_0235253 3300053091 Bacteria 813
626 Ga0500651_0000263 3300053093 Bacteria 31317
627 Ga0500566_0013376 3300053094 Bacteria 4833
628 Ga0500566_0164633 3300053094 Bacteria 1152
629 Ga0500650_0085302 3300053098 Bacteria 1478
630 Ga0500560_018400 3300053107 Bacteria 1947
631 Ga0500571_000529 3300053110 Bacteria 15703
632 Ga0500593_000756 3300053117 Bacteria 12138
633 Ga0500593_001588 3300053117 Bacteria 8179
634 Ga0500594_0000967 3300053118 Bacteria 6176
635 Ga0500597_031758 3300053120 Bacteria 2177
636 Ga0500607_001975 3300053121 Bacteria 17413
637 Ga0500607_094037 3300053121 Bacteria 1502
638 Ga0500614_151984 3300053123 Bacteria 697
639 Ga0500626_162313 3300053128 Bacteria 917
640 Ga0500655_000174 3300053133 Bacteria 15748
641 Ga0500658_0000517 3300053134 Bacteria 16395
642 Ga0500658_0000583 3300053134 Bacteria 15377
643 Ga0500559_0002747 3300053136 Bacteria 8928
644 Ga0500561_0049622 3300053137 Bacteria 1140
645 Ga0500564_025460 3300053138 Bacteria 2717
646 Ga0500568_0001222 3300053139 Bacteria 17151
647 Ga0500574_002592 3300053141 Bacteria 3010
648 Ga0500619_195616 3300053154 Bacteria 680
649 Ga0500620_249953 3300053155 Bacteria 590
650 Ga0500627_0005114 3300053158 Bacteria 4312
651 Ga0500634_0015120 3300053161 Bacteria 4091
652 Ga0500634_0015329 3300053161 Bacteria 4068
653 Ga0500638_008052 3300053162 Bacteria 4466
654 Ga0500636_0308497 3300053177 Bacteria 775
655 Ga0500625_098473 3300053729 Bacteria 1232
656 Ga0500645_002194 3300053730 Bacteria 8924
657 Ga0500645_003711 3300053730 Bacteria 6086
658 Ga0500645_009996 3300053730 Bacteria 3160

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042436 Ga0439435_0328648 Ga0439435_0328648_114_509 131
2 3300006173 Ga0070716_100527196 Ga0070716_1005271962 137
3 3300007265 Ga0099794_10032045 Ga0099794_100320452 137
4 3300010159 Ga0099796_10132212 Ga0099796_101322122 137
5 3300025939 Ga0207665_10726703 Ga0207665_107267032 137
6 3300026075 Ga0207708_11575272 Ga0207708_115752722 137
7 3300047318 Ga0495636_0004542 Ga0495636_0004542_2289_2702 137
8 3300050514 nmdc:mga08x19_64770_c1 nmdc:mga08x19_64770_c1_1277_1690 137
9 3300041486 Ga0451807_1087274 Ga0451807_1087274_25_465 144
10 3300053161 Ga0500634_0015329 Ga0500634_0015329_293_817 148
11 3300005535 Ga0070684_100202075 Ga0070684_1002020752 149
12 3300048090 Ga0495615_0212751 Ga0495615_0212751_104_553 149
13 iso_pu_bacteria 2513020051 2513231023 149
14 iso_pu_bacteria 2643221658 2644328037 149
15 iso_pu_bacteria 2643221672 2644398656 149
16 iso_pu_bacteria 2599185214 2599624468 150
17 iso_pu_bacteria 2599185226 2599672670 150
18 iso_pu_bacteria 2599185227 2599683670 150
19 iso_pu_bacteria 2599185229 2599694279 150
20 iso_pu_bacteria 2643221683 2644468548 150
21 iso_pu_bacteria 2738541307 2738881771 150
22 iso_pu_bacteria 2818991446 2819595882 150
23 iso_pu_bacteria 2831265667 2831266969 150
24 iso_pu_bacteria 2885198086 2885198973 150
25 iso_pu_bacteria 2885211737 2885212764 150
26 iso_pu_bacteria 2899924645 2899925230 150
27 iso_pu_bacteria 2928037797 2928038647 150
28 iso_pu_bacteria 2928044640 2928045748 150
29 iso_pu_bacteria 2928051484 2928053365 150
30 iso_pu_bacteria 2928064002 2928066970 150
31 iso_pu_bacteria 2928070936 2928071132 150
32 iso_pu_bacteria 2928084124 2928084924 150
33 3300003323 rootH1_10403597 rootH1_104035972 151
34 3300005468 Ga0070707_100507861 Ga0070707_1005078612 151
35 3300005518 Ga0070699_100382334 Ga0070699_1003823342 151
36 3300005563 Ga0068855_100018937 Ga0068855_1000189371 151
37 3300006173 Ga0070716_100009970 Ga0070716_1000099704 151
38 3300006914 Ga0075436_100008852 Ga0075436_1000088522 151
39 3300007788 Ga0099795_10068661 Ga0099795_100686612 151
40 3300010159 Ga0099796_10060262 Ga0099796_100602622 151
41 3300025909 Ga0207705_10387058 Ga0207705_103870581 151
42 3300025922 Ga0207646_10601023 Ga0207646_106010232 151
43 3300025939 Ga0207665_10048106 Ga0207665_100481062 151
44 3300025949 Ga0207667_10257275 Ga0207667_102572751 151
45 3300027512 Ga0209179_1001018 Ga0209179_10010183 151
46 iso_pu_bacteria 2791355260 2793324348 151
47 iso_pu_bacteria 2838022645 2838025396 151
48 iso_pu_bacteria 2842198810 2842200964 151
49 iso_pu_bacteria 2842677519 2842678834 151
50 iso_pu_bacteria 2919462493 2919465885 151
51 3300003323 rootH1_10276335 rootH1_102763352 152
52 3300005548 Ga0070665_100663247 Ga0070665_1006632472 152
53 3300005842 Ga0068858_100017427 Ga0068858_1000174274 152
54 3300026035 Ga0207703_10021875 Ga0207703_100218754 152
55 iso_pu_bacteria 2765235841 2765583753 152
56 iso_pu_bacteria 2945909444 2945912389 152
57 iso_pu_bacteria 2945984333 2945985297 152
58 iso_pu_bacteria 8054929484 8054931465 152
59 3300003781 Ga0055536_1020823 Ga0055536_10208232 153
60 3300003791 Ga0055530_10026962 Ga0055530_100269623 153
61 3300003792 Ga0055540_1001514 Ga0055540_10015148 153
62 3300003794 Ga0055531_10002080 Ga0055531_100020808 153
63 3300005331 Ga0070670_100473472 Ga0070670_1004734722 153
64 3300005335 Ga0070666_10223264 Ga0070666_102232642 153
65 3300005354 Ga0070675_100488999 Ga0070675_1004889992 153
66 3300005356 Ga0070674_100153148 Ga0070674_1001531482 153
67 3300005440 Ga0070705_100246218 Ga0070705_1002462182 153
68 3300005444 Ga0070694_100319664 Ga0070694_1003196641 153
69 3300005457 Ga0070662_100638014 Ga0070662_1006380142 153
70 3300005546 Ga0070696_100192760 Ga0070696_1001927602 153
71 3300005549 Ga0070704_100198713 Ga0070704_1001987133 153
72 3300005564 Ga0070664_100016355 Ga0070664_1000163557 153
73 3300005577 Ga0068857_100100359 Ga0068857_1001003593 153
74 3300006237 Ga0097621_100881238 Ga0097621_1008812382 153
75 3300006353 Ga0075370_10003966 Ga0075370_100039665 153
76 3300009036 Ga0105244_10001326 Ga0105244_1000132611 153
77 3300009148 Ga0105243_10001807 Ga0105243_100018075 153
78 3300009176 Ga0105242_10691897 Ga0105242_106918971 153
79 3300009545 Ga0105237_10512134 Ga0105237_105121342 153
80 3300011119 Ga0105246_10010302 Ga0105246_100103022 153
81 3300014326 Ga0157380_10828388 Ga0157380_108283881 153
82 3300014497 Ga0182008_10004833 Ga0182008_100048336 153
83 3300015261 Ga0182006_1001517 Ga0182006_10015175 153
84 3300015262 Ga0182007_10001159 Ga0182007_100011595 153
85 3300025292 Ga0209676_1001872 Ga0209676_10018725 153
86 3300025298 Ga0209050_1000570 Ga0209050_100057053 153
87 3300025303 Ga0209051_1000564 Ga0209051_100056440 153
88 3300025304 Ga0209257_1000502 Ga0209257_100050256 153
89 3300025728 Ga0207655_1001293 Ga0207655_100129315 153
90 3300025901 Ga0207688_10183145 Ga0207688_101831451 153
91 3300025923 Ga0207681_10585547 Ga0207681_105855471 153
92 3300025924 Ga0207694_10074131 Ga0207694_100741312 153
93 3300025926 Ga0207659_10616280 Ga0207659_106162802 153
94 3300025933 Ga0207706_10017972 Ga0207706_100179727 153
95 3300025933 Ga0207706_10421630 Ga0207706_104216302 153
96 3300025935 Ga0207709_10000794 Ga0207709_1000079414 153
97 3300025940 Ga0207691_11140719 Ga0207691_111407192 153
98 3300025945 Ga0207679_10021190 Ga0207679_100211905 153
99 3300025949 Ga0207667_10549779 Ga0207667_105497792 153
100 3300026116 Ga0207674_10046068 Ga0207674_100460682 153
101 3300032002 Ga0307416_101660968 Ga0307416_1016609681 153
102 3300048905 Ga0496102_1012620 Ga0496102_1012620_109_570 153
103 3300048913 Ga0496110_1239158 Ga0496110_1239158_97_558 153
104 3300048919 Ga0496116_0013551 Ga0496116_0013551_4089_4550 153
105 3300048920 Ga0496117_0036460 Ga0496117_0036460_1221_1682 153
106 3300048921 Ga0496118_0103225 Ga0496118_0103225_130_591 153
107 3300048924 Ga0496121_0091533 Ga0496121_0091533_463_924 153
108 3300048928 Ga0496125_0164985 Ga0496125_0164985_172_633 153
109 3300050490 nmdc:mga03n38_45643_c1 nmdc:mga03n38_45643_c1_512_973 153
110 3300050496 nmdc:mga07m45_8950_c1 nmdc:mga07m45_8950_c1_619_1080 153
111 iso_pu_bacteria 2511231002 2511246299 153
112 iso_pu_bacteria 2513237150 2513957013 153
113 iso_pu_bacteria 2513237165 2514043175 153
114 iso_pu_bacteria 2738541277 2738720231 153
115 iso_pu_bacteria 2738543019 2739279430 153
116 iso_pu_bacteria 644736347 644749404 153
117 3300002773 JGI25152J39213_1001121 JGI25152J39213_10011214 154
118 3300002773 JGI25152J39213_1004181 JGI25152J39213_10041816 154
119 3300002774 JGI25150J39212_1000556 JGI25150J39212_10005564 154
120 3300002774 JGI25150J39212_1010834 JGI25150J39212_10108342 154
121 3300002987 JGI25159J45721_1004621 JGI25159J45721_10046214 154
122 3300003187 JGI25151J46595_10009784 JGI25151J46595_100097844 154
123 3300003187 JGI25151J46595_10034889 JGI25151J46595_100348892 154
124 3300003215 JGI25153J46596_10009924 JGI25153J46596_100099243 154
125 3300003215 JGI25153J46596_10028831 JGI25153J46596_100288312 154
126 3300003316 rootH1_10045273 rootH1_100452735 154
127 3300003320 rootH2_10070709 rootH2_100707096 154
128 3300003322 rootL2_10069764 rootL2_100697642 154
129 3300003323 rootH1_10057228 rootH1_100572283 154
130 3300003354 JGI25160J50197_1006922 JGI25160J50197_10069224 154
131 3300003354 JGI25160J50197_1010866 JGI25160J50197_10108663 154
132 3300003374 JGI25161J50226_1002668 JGI25161J50226_10026683 154
133 3300003374 JGI25161J50226_1002758 JGI25161J50226_10027584 154
134 3300003761 Ga0055535_1000507 Ga0055535_100050714 154
135 3300003762 Ga0055542_1000004 Ga0055542_100000489 154
136 3300003771 Ga0055526_1010324 Ga0055526_10103243 154
137 3300003771 Ga0055526_1031110 Ga0055526_10311102 154
138 3300003773 Ga0055537_1003982 Ga0055537_10039823 154
139 3300003773 Ga0055537_1013497 Ga0055537_10134972 154
140 3300003775 Ga0055524_1008191 Ga0055524_10081913 154
141 3300003775 Ga0055524_1008253 Ga0055524_10082533 154
142 3300003781 Ga0055536_1004573 Ga0055536_10045733 154
143 3300003781 Ga0055536_1021460 Ga0055536_10214603 154
144 3300003784 Ga0055534_1004074 Ga0055534_10040743 154
145 3300003784 Ga0055534_1019110 Ga0055534_10191102 154
146 3300003790 Ga0055528_1008560 Ga0055528_10085603 154
147 3300003790 Ga0055528_1028650 Ga0055528_10286502 154
148 3300003790 Ga0055528_1028651 Ga0055528_10286512 154
149 3300003791 Ga0055530_10000547 Ga0055530_100005476 154
150 3300003792 Ga0055540_1002602 Ga0055540_10026026 154
151 3300003792 Ga0055540_1007972 Ga0055540_10079722 154
152 3300003792 Ga0055540_1028387 Ga0055540_10283872 154
153 3300003794 Ga0055531_10002810 Ga0055531_100028106 154
154 3300003794 Ga0055531_10007878 Ga0055531_100078786 154
155 3300004625 Ga0055543_1003692 Ga0055543_10036924 154
156 3300004625 Ga0055543_1005079 Ga0055543_10050793 154
157 3300005262 Ga0065165_1009376 Ga0065165_10093764 154
158 3300005328 Ga0070676_10394333 Ga0070676_103943332 154
159 3300005337 Ga0070682_101912147 Ga0070682_1019121471 154
160 3300005457 Ga0070662_100763038 Ga0070662_1007630382 154
161 3300005539 Ga0068853_100021089 Ga0068853_1000210895 154
162 3300005539 Ga0068853_100462693 Ga0068853_1004626932 154
163 3300005548 Ga0070665_101016357 Ga0070665_1010163572 154
164 3300005548 Ga0070665_101074337 Ga0070665_1010743371 154
165 3300005563 Ga0068855_100065866 Ga0068855_1000658663 154
166 3300005564 Ga0070664_100883057 Ga0070664_1008830572 154
167 3300005577 Ga0068857_100269725 Ga0068857_1002697252 154
168 3300005578 Ga0068854_100167245 Ga0068854_1001672452 154
169 3300005616 Ga0068852_100289453 Ga0068852_1002894532 154
170 3300005834 Ga0068851_10003627 Ga0068851_100036273 154
171 3300006051 Ga0075364_10688418 Ga0075364_106884181 154
172 3300009093 Ga0105240_11410390 Ga0105240_114103902 154
173 3300009148 Ga0105243_10000802 Ga0105243_1000080227 154
174 3300009545 Ga0105237_10434576 Ga0105237_104345763 154
175 3300010375 Ga0105239_10051418 Ga0105239_100514186 154
176 3300010375 Ga0105239_10064586 Ga0105239_100645864 154
177 3300010375 Ga0105239_10828218 Ga0105239_108282182 154
178 3300010375 Ga0105239_11914033 Ga0105239_119140331 154
179 3300013100 Ga0157373_10204319 Ga0157373_102043192 154
180 3300013102 Ga0157371_10549497 Ga0157371_105494971 154
181 3300013104 Ga0157370_10353125 Ga0157370_103531252 154
182 3300013105 Ga0157369_10017003 Ga0157369_100170037 154
183 3300017792 Ga0163161_10017313 Ga0163161_100173135 154
184 3300025208 Ga0209436_104400 Ga0209436_1044003 154
185 3300025208 Ga0209436_107124 Ga0209436_1071243 154
186 3300025228 Ga0209672_101002 Ga0209672_1010026 154
187 3300025229 Ga0209147_102838 Ga0209147_1028384 154
188 3300025242 Ga0209258_100022 Ga0209258_10002289 154
189 3300025245 Ga0207425_1000154 Ga0207425_100015436 154
190 3300025245 Ga0207425_1014604 Ga0207425_10146043 154
191 3300025254 Ga0209148_1000034 Ga0209148_100003489 154
192 3300025258 Ga0209129_1000023 Ga0209129_1000023168 154
193 3300025258 Ga0209129_1005330 Ga0209129_10053305 154
194 3300025263 Ga0209565_1000125 Ga0209565_100012536 154
195 3300025263 Ga0209565_1017322 Ga0209565_10173222 154
196 3300025273 Ga0209673_1000192 Ga0209673_100019241 154
197 3300025273 Ga0209673_1000583 Ga0209673_100058336 154
198 3300025284 Ga0209130_1001296 Ga0209130_10012966 154
199 3300025284 Ga0209130_1012355 Ga0209130_10123552 154
200 3300025291 Ga0209675_1000403 Ga0209675_100040328 154
201 3300025291 Ga0209675_1002091 Ga0209675_10020919 154
202 3300025291 Ga0209675_1032745 Ga0209675_10327452 154
203 3300025292 Ga0209676_1000005 Ga0209676_1000005634 154
204 3300025292 Ga0209676_1000285 Ga0209676_100028541 154
205 3300025292 Ga0209676_1003651 Ga0209676_10036514 154
206 3300025292 Ga0209676_1043397 Ga0209676_10433972 154
207 3300025294 Ga0209025_1001378 Ga0209025_10013786 154
208 3300025294 Ga0209025_1005820 Ga0209025_10058207 154
209 3300025295 Ga0209564_1000270 Ga0209564_100027062 154
210 3300025295 Ga0209564_1000817 Ga0209564_100081736 154
211 3300025297 Ga0209758_1000064 Ga0209758_100006469 154
212 3300025297 Ga0209758_1036488 Ga0209758_10364882 154
213 3300025298 Ga0209050_1000007 Ga0209050_1000007463 154
214 3300025298 Ga0209050_1006518 Ga0209050_10065183 154
215 3300025299 Ga0209256_1000020 Ga0209256_1000020440 154
216 3300025299 Ga0209256_1002874 Ga0209256_10028746 154
217 3300025302 Ga0207426_1000001 Ga0207426_10000011075 154
218 3300025302 Ga0207426_1000031 Ga0207426_1000031152 154
219 3300025303 Ga0209051_1000009 Ga0209051_1000009634 154
220 3300025303 Ga0209051_1008199 Ga0209051_10081996 154
221 3300025303 Ga0209051_1050011 Ga0209051_10500112 154
222 3300025303 Ga0209051_1097704 Ga0209051_10977041 154
223 3300025304 Ga0209257_1000011 Ga0209257_1000011608 154
224 3300025304 Ga0209257_1001812 Ga0209257_10018126 154
225 3300025321 Ga0207656_10008004 Ga0207656_100080041 154
226 3300025913 Ga0207695_10529008 Ga0207695_105290082 154
227 3300025914 Ga0207671_10189642 Ga0207671_101896422 154
228 3300025914 Ga0207671_10309713 Ga0207671_103097132 154
229 3300025924 Ga0207694_10793965 Ga0207694_107939652 154
230 3300025933 Ga0207706_10158242 Ga0207706_101582422 154
231 3300025935 Ga0207709_10000529 Ga0207709_1000052921 154
232 3300025949 Ga0207667_10140730 Ga0207667_101407302 154
233 3300025981 Ga0207640_10095653 Ga0207640_100956532 154
234 3300026041 Ga0207639_10034610 Ga0207639_100346103 154
235 3300026041 Ga0207639_10446685 Ga0207639_104466852 154
236 3300026116 Ga0207674_10837649 Ga0207674_108376492 154
237 3300026142 Ga0207698_10518879 Ga0207698_105188791 154
238 3300028379 Ga0268266_10815232 Ga0268266_108152321 154
239 3300028794 Ga0307515_10093141 Ga0307515_100931412 154
240 3300032002 Ga0307416_100108755 Ga0307416_1001087552 154
241 3300032005 Ga0307411_10056918 Ga0307411_100569182 154
242 3300041443 Ga0451789_1328374 Ga0451789_1328374_402_866 154
243 3300041452 Ga0451793_0253438 Ga0451793_0253438_848_1384 154
244 3300041486 Ga0451807_2468035 Ga0451807_2468035_258_722 154
245 3300041512 Ga0451853_1360737 Ga0451853_1360737_60_596 154
246 3300046453 Ga0495627_054274 Ga0495627_054274_127_591 154
247 3300046460 Ga0495638_0024154 Ga0495638_0024154_660_1124 154
248 3300046473 Ga0495582_0441599 Ga0495582_0441599_123_587 154
249 3300046513 Ga0495616_0002711 Ga0495616_0002711_6901_7365 154
250 3300046515 Ga0495620_0061517 Ga0495620_0061517_552_1016 154
251 3300046518 Ga0495631_0009101 Ga0495631_0009101_79_543 154
252 3300046520 Ga0495637_0076686 Ga0495637_0076686_699_1163 154
253 3300046530 Ga0495654_0006805 Ga0495654_0006805_2090_2554 154
254 3300046539 Ga0495621_0069346 Ga0495621_0069346_640_1104 154
255 3300046660 Ga0495625_0029783 Ga0495625_0029783_1368_1832 154
256 3300046674 Ga0495588_0019339 Ga0495588_0019339_1389_1853 154
257 3300046674 Ga0495588_0174565 Ga0495588_0174565_606_1070 154
258 3300046683 Ga0495658_0009172 Ga0495658_0009172_2188_2652 154
259 3300047321 Ga0495676_0026837 Ga0495676_0026837_3174_3638 154
260 3300047673 Ga0495593_0194653 Ga0495593_0194653_478_942 154
261 3300048089 Ga0495614_0013915 Ga0495614_0013915_1716_2180 154
262 3300048909 Ga0496106_0840096 Ga0496106_0840096_190_660 154
263 3300048919 Ga0496116_0044869 Ga0496116_0044869_1105_1569 154
264 3300048920 Ga0496117_0018544 Ga0496117_0018544_1312_1776 154
265 3300048922 Ga0496119_0165653 Ga0496119_0165653_608_1072 154
266 3300048924 Ga0496121_0028066 Ga0496121_0028066_418_882 154
267 3300048924 Ga0496121_0276714 Ga0496121_0276714_599_1063 154
268 3300048925 Ga0496122_0068659 Ga0496122_0068659_1140_1604 154
269 3300048925 Ga0496122_0086028 Ga0496122_0086028_1459_1923 154
270 3300048925 Ga0496122_0300964 Ga0496122_0300964_391_855 154
271 3300048926 Ga0496123_0030622 Ga0496123_0030622_432_896 154
272 3300048926 Ga0496123_0041787 Ga0496123_0041787_1437_1901 154
273 3300048926 Ga0496123_0044060 Ga0496123_0044060_1051_1515 154
274 3300048926 Ga0496123_0190109 Ga0496123_0190109_405_869 154
275 3300048927 Ga0496124_0025510 Ga0496124_0025510_393_857 154
276 3300048928 Ga0496125_0037422 Ga0496125_0037422_3106_3570 154
277 3300048928 Ga0496125_0235485 Ga0496125_0235485_433_897 154
278 3300048929 Ga0496126_0487552 Ga0496126_0487552_396_860 154
279 3300049459 Ga0495678_158516 Ga0495678_158516_164_628 154
280 3300050491 nmdc:mga00v17_10064_c1 nmdc:mga00v17_10064_c1_4367_4831 154
281 3300053087 Ga0500643_002259 Ga0500643_002259_4205_4669 154
282 3300053093 Ga0500651_0000263 Ga0500651_0000263_5327_5791 154
283 3300053094 Ga0500566_0013376 Ga0500566_0013376_1036_1500 154
284 3300053107 Ga0500560_018400 Ga0500560_018400_82_546 154
285 3300053110 Ga0500571_000529 Ga0500571_000529_9963_10427 154
286 3300053118 Ga0500594_0000967 Ga0500594_0000967_1958_2422 154
287 3300053120 Ga0500597_031758 Ga0500597_031758_176_640 154
288 3300053123 Ga0500614_151984 Ga0500614_151984_215_679 154
289 3300053128 Ga0500626_162313 Ga0500626_162313_101_565 154
290 3300053133 Ga0500655_000174 Ga0500655_000174_5277_5741 154
291 3300053134 Ga0500658_0000517 Ga0500658_0000517_14596_15060 154
292 3300053134 Ga0500658_0000583 Ga0500658_0000583_410_874 154
293 3300053136 Ga0500559_0002747 Ga0500559_0002747_787_1251 154
294 3300053137 Ga0500561_0049622 Ga0500561_0049622_363_827 154
295 3300053138 Ga0500564_025460 Ga0500564_025460_1403_1867 154
296 3300053139 Ga0500568_0001222 Ga0500568_0001222_4356_4820 154
297 3300053141 Ga0500574_002592 Ga0500574_002592_2174_2638 154
298 3300053154 Ga0500619_195616 Ga0500619_195616_200_664 154
299 3300053155 Ga0500620_249953 Ga0500620_249953_82_546 154
300 3300053161 Ga0500634_0015120 Ga0500634_0015120_2650_3114 154
301 3300053162 Ga0500638_008052 Ga0500638_008052_2264_2728 154
302 3300053177 Ga0500636_0308497 Ga0500636_0308497_38_502 154
303 iso_pu_bacteria 2643221628 2644159476 154
304 iso_pu_bacteria 2904449895 2904454551 154
305 iso_pu_bacteria 2904456579 2904461006 154
306 iso_pu_bacteria 2929520902 2929526890 154
307 iso_pu_bacteria 2945945610 2945948309 154
308 iso_pu_bacteria 2945972063 2945977048 154
309 3300005364 Ga0070673_100570205 Ga0070673_1005702052 155
310 3300005365 Ga0070688_101173381 Ga0070688_1011733811 155
311 3300005367 Ga0070667_100219115 Ga0070667_1002191152 155
312 3300005445 Ga0070708_100347359 Ga0070708_1003473592 155
313 3300006946 Ga0079104_1035286 Ga0079104_10352862 155
314 3300014326 Ga0157380_11311147 Ga0157380_113111471 155
315 3300015261 Ga0182006_1136057 Ga0182006_11360571 155
316 3300025937 Ga0207669_10376295 Ga0207669_103762952 155
317 3300027111 Ga0209281_1038816 Ga0209281_10388161 155
318 3300028786 Ga0307517_10052647 Ga0307517_100526472 155
319 3300030731 Ga0316177_1134579 Ga0316177_11345792 155
320 3300030732 Ga0316176_1121982 Ga0316176_11219822 155
321 3300030733 Ga0314311_1033639 Ga0314311_10336392 155
322 3300030735 Ga0316178_1003154 Ga0316178_10031544 155
323 3300030736 Ga0316180_1086033 Ga0316180_10860332 155
324 3300030742 Ga0316183_1098709 Ga0316183_10987095 155
325 3300030744 Ga0316181_1249780 Ga0316181_12497801 155
326 3300030745 Ga0316182_1324443 Ga0316182_13244433 155
327 3300031548 Ga0307408_101245130 Ga0307408_1012451302 155
328 3300031649 Ga0307514_10067278 Ga0307514_100672781 155
329 3300031731 Ga0307405_10334692 Ga0307405_103346922 155
330 3300031911 Ga0307412_10166553 Ga0307412_101665532 155
331 3300041452 Ga0451793_0518933 Ga0451793_0518933_605_1072 155
332 3300049679 Ga0501249_000867 Ga0501249_000867_4882_5412 155
333 3300049705 Ga0501225_0019327 Ga0501225_0019327_710_1240 155
334 3300003781 Ga0055536_1002065 Ga0055536_10020658 156
335 3300003792 Ga0055540_1000950 Ga0055540_100095011 156
336 3300005290 Ga0065712_10240137 Ga0065712_102401372 156
337 3300005295 Ga0065707_10844695 Ga0065707_108446951 156
338 3300005330 Ga0070690_100482230 Ga0070690_1004822302 156
339 3300005347 Ga0070668_100189413 Ga0070668_1001894133 156
340 3300005353 Ga0070669_100091186 Ga0070669_1000911862 156
341 3300005367 Ga0070667_100252040 Ga0070667_1002520402 156
342 3300005440 Ga0070705_100491861 Ga0070705_1004918611 156
343 3300005458 Ga0070681_10020571 Ga0070681_100205715 156
344 3300005467 Ga0070706_100623891 Ga0070706_1006238912 156
345 3300005535 Ga0070684_100036197 Ga0070684_1000361973 156
346 3300005614 Ga0068856_100693512 Ga0068856_1006935122 156
347 3300005618 Ga0068864_100158173 Ga0068864_1001581733 156
348 3300005719 Ga0068861_100285353 Ga0068861_1002853532 156
349 3300005841 Ga0068863_100018659 Ga0068863_1000186599 156
350 3300005844 Ga0068862_100105181 Ga0068862_1001051812 156
351 3300006175 Ga0070712_100965735 Ga0070712_1009657352 156
352 3300006852 Ga0075433_10223844 Ga0075433_102238444 156
353 3300006871 Ga0075434_100197407 Ga0075434_1001974072 156
354 3300006948 Ga0099826_10000022 Ga0099826_10000022120 156
355 3300009011 Ga0105251_10008851 Ga0105251_100088514 156
356 3300009011 Ga0105251_10040138 Ga0105251_100401382 156
357 3300009147 Ga0114129_10123519 Ga0114129_101235194 156
358 3300013297 Ga0157378_10561956 Ga0157378_105619562 156
359 3300017792 Ga0163161_10000188 Ga0163161_1000018836 156
360 3300021384 Ga0213876_10049610 Ga0213876_100496102 156
361 3300025292 Ga0209676_1000418 Ga0209676_100041855 156
362 3300025298 Ga0209050_1028845 Ga0209050_10288452 156
363 3300025303 Ga0209051_1000327 Ga0209051_100032736 156
364 3300025304 Ga0209257_1003892 Ga0209257_10038927 156
365 3300025735 Ga0207713_1055951 Ga0207713_10559512 156
366 3300025735 Ga0207713_1119549 Ga0207713_11195492 156
367 3300025908 Ga0207643_10049551 Ga0207643_100495513 156
368 3300025915 Ga0207693_10889028 Ga0207693_108890281 156
369 3300025917 Ga0207660_10408169 Ga0207660_104081692 156
370 3300025923 Ga0207681_10084034 Ga0207681_100840342 156
371 3300025944 Ga0207661_10065286 Ga0207661_100652863 156
372 3300025944 Ga0207661_10479494 Ga0207661_104794942 156
373 3300025961 Ga0207712_10068259 Ga0207712_100682593 156
374 3300026035 Ga0207703_10617247 Ga0207703_106172471 156
375 3300026078 Ga0207702_10914514 Ga0207702_109145142 156
376 3300026088 Ga0207641_10022320 Ga0207641_100223205 156
377 3300026095 Ga0207676_10171624 Ga0207676_101716243 156
378 3300027666 Ga0209282_1000485 Ga0209282_10004855 156
379 3300027682 Ga0209971_1005249 Ga0209971_10052493 156
380 3300027876 Ga0209974_10024906 Ga0209974_100249062 156
381 3300028380 Ga0268265_10067383 Ga0268265_100673835 156
382 3300031731 Ga0307405_10083374 Ga0307405_100833744 156
383 3300031911 Ga0307412_10008603 Ga0307412_100086032 156
384 3300032004 Ga0307414_10027853 Ga0307414_100278533 156
385 3300039437 Ga0436365_0851258 Ga0436365_0851258_2648_3124 156
386 3300039450 Ga0436363_0688494 Ga0436363_0688494_508_984 156
387 3300044683 Ga0466965_0050921 Ga0466965_0050921_631_1101 156
388 3300045049 Ga0466959_0003718 Ga0466959_0003718_2442_2912 156
389 3300046474 Ga0495605_0080587 Ga0495605_0080587_714_1184 156
390 3300046491 Ga0495584_0102625 Ga0495584_0102625_397_867 156
391 3300046500 Ga0495596_0007565 Ga0495596_0007565_1286_1756 156
392 3300046501 Ga0495607_0016279 Ga0495607_0016279_3274_3744 156
393 3300046507 Ga0495606_0140150 Ga0495606_0140150_724_1194 156
394 3300046512 Ga0495610_0013283 Ga0495610_0013283_3278_3748 156
395 3300046513 Ga0495616_0011172 Ga0495616_0011172_1366_1836 156
396 3300046515 Ga0495620_0163329 Ga0495620_0163329_49_519 156
397 3300046524 Ga0495648_0055299 Ga0495648_0055299_1018_1488 156
398 3300046528 Ga0495642_0385180 Ga0495642_0385180_101_574 156
399 3300046538 Ga0495609_0008892 Ga0495609_0008892_3261_3731 156
400 3300046542 Ga0495597_0027982 Ga0495597_0027982_798_1268 156
401 3300046542 Ga0495597_0213681 Ga0495597_0213681_282_752 156
402 3300046615 Ga0495656_0018259 Ga0495656_0018259_1302_1772 156
403 3300046648 Ga0495611_0058799 Ga0495611_0058799_886_1356 156
404 3300046665 Ga0495661_0047949 Ga0495661_0047949_964_1434 156
405 3300046684 Ga0495669_0056376 Ga0495669_0056376_373_843 156
406 3300046691 Ga0495670_0042837 Ga0495670_0042837_1006_1476 156
407 3300046692 Ga0495671_0010757 Ga0495671_0010757_3331_3801 156
408 3300046694 Ga0495649_0036620 Ga0495649_0036620_1214_1684 156
409 3300046794 Ga0495589_0041347 Ga0495589_0041347_1148_1618 156
410 3300047320 Ga0495672_0017607 Ga0495672_0017607_3246_3716 156
411 3300048911 Ga0496108_0564510 Ga0496108_0564510_199_669 156
412 3300048914 Ga0496111_0094160 Ga0496111_0094160_1406_1876 156
413 3300048915 Ga0496112_0255566 Ga0496112_0255566_530_1000 156
414 3300048919 Ga0496116_0085004 Ga0496116_0085004_1266_1736 156
415 3300048919 Ga0496116_0304018 Ga0496116_0304018_220_690 156
416 3300048924 Ga0496121_0064366 Ga0496121_0064366_1215_1685 156
417 3300048925 Ga0496122_0059980 Ga0496122_0059980_1073_1543 156
418 3300048926 Ga0496123_0020792 Ga0496123_0020792_1255_1725 156
419 3300048927 Ga0496124_0008899 Ga0496124_0008899_8244_8714 156
420 3300048928 Ga0496125_0054440 Ga0496125_0054440_1429_1899 156
421 3300048928 Ga0496125_0104312 Ga0496125_0104312_491_961 156
422 3300049573 Ga0501037_0038947 Ga0501037_0038947_2559_3032 156
423 3300049822 Ga0501035_0578099 Ga0501035_0578099_151_621 156
424 3300050507 nmdc:mga05p37_321327_c1 nmdc:mga05p37_321327_c1_1030_1500 156
425 3300050512 nmdc:mga0n895_167478_c1 nmdc:mga0n895_167478_c1_375_845 156
426 3300053091 Ga0500647_0235253 Ga0500647_0235253_176_646 156
427 3300053121 Ga0500607_094037 Ga0500607_094037_744_1214 156
428 3300053729 Ga0500625_098473 Ga0500625_098473_499_969 156
429 3300002704 JGI25155J39150_1000106 JGI25155J39150_100010617 157
430 3300002705 JGI25156J39149_1000024 JGI25156J39149_100002497 157
431 3300002738 JGI25154J39366_1000043 JGI25154J39366_100004398 157
432 3300002741 JGI25157J39369_1000031 JGI25157J39369_100003131 157
433 3300002987 JGI25159J45721_1000583 JGI25159J45721_100058312 157
434 3300002987 JGI25159J45721_1003958 JGI25159J45721_10039587 157
435 3300003187 JGI25151J46595_10000983 JGI25151J46595_1000098318 157
436 3300003187 JGI25151J46595_10016862 JGI25151J46595_100168623 157
437 3300003187 JGI25151J46595_10020552 JGI25151J46595_100205523 157
438 3300003187 JGI25151J46595_10056962 JGI25151J46595_100569622 157
439 3300003354 JGI25160J50197_1000276 JGI25160J50197_100027612 157
440 3300003374 JGI25161J50226_1000021 JGI25161J50226_100002132 157
441 3300003771 Ga0055526_1009371 Ga0055526_10093712 157
442 3300003771 Ga0055526_1017805 Ga0055526_10178052 157
443 3300003771 Ga0055526_1059645 Ga0055526_10596452 157
444 3300003773 Ga0055537_1000418 Ga0055537_100041831 157
445 3300003773 Ga0055537_1000444 Ga0055537_100044411 157
446 3300003773 Ga0055537_1021539 Ga0055537_10215392 157
447 3300003775 Ga0055524_1000039 Ga0055524_1000039120 157
448 3300003781 Ga0055536_1005447 Ga0055536_10054475 157
449 3300003784 Ga0055534_1000417 Ga0055534_100041718 157
450 3300003790 Ga0055528_1001025 Ga0055528_10010256 157
451 3300003791 Ga0055530_10000457 Ga0055530_1000045719 157
452 3300003791 Ga0055530_10015173 Ga0055530_100151732 157
453 3300003792 Ga0055540_1000047 Ga0055540_1000047110 157
454 3300003794 Ga0055531_10000433 Ga0055531_1000043319 157
455 3300004625 Ga0055543_1001013 Ga0055543_10010132 157
456 3300005262 Ga0065165_1005063 Ga0065165_10050632 157
457 3300005262 Ga0065165_1029098 Ga0065165_10290982 157
458 3300005262 Ga0065165_1029128 Ga0065165_10291282 157
459 3300005327 Ga0070658_10304935 Ga0070658_103049352 157
460 3300005328 Ga0070676_10020801 Ga0070676_100208012 157
461 3300005331 Ga0070670_100186401 Ga0070670_1001864012 157
462 3300005334 Ga0068869_100051079 Ga0068869_1000510794 157
463 3300005336 Ga0070680_100299329 Ga0070680_1002993291 157
464 3300005338 Ga0068868_100481751 Ga0068868_1004817512 157
465 3300005339 Ga0070660_100020620 Ga0070660_1000206202 157
466 3300005353 Ga0070669_100002673 Ga0070669_1000026737 157
467 3300005355 Ga0070671_100112332 Ga0070671_1001123322 157
468 3300005364 Ga0070673_100017705 Ga0070673_1000177054 157
469 3300005365 Ga0070688_100330678 Ga0070688_1003306782 157
470 3300005456 Ga0070678_100199372 Ga0070678_1001993722 157
471 3300005457 Ga0070662_100044539 Ga0070662_1000445394 157
472 3300005459 Ga0068867_100003586 Ga0068867_1000035867 157
473 3300005530 Ga0070679_100089580 Ga0070679_1000895803 157
474 3300005539 Ga0068853_100020424 Ga0068853_1000204244 157
475 3300005543 Ga0070672_100022223 Ga0070672_1000222234 157
476 3300005563 Ga0068855_100033927 Ga0068855_1000339275 157
477 3300005578 Ga0068854_100755134 Ga0068854_1007551342 157
478 3300005844 Ga0068862_100053515 Ga0068862_1000535153 157
479 3300005844 Ga0068862_100062095 Ga0068862_1000620951 157
480 3300005844 Ga0068862_100342033 Ga0068862_1003420332 157
481 3300005981 Ga0081538_10030266 Ga0081538_100302662 157
482 3300006038 Ga0075365_10449419 Ga0075365_104494192 157
483 3300006051 Ga0075364_10015136 Ga0075364_100151364 157
484 3300006058 Ga0075432_10461959 Ga0075432_104619591 157
485 3300006177 Ga0075362_10012179 Ga0075362_100121793 157
486 3300006195 Ga0075366_10567782 Ga0075366_105677822 157
487 3300006353 Ga0075370_10001266 Ga0075370_100012663 157
488 3300006353 Ga0075370_10444226 Ga0075370_104442262 157
489 3300006353 Ga0075370_10615580 Ga0075370_106155801 157
490 3300006844 Ga0075428_100226017 Ga0075428_1002260173 157
491 3300006852 Ga0075433_10494954 Ga0075433_104949542 157
492 3300006881 Ga0068865_100796125 Ga0068865_1007961251 157
493 3300006948 Ga0099826_10018113 Ga0099826_100181132 157
494 3300009093 Ga0105240_10018681 Ga0105240_100186813 157
495 3300009094 Ga0111539_10000919 Ga0111539_100009194 157
496 3300009094 Ga0111539_10763236 Ga0111539_107632361 157
497 3300009147 Ga0114129_10129546 Ga0114129_101295464 157
498 3300009147 Ga0114129_11437120 Ga0114129_114371201 157
499 3300009148 Ga0105243_10022126 Ga0105243_100221263 157
500 3300009148 Ga0105243_10266801 Ga0105243_102668012 157
501 3300009551 Ga0105238_10051027 Ga0105238_100510272 157
502 3300009553 Ga0105249_10177487 Ga0105249_101774872 157
503 3300009993 Ga0105028_123472 Ga0105028_1234721 157
504 3300011119 Ga0105246_10131455 Ga0105246_101314553 157
505 3300012513 Ga0157326_1000714 Ga0157326_10007143 157
506 3300013308 Ga0157375_10042119 Ga0157375_100421192 157
507 3300014326 Ga0157380_10043291 Ga0157380_100432914 157
508 3300014326 Ga0157380_10244759 Ga0157380_102447592 157
509 3300025206 Ga0209435_100008 Ga0209435_100008427 157
510 3300025208 Ga0209436_108431 Ga0209436_1084313 157
511 3300025245 Ga0207425_1006563 Ga0207425_10065633 157
512 3300025246 Ga0209646_1000079 Ga0209646_1000079150 157
513 3300025250 Ga0209026_1000067 Ga0209026_1000067150 157
514 3300025256 Ga0209759_1000056 Ga0209759_1000056150 157
515 3300025258 Ga0209129_1002197 Ga0209129_10021978 157
516 3300025258 Ga0209129_1036212 Ga0209129_10362122 157
517 3300025263 Ga0209565_1000080 Ga0209565_1000080115 157
518 3300025263 Ga0209565_1002434 Ga0209565_10024342 157
519 3300025273 Ga0209673_1000088 Ga0209673_100008831 157
520 3300025284 Ga0209130_1000103 Ga0209130_1000103132 157
521 3300025284 Ga0209130_1000238 Ga0209130_100023860 157
522 3300025291 Ga0209675_1000209 Ga0209675_100020918 157
523 3300025291 Ga0209675_1000888 Ga0209675_100088815 157
524 3300025292 Ga0209676_1000073 Ga0209676_1000073141 157
525 3300025292 Ga0209676_1003830 Ga0209676_10038302 157
526 3300025294 Ga0209025_1000531 Ga0209025_10005315 157
527 3300025294 Ga0209025_1001659 Ga0209025_10016599 157
528 3300025294 Ga0209025_1003871 Ga0209025_100387111 157
529 3300025294 Ga0209025_1013190 Ga0209025_10131907 157
530 3300025295 Ga0209564_1001646 Ga0209564_100164616 157
531 3300025295 Ga0209564_1003481 Ga0209564_10034814 157
532 3300025295 Ga0209564_1005469 Ga0209564_10054699 157
533 3300025297 Ga0209758_1014110 Ga0209758_10141103 157
534 3300025297 Ga0209758_1045022 Ga0209758_10450222 157
535 3300025298 Ga0209050_1000008 Ga0209050_1000008922 157
536 3300025298 Ga0209050_1013365 Ga0209050_10133653 157
537 3300025298 Ga0209050_1015357 Ga0209050_10153573 157
538 3300025299 Ga0209256_1000096 Ga0209256_1000096176 157
539 3300025302 Ga0207426_1000731 Ga0207426_100073133 157
540 3300025302 Ga0207426_1001996 Ga0207426_100199611 157
541 3300025303 Ga0209051_1000005 Ga0209051_1000005922 157
542 3300025304 Ga0209257_1000031 Ga0209257_1000031512 157
543 3300025304 Ga0209257_1017679 Ga0209257_10176791 157
544 3300025907 Ga0207645_10014539 Ga0207645_100145394 157
545 3300025913 Ga0207695_10466267 Ga0207695_104662672 157
546 3300025918 Ga0207662_10894968 Ga0207662_108949681 157
547 3300025919 Ga0207657_10661012 Ga0207657_106610121 157
548 3300025923 Ga0207681_10732402 Ga0207681_107324022 157
549 3300025924 Ga0207694_10117824 Ga0207694_101178242 157
550 3300025925 Ga0207650_10966352 Ga0207650_109663522 157
551 3300025933 Ga0207706_10192344 Ga0207706_101923442 157
552 3300025935 Ga0207709_10024347 Ga0207709_100243474 157
553 3300025935 Ga0207709_10539048 Ga0207709_105390482 157
554 3300025940 Ga0207691_10057061 Ga0207691_100570612 157
555 3300025942 Ga0207689_10052706 Ga0207689_100527064 157
556 3300025945 Ga0207679_11296676 Ga0207679_112966761 157
557 3300025949 Ga0207667_10247807 Ga0207667_102478072 157
558 3300025960 Ga0207651_10076997 Ga0207651_100769972 157
559 3300025981 Ga0207640_10453467 Ga0207640_104534672 157
560 3300026023 Ga0207677_10015431 Ga0207677_100154312 157
561 3300026089 Ga0207648_10011428 Ga0207648_100114285 157
562 3300026116 Ga0207674_10735321 Ga0207674_107353212 157
563 3300026118 Ga0207675_100029259 Ga0207675_1000292594 157
564 3300026121 Ga0207683_10598708 Ga0207683_105987082 157
565 3300027907 Ga0207428_10000152 Ga0207428_1000015215 157
566 3300027907 Ga0207428_10406388 Ga0207428_104063882 157
567 3300028380 Ga0268265_10178654 Ga0268265_101786543 157
568 3300028786 Ga0307517_10333679 Ga0307517_103336791 157
569 3300031456 Ga0307513_10001864 Ga0307513_100018641 157
570 3300031548 Ga0307408_100006292 Ga0307408_1000062928 157
571 3300031548 Ga0307408_100605224 Ga0307408_1006052242 157
572 3300031730 Ga0307516_10187548 Ga0307516_101875482 157
573 3300031901 Ga0307406_10030715 Ga0307406_100307152 157
574 3300031911 Ga0307412_10348713 Ga0307412_103487132 157
575 3300031995 Ga0307409_100474480 Ga0307409_1004744801 157
576 3300032002 Ga0307416_100539735 Ga0307416_1005397352 157
577 3300032004 Ga0307414_11175424 Ga0307414_111754242 157
578 3300032005 Ga0307411_10198553 Ga0307411_101985531 157
579 3300041459 Ga0451800_0093157 Ga0451800_0093157_201_674 157
580 3300041512 Ga0451853_0087738 Ga0451853_0087738_629_1102 157
581 3300042013 Ga0439456_105095 Ga0439456_105095_139_615 157
582 3300046515 Ga0495620_0135363 Ga0495620_0135363_417_890 157
583 3300046660 Ga0495625_0145774 Ga0495625_0145774_841_1314 157
584 3300046660 Ga0495625_0174108 Ga0495625_0174108_687_1160 157
585 3300046674 Ga0495588_0158083 Ga0495588_0158083_291_764 157
586 3300046692 Ga0495671_0002240 Ga0495671_0002240_11532_12005 157
587 3300046810 Ga0495660_0060417 Ga0495660_0060417_1079_1552 157
588 3300047470 Ga0495681_0261790 Ga0495681_0261790_104_577 157
589 3300048904 Ga0496101_0019042 Ga0496101_0019042_3959_4432 157
590 3300050489 nmdc:mga03683_56351_c1 nmdc:mga03683_56351_c1_377_850 157
591 3300050491 nmdc:mga00v17_246763_c1 nmdc:mga00v17_246763_c1_187_660 157
592 3300050492 nmdc:mga0yw44_899936_c1 nmdc:mga0yw44_899936_c1_101_574 157
593 3300050493 nmdc:mga0k408_157450_c1 nmdc:mga0k408_157450_c1_543_1016 157
594 3300050493 nmdc:mga0k408_186712_c1 nmdc:mga0k408_186712_c1_618_1091 157
595 3300050496 nmdc:mga07m45_375981_c1 nmdc:mga07m45_375981_c1_331_807 157
596 3300050496 nmdc:mga07m45_389937_c1 nmdc:mga07m45_389937_c1_266_739 157
597 3300050496 nmdc:mga07m45_4118_c1 nmdc:mga07m45_4118_c1_1359_1832 157
598 3300050507 nmdc:mga05p37_347711_c2 nmdc:mga05p37_347711_c2_45_521 157
599 3300050507 nmdc:mga05p37_918535_c1 nmdc:mga05p37_918535_c1_313_786 157
600 3300050510 nmdc:mga06r32_1194049_c1 nmdc:mga06r32_1194049_c1_211_687 157
601 3300050510 nmdc:mga06r32_1361325_c1 nmdc:mga06r32_1361325_c1_97_573 157
602 3300050511 nmdc:mga08y16_474866_c1 nmdc:mga08y16_474866_c1_556_1032 157
603 3300050511 nmdc:mga08y16_54_c1 nmdc:mga08y16_54_c1_57270_57746 157
604 3300050515 nmdc:mga0a205_530846_c1 nmdc:mga0a205_530846_c1_291_767 157
605 3300053079 Ga0500610_0001085 Ga0500610_0001085_2014_2487 157
606 3300053079 Ga0500610_0001382 Ga0500610_0001382_1675_2148 157
607 3300053088 Ga0500644_0008163 Ga0500644_0008163_1885_2358 157
608 3300053094 Ga0500566_0164633 Ga0500566_0164633_345_818 157
609 3300053098 Ga0500650_0085302 Ga0500650_0085302_725_1198 157
610 3300053117 Ga0500593_000756 Ga0500593_000756_11564_12037 157
611 3300053117 Ga0500593_001588 Ga0500593_001588_7015_7488 157
612 3300053121 Ga0500607_001975 Ga0500607_001975_5327_5800 157
613 3300053158 Ga0500627_0005114 Ga0500627_0005114_276_749 157
614 3300053730 Ga0500645_002194 Ga0500645_002194_3608_4081 157
615 3300053730 Ga0500645_003711 Ga0500645_003711_321_794 157
616 3300053730 Ga0500645_009996 Ga0500645_009996_800_1273 157
617 3300001989 JGI24739J22299_10148046 JGI24739J22299_101480462 158
618 3300003773 Ga0055537_1000124 Ga0055537_100012428 158
619 3300003784 Ga0055534_1000117 Ga0055534_100011733 158
620 3300003790 Ga0055528_1001402 Ga0055528_10014024 158
621 3300003792 Ga0055540_1003418 Ga0055540_10034186 158
622 3300005331 Ga0070670_100244491 Ga0070670_1002444912 158
623 3300005456 Ga0070678_100998677 Ga0070678_1009986772 158
624 3300005844 Ga0068862_100071146 Ga0068862_1000711462 158
625 3300006038 Ga0075365_10001430 Ga0075365_100014308 158
626 3300006048 Ga0075363_100075106 Ga0075363_1000751062 158
627 3300006048 Ga0075363_100404275 Ga0075363_1004042752 158
628 3300006051 Ga0075364_10129589 Ga0075364_101295892 158
629 3300006058 Ga0075432_10024090 Ga0075432_100240902 158
630 3300006177 Ga0075362_10076850 Ga0075362_100768502 158
631 3300006186 Ga0075369_10021689 Ga0075369_100216892 158
632 3300006195 Ga0075366_10012391 Ga0075366_100123912 158
633 3300006353 Ga0075370_10000897 Ga0075370_100008972 158
634 3300006358 Ga0068871_100035745 Ga0068871_1000357455 158
635 3300006948 Ga0099826_10002164 Ga0099826_1000216414 158
636 3300006948 Ga0099826_10074502 Ga0099826_100745022 158
637 3300009093 Ga0105240_10197613 Ga0105240_101976133 158
638 3300009176 Ga0105242_11231168 Ga0105242_112311682 158
639 3300012502 Ga0157347_1002655 Ga0157347_10026552 158
640 3300013100 Ga0157373_10012722 Ga0157373_100127222 158
641 3300014497 Ga0182008_10027531 Ga0182008_100275312 158
642 3300015262 Ga0182007_10026879 Ga0182007_100268792 158
643 3300017792 Ga0163161_10052739 Ga0163161_100527393 158
644 3300025263 Ga0209565_1000114 Ga0209565_100011489 158
645 3300025273 Ga0209673_1000572 Ga0209673_100057232 158
646 3300025291 Ga0209675_1000029 Ga0209675_1000029254 158
647 3300025292 Ga0209676_1057284 Ga0209676_10572841 158
648 3300025303 Ga0209051_1000363 Ga0209051_100036329 158
649 3300025925 Ga0207650_10032850 Ga0207650_100328503 158
650 3300026089 Ga0207648_10222228 Ga0207648_102222282 158
651 3300027666 Ga0209282_1001104 Ga0209282_100110417 158
652 3300027907 Ga0207428_10927907 Ga0207428_109279071 158
653 3300031235 Ga0265330_10000014 Ga0265330_10000014100 158
654 3300031238 Ga0265332_10000011 Ga0265332_10000011139 158
655 3300031250 Ga0265331_10013364 Ga0265331_100133643 158
656 3300031251 Ga0265327_10000027 Ga0265327_1000002736 158
657 3300031456 Ga0307513_10000256 Ga0307513_1000025620 158
658 3300031548 Ga0307408_100108899 Ga0307408_1001088992 158
659 3300031548 Ga0307408_101193668 Ga0307408_1011936681 158
660 3300031649 Ga0307514_10027922 Ga0307514_100279222 158
661 3300031711 Ga0265314_10000026 Ga0265314_10000026129 158
662 3300031731 Ga0307405_10177300 Ga0307405_101773002 158
663 3300031731 Ga0307405_11473646 Ga0307405_114736461 158
664 3300031824 Ga0307413_10132383 Ga0307413_101323832 158
665 3300031901 Ga0307406_10010740 Ga0307406_100107402 158
666 3300031911 Ga0307412_10118809 Ga0307412_101188092 158
667 3300031911 Ga0307412_10253645 Ga0307412_102536452 158
668 3300031911 Ga0307412_11214830 Ga0307412_112148302 158
669 3300031911 Ga0307412_11495132 Ga0307412_114951321 158
670 3300031995 Ga0307409_100437721 Ga0307409_1004377212 158
671 3300032002 Ga0307416_100017223 Ga0307416_1000172234 158
672 3300032002 Ga0307416_100104627 Ga0307416_1001046272 158
673 3300032005 Ga0307411_10011105 Ga0307411_100111056 158
674 3300041413 Ga0439465_0067288 Ga0439465_0067288_661_1137 158
675 3300042004 Ga0439445_0013272 Ga0439445_0013272_1396_1872 158
676 3300042125 Ga0450923_024679 Ga0450923_024679_573_1049 158
677 3300042145 Ga0450906_047766 Ga0450906_047766_86_562 158
678 3300042147 Ga0450910_030375 Ga0450910_030375_266_742 158
679 3300042156 Ga0439446_0044737 Ga0439446_0044737_588_1064 158
680 3300042184 Ga0450908_000847 Ga0450908_000847_1591_2067 158
681 3300042531 Ga0450918_001787 Ga0450918_001787_2278_2754 158
682 3300044673 Ga0453683_0968597 Ga0453683_0968597_14_490 158
683 3300046472 Ga0495580_0136857 Ga0495580_0136857_453_932 158
684 3300046499 Ga0495594_0197728 Ga0495594_0197728_290_769 158
685 3300046526 Ga0495666_0065402 Ga0495666_0065402_434_913 158
686 3300046660 Ga0495625_0001291 Ga0495625_0001291_5589_6098 158
687 3300046674 Ga0495588_0119983 Ga0495588_0119983_654_1130 158
688 3300046690 Ga0495624_0311035 Ga0495624_0311035_172_651 158
689 3300049686 Ga0501257_119607 Ga0501257_119607_18_494 158
690 3300049759 Ga0501262_000093 Ga0501262_000093_1819_2358 158
691 3300050489 nmdc:mga03683_22005_c1 nmdc:mga03683_22005_c1_1535_2044 158
692 3300050489 nmdc:mga03683_313736_c1 nmdc:mga03683_313736_c1_118_615 158
693 3300050490 nmdc:mga03n38_20693_c1 nmdc:mga03n38_20693_c1_1705_2214 158
694 3300050490 nmdc:mga03n38_318906_c1 nmdc:mga03n38_318906_c1_139_615 158
695 3300050491 nmdc:mga00v17_80922_c1 nmdc:mga00v17_80922_c1_1151_1660 158
696 3300050492 nmdc:mga0yw44_13446_c1 nmdc:mga0yw44_13446_c1_3601_4110 158
697 3300050493 nmdc:mga0k408_7234_c1 nmdc:mga0k408_7234_c1_1171_1680 158
698 3300050496 nmdc:mga07m45_9938_c1 nmdc:mga07m45_9938_c1_903_1400 158
699 3300050516 nmdc:mga0sz30_179802_c1 nmdc:mga0sz30_179802_c1_331_807 158

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

71

173

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9776 1 151
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9528 1 151
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8579 1 153
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8467 1 153
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.8117 1 153
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9647 2 151 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9522 2 151 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8493 7 153 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8319 7 153 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8278 55 153 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A534GYJ0-F1-model_v4 OsmC family peroxiredoxin 0.9977 52 153
AF-A0A534FSH6-F1-model_v4 OsmC family peroxiredoxin 0.9943 34 153
AF-A0A3N7CUJ4-F1-model_v4 Peroxiredoxin 0.9936 1 151
AF-A0A1E4J6V7-F1-model_v4 Peroxiredoxin 0.9919 1 151
AF-A0A0J1GHH4-F1-model_v4 Peroxiredoxin 0.9899 49 151

Feature Viewer

pLDDT pTM Quality
96.18 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map