F475995

General Info

Members Datasets Scaffolds Average Seq Length
698 383 632 272

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221652|2644294982
Length 318
Sequence FLRNVAYSSSGSPWRGCGRPVVLPGAGDPACGVIASAGTIPATMLTYPHIDPVALQIGPLAVHWYGLTYLAAFGLFMLLGIRRLRHPPFASITGPGAWTRKDVEDILFLGVAGVVIGGRLGYCLFYKPGYYLSHPLEIFAVWQGGMAFHGGLLGVVVSMLWFAHSRQRPWLQVADFVAPCVPTGLAAGRVGNFINGELWGRFASPDLPWGMVFAHSGSMQPRHPSQVYQFLMEGLLLFILLWLYARKERRPGQVAAAFLFGYGVFRFIAEYFREPDAFLGILSLGMSMGQWLCVPMIVGGAAMWLWAQRQPVGALVSR

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221570 Acidovorax sp. Root568 Isolate Unclassified
11 2643221596 Acidovorax sp. Root70 Isolate Unclassified
12 2643221609 Acidovorax sp. Root217 Isolate Unclassified
13 2643221611 Acidovorax sp. Root219 Isolate Unclassified
14 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
15 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
16 2643221652 Acidovorax sp. Root402 Isolate Unclassified
17 2643221658 Variovorax sp. Root411 Isolate Unclassified
18 2643221660 Methylibium sp. Root1272 Isolate Unclassified
19 2643221672 Variovorax sp. Root434 Isolate Unclassified
20 2643221683 Variovorax sp. Root473 Isolate Unclassified
21 2643221717 Acidovorax sp. Root267 Isolate Unclassified
22 2721755523 Delftia sp. HK171 Isolate Unclassified
23 2738541277 Variovorax sp. GV051 Isolate Unclassified
24 2738541307 Variovorax sp. GV008 Isolate Unclassified
25 2738543012 Acidovorax sp. CF301 Isolate Unclassified
26 2738543013 Variovorax sp. BT01 Isolate Unclassified
27 2738543019 Variovorax sp. GV040 Isolate Unclassified
28 2816332133 Acidovorax radicis 2721A Isolate Unclassified
29 2818991446 Variovorax sp. 1180 Isolate Unclassified
30 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
31 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
32 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
33 2842677519 Variovorax sp. R-72495 Isolate Unclassified
34 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
35 2842733646 Variovorax sp. R-72446 Isolate Unclassified
36 2842747753 Variovorax sp. R-72060 Isolate Unclassified
37 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
38 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
39 2885198086 Variovorax sp. 679 Isolate Unclassified
40 2885211737 Variovorax sp. 553 Isolate Unclassified
41 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
42 2899924645 Variovorax sp. 369 Isolate Unclassified
43 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
44 2904456579 Variovorax sp. 2002 Isolate Unclassified
45 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
46 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
47 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
48 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
49 2928037797 Variovorax sp. 1126 Isolate Unclassified
50 2928044640 Variovorax sp. 1128 Isolate Unclassified
51 2928051484 Variovorax sp. 1133 Isolate Unclassified
52 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
53 2928070936 Variovorax gossypii 1167 Isolate Unclassified
54 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
55 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
56 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
57 2929520902 Variovorax beijingensis 502 Isolate Unclassified
58 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
59 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
60 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
61 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
62 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
63 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
64 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
65 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
66 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
67 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
68 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
69 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
70 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
71 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
72 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
73 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
74 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
75 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
76 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
77 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
78 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
81 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
82 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
83 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
84 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
85 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
86 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
87 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
88 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
89 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
90 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
91 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
92 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
93 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
94 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
95 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
96 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
97 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
98 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
99 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
102 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
103 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
107 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
123 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
124 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
125 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
130 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
131 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
135 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
136 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
137 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
140 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
141 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
142 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
143 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
144 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
155 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
156 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
157 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
158 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
159 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
163 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
168 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
169 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
170 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
172 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
173 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
174 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
184 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
216 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
217 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
218 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
220 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
223 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
224 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
225 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
226 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
244 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
249 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
255 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
259 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
260 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
261 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
262 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
263 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
264 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
265 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
266 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
267 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
268 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
269 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
270 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
271 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
272 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
273 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
274 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
275 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
276 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
277 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
278 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
279 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
282 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
283 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
286 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
287 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
288 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
289 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
290 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
291 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
292 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
293 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
296 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
297 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
298 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
299 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
300 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
301 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
302 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
306 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
307 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
312 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
313 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
314 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
315 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
316 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
317 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
321 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
322 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
335 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
336 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
339 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
342 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
347 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
348 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
356 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
359 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
363 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
364 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
367 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
368 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
369 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
370 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
371 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
372 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
373 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
374 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
377 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
378 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
379 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
380 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
383 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.26
Metatranscriptomes 0.29
Isolates 9.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 38.25
Nodule 1.29
Rhizoplane 2.44
Rhizosphere 45.27
Stem 0
Stem Tuber 0
Unclassified 12.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011138 3300001979 Bacteria 3433
2 JGI24740J21852_10013604 3300001979 Bacteria 3028
3 JGI25156J39149_1000002 3300002705 Bacteria 343501
4 JGI25154J39366_1000010 3300002738 Bacteria 297985
5 JGI25157J39369_1000001 3300002741 Bacteria 363277
6 JGI25152J39213_1003097 3300002773 Bacteria 5816
7 JGI25152J39213_1006587 3300002773 Bacteria 3127
8 JGI25150J39212_1002336 3300002774 Bacteria 4768
9 JGI25150J39212_1011673 3300002774 Bacteria 1582
10 JGI25159J45721_1001031 3300002987 Bacteria 11936
11 JGI25159J45721_1001487 3300002987 Bacteria 9633
12 JGI25159J45721_1008017 3300002987 Bacteria 2951
13 JGI25159J45721_1012808 3300002987 Bacteria 1976
14 JGI25151J46595_10000849 3300003187 Bacteria 24354
15 JGI25151J46595_10005377 3300003187 Bacteria 6619
16 JGI25151J46595_10005605 3300003187 Bacteria 6460
17 JGI25151J46595_10006891 3300003187 Bacteria 5641
18 JGI25151J46595_10009023 3300003187 Bacteria 4753
19 JGI25151J46595_10011921 3300003187 Bacteria 3973
20 JGI25153J46596_10006648 3300003215 Bacteria 5816
21 JGI25160J50197_1000301 3300003354 Bacteria 34898
22 JGI25160J50197_1015284 3300003354 Bacteria 2527
23 JGI25161J50226_1000043 3300003374 Bacteria 120741
24 JGI25161J50226_1002461 3300003374 Bacteria 4733
25 Ga0006562J51391_1151955 3300003578 Bacteria 2740
26 Ga0006562J51391_1151956 3300003578 Bacteria 2560
27 Ga0055535_1000263 3300003761 Bacteria 55363
28 Ga0055542_1000004 3300003762 Bacteria 553532
29 Ga0055526_1000766 3300003771 Bacteria 23992
30 Ga0055526_1005571 3300003771 Bacteria 7186
31 Ga0055526_1009308 3300003771 Bacteria 4753
32 Ga0055526_1009358 3300003771 Bacteria 4727
33 Ga0055537_1000124 3300003773 Bacteria 58656
34 Ga0055537_1000365 3300003773 Bacteria 30792
35 Ga0055537_1000479 3300003773 Bacteria 25018
36 Ga0055537_1003569 3300003773 Bacteria 4753
37 Ga0055524_1000130 3300003775 Bacteria 88754
38 Ga0055524_1000167 3300003775 Bacteria 75234
39 Ga0055524_1007210 3300003775 Bacteria 4753
40 Ga0055524_1013103 3300003775 Bacteria 3146
41 Ga0055536_1000896 3300003781 Bacteria 19290
42 Ga0055536_1001627 3300003781 Bacteria 13360
43 Ga0055536_1002373 3300003781 Bacteria 10626
44 Ga0055536_1013807 3300003781 Bacteria 2882
45 Ga0055536_1016391 3300003781 Bacteria 2481
46 Ga0055536_1019956 3300003781 Bacteria 2088
47 Ga0055534_1000117 3300003784 Bacteria 58656
48 Ga0055534_1003009 3300003784 Bacteria 5541
49 Ga0055534_1004914 3300003784 Bacteria 3735
50 Ga0055534_1005542 3300003784 Bacteria 3353
51 Ga0055534_1006602 3300003784 Bacteria 2896
52 Ga0055528_1000145 3300003790 Bacteria 58081
53 Ga0055528_1001213 3300003790 Bacteria 16517
54 Ga0055528_1007631 3300003790 Bacteria 4753
55 Ga0055528_1022869 3300003790 Bacteria 1929
56 Ga0055530_10000265 3300003791 Bacteria 47389
57 Ga0055530_10005615 3300003791 Bacteria 5886
58 Ga0055530_10006721 3300003791 Bacteria 5039
59 Ga0055530_10013110 3300003791 Bacteria 2846
60 Ga0055530_10018585 3300003791 Bacteria 2137
61 Ga0055540_1000079 3300003792 Bacteria 112817
62 Ga0055540_1000086 3300003792 Bacteria 102576
63 Ga0055540_1000578 3300003792 Bacteria 26846
64 Ga0055540_1001104 3300003792 Bacteria 17014
65 Ga0055540_1004004 3300003792 Bacteria 6860
66 Ga0055540_1014383 3300003792 Bacteria 2358
67 Ga0055540_1017767 3300003792 Bacteria 1973
68 Ga0055531_10000536 3300003794 Bacteria 33683
69 Ga0055531_10001363 3300003794 Bacteria 18136
70 Ga0055531_10010642 3300003794 Bacteria 4545
71 Ga0055531_10013529 3300003794 Bacteria 3753
72 Ga0055531_10020052 3300003794 Bacteria 2666
73 Ga0055531_10022816 3300003794 Bacteria 2370
74 Ga0055531_10022924 3300003794 Bacteria 2361
75 Ga0055543_1000805 3300004625 Bacteria 15454
76 Ga0055543_1001896 3300004625 Bacteria 7566
77 Ga0055543_1002001 3300004625 Bacteria 7242
78 Ga0065165_1005107 3300005262 Bacteria 7618
79 Ga0065165_1008339 3300005262 Bacteria 4870
80 Ga0065165_1008653 3300005262 Bacteria 4715
81 Ga0065165_1012867 3300005262 Bacteria 3373
82 Ga0065714_10124086 3300005288 Bacteria 1315
83 Ga0065704_10081381 3300005289 Bacteria 3769
84 Ga0070676_10081865 3300005328 Bacteria 1960
85 Ga0070683_100096688 3300005329 Bacteria 2778
86 Ga0070690_100046592 3300005330 Bacteria 2756
87 Ga0070680_100098501 3300005336 Bacteria 2425
88 Ga0068868_100439366 3300005338 Bacteria 1133
89 Ga0070689_100167342 3300005340 Bacteria 1780
90 Ga0070687_100028560 3300005343 Bacteria 2707
91 Ga0070661_100002671 3300005344 Bacteria 12213
92 Ga0070669_100198122 3300005353 Bacteria 1579
93 Ga0070659_100133938 3300005366 Bacteria 2014
94 Ga0070667_100162647 3300005367 Bacteria 1967
95 Ga0070710_10028644 3300005437 Bacteria 2981
96 Ga0070662_100009317 3300005457 Bacteria 6416
97 Ga0068867_100160666 3300005459 Bacteria 1772
98 Ga0070679_100187766 3300005530 Bacteria 2036
99 Ga0070679_100614913 3300005530 Bacteria 1030
100 Ga0070686_100013770 3300005544 Bacteria 4639
101 Ga0070665_100279277 3300005548 Bacteria 1672
102 Ga0070665_100334758 3300005548 Bacteria 1518
103 Ga0068855_100096209 3300005563 Bacteria 3412
104 Ga0070664_100027002 3300005564 Bacteria 4768
105 Ga0070664_100259811 3300005564 Bacteria 1562
106 Ga0070664_100298088 3300005564 Bacteria 1456
107 Ga0070664_100599947 3300005564 Bacteria 1021
108 Ga0068857_100030969 3300005577 Bacteria 4727
109 Ga0068854_100221493 3300005578 Bacteria 1497
110 Ga0070702_100354814 3300005615 Bacteria 1034
111 Ga0068852_100007651 3300005616 Bacteria 7899
112 Ga0068852_100030084 3300005616 Bacteria 4466
113 Ga0068859_100101309 3300005617 Bacteria 2937
114 Ga0068858_100088828 3300005842 Bacteria 2876
115 Ga0081539_10001356 3300005985 Bacteria 42605
116 Ga0075365_10021178 3300006038 Bacteria 4051
117 Ga0075365_10027325 3300006038 Bacteria 3630
118 Ga0075365_10051968 3300006038 Bacteria 2709
119 Ga0075365_10059315 3300006038 Bacteria 2550
120 Ga0075368_10002580 3300006042 Bacteria 5940
121 Ga0075363_100009495 3300006048 Bacteria 4574
122 Ga0075363_100011657 3300006048 Bacteria 4217
123 Ga0075363_100118134 3300006048 Bacteria 1479
124 Ga0075364_10006781 3300006051 Bacteria 6754
125 Ga0075364_10096910 3300006051 Bacteria 1962
126 Ga0075362_10004271 3300006177 Bacteria 5107
127 Ga0075362_10008739 3300006177 Bacteria 3891
128 Ga0075362_10010016 3300006177 Bacteria 3685
129 Ga0075362_10017847 3300006177 Bacteria 2928
130 Ga0075362_10020067 3300006177 Bacteria 2789
131 Ga0075362_10072510 3300006177 Bacteria 1575
132 Ga0075362_10138525 3300006177 Bacteria 1162
133 Ga0075367_10003242 3300006178 Bacteria 7698
134 Ga0075367_10160279 3300006178 Bacteria 1399
135 Ga0075369_10047418 3300006186 Bacteria 1852
136 Ga0075366_10001774 3300006195 Bacteria 10888
137 Ga0075366_10007976 3300006195 Bacteria 5863
138 Ga0075366_10013528 3300006195 Bacteria 4650
139 Ga0075366_10027503 3300006195 Bacteria 3337
140 Ga0075366_10067359 3300006195 Bacteria 2130
141 Ga0075366_10078028 3300006195 Bacteria 1976
142 Ga0097621_100001352 3300006237 Bacteria 16880
143 Ga0075370_10000855 3300006353 Bacteria 12358
144 Ga0075370_10000948 3300006353 Bacteria 11930
145 Ga0075370_10003921 3300006353 Bacteria 7143
146 Ga0075370_10016758 3300006353 Bacteria 3947
147 Ga0075370_10019514 3300006353 Bacteria 3694
148 Ga0075370_10027582 3300006353 Bacteria 3152
149 Ga0075370_10031657 3300006353 Bacteria 2953
150 Ga0075370_10034068 3300006353 Bacteria 2854
151 Ga0075370_10159443 3300006353 Bacteria 1324
152 Ga0075370_10192607 3300006353 Bacteria 1202
153 Ga0068871_100072909 3300006358 Bacteria 2829
154 Ga0068871_100293739 3300006358 Bacteria 1425
155 Ga0075433_10000369 3300006852 Bacteria 28286
156 Ga0075434_100000187 3300006871 Bacteria 40764
157 Ga0075434_100001022 3300006871 Bacteria 22777
158 Ga0075429_100090684 3300006880 Bacteria 2666
159 Ga0075436_100016561 3300006914 Bacteria 5046
160 Ga0075436_100039260 3300006914 Bacteria 3268
161 Ga0097620_100101314 3300006931 Bacteria 2937
162 Ga0079104_1000034 3300006946 Bacteria 199368
163 Ga0079104_1000100 3300006946 Bacteria 126924
164 Ga0079104_1011656 3300006946 Bacteria 2812
165 Ga0099826_10000831 3300006948 Bacteria 16641
166 Ga0075435_100000126 3300007076 Bacteria 43549
167 Ga0075435_100013976 3300007076 Bacteria 5987
168 Ga0099794_10001777 3300007265 Bacteria 7682
169 Ga0105244_10000699 3300009036 Bacteria 29093
170 Ga0105250_10028913 3300009092 Bacteria 2230
171 Ga0105240_10085376 3300009093 Bacteria 3867
172 Ga0105240_10088473 3300009093 Bacteria 3789
173 Ga0111539_10055258 3300009094 Bacteria 4720
174 Ga0105243_10003962 3300009148 Bacteria 11811
175 Ga0105243_10007155 3300009148 Bacteria 8578
176 Ga0105243_10009092 3300009148 Bacteria 7591
177 Ga0105243_10034358 3300009148 Bacteria 3925
178 Ga0105243_10042495 3300009148 Bacteria 3558
179 Ga0105241_10055398 3300009174 Bacteria 3038
180 Ga0105241_10312537 3300009174 Bacteria 1352
181 Ga0105242_10006957 3300009176 Bacteria 8729
182 Ga0105242_10350059 3300009176 Bacteria 1364
183 Ga0105242_10410953 3300009176 Bacteria 1266
184 Ga0105237_10011096 3300009545 Bacteria 9549
185 Ga0105238_10197750 3300009551 Bacteria 1986
186 Ga0105238_10289003 3300009551 Bacteria 1621
187 Ga0105239_10594363 3300010375 Bacteria 1262
188 Ga0105246_10071480 3300011119 Bacteria 2443
189 Ga0105246_10291497 3300011119 Bacteria 1313
190 Ga0105246_10309044 3300011119 Bacteria 1280
191 Ga0157373_10075329 3300013100 Bacteria 2381
192 Ga0157373_10132358 3300013100 Bacteria 1754
193 Ga0157373_10158989 3300013100 Bacteria 1590
194 Ga0157370_10022578 3300013104 Bacteria 6262
195 Ga0157370_10730574 3300013104 Bacteria 903
196 Ga0157369_10044036 3300013105 Bacteria 4861
197 Ga0157378_10069662 3300013297 Bacteria 3156
198 Ga0163163_10652925 3300014325 Bacteria 1115
199 Ga0182008_10000418 3300014497 Bacteria 32935
200 Ga0182008_10008154 3300014497 Bacteria 5734
201 Ga0182008_10032416 3300014497 Bacteria 2626
202 Ga0182008_10096862 3300014497 Bacteria 1456
203 Ga0157376_10021945 3300014969 Bacteria 4967
204 Ga0157376_10932236 3300014969 Bacteria 888
205 Ga0182006_1000867 3300015261 Bacteria 20300
206 Ga0182006_1055366 3300015261 Bacteria 1514
207 Ga0182007_10000627 3300015262 Bacteria 20547
208 Ga0182007_10002274 3300015262 Bacteria 9676
209 Ga0182005_1048620 3300015265 Bacteria 1152
210 Ga0183362_10001 3300015683 Bacteria 2046624
211 Ga0163161_10031156 3300017792 Bacteria 3798
212 Ga0163161_10037236 3300017792 Bacteria 3487
213 Ga0213872_10000074 3300021361 Bacteria 90986
214 Ga0213872_10012229 3300021361 Bacteria 4044
215 Ga0209435_100001 3300025206 Bacteria 1424171
216 Ga0209436_105671 3300025208 Bacteria 2831
217 Ga0209672_100775 3300025228 Bacteria 15309
218 Ga0209147_100541 3300025229 Bacteria 21608
219 Ga0209258_100022 3300025242 Bacteria 553584
220 Ga0207425_1000154 3300025245 Bacteria 58601
221 Ga0207425_1000959 3300025245 Bacteria 13578
222 Ga0207425_1002619 3300025245 Bacteria 6220
223 Ga0207425_1005184 3300025245 Bacteria 3753
224 Ga0209646_1000001 3300025246 Bacteria 3092932
225 Ga0209026_1000001 3300025250 Bacteria 1228671
226 Ga0209148_1000034 3300025254 Bacteria 553584
227 Ga0209759_1000001 3300025256 Bacteria 2799452
228 Ga0209129_1000023 3300025258 Bacteria 420646
229 Ga0209129_1001811 3300025258 Bacteria 11351
230 Ga0209129_1003387 3300025258 Bacteria 6997
231 Ga0209129_1026680 3300025258 Bacteria 995
232 Ga0209565_1000096 3300025263 Bacteria 134434
233 Ga0209565_1000114 3300025263 Bacteria 116078
234 Ga0209565_1000125 3300025263 Bacteria 110485
235 Ga0209565_1001491 3300025263 Bacteria 10225
236 Ga0209565_1004038 3300025263 Bacteria 4573
237 Ga0209565_1019267 3300025263 Bacteria 1460
238 Ga0209673_1000192 3300025273 Bacteria 123155
239 Ga0209673_1000232 3300025273 Bacteria 108581
240 Ga0209673_1000572 3300025273 Bacteria 58687
241 Ga0209673_1000583 3300025273 Bacteria 57643
242 Ga0209673_1002127 3300025273 Bacteria 14789
243 Ga0209130_1000041 3300025284 Bacteria 261078
244 Ga0209130_1000113 3300025284 Bacteria 130804
245 Ga0209130_1000508 3300025284 Bacteria 39372
246 Ga0209130_1000752 3300025284 Bacteria 28075
247 Ga0209130_1001465 3300025284 Bacteria 15515
248 Ga0209675_1000029 3300025291 Bacteria 281053
249 Ga0209675_1000705 3300025291 Bacteria 22965
250 Ga0209675_1001714 3300025291 Bacteria 12082
251 Ga0209675_1001840 3300025291 Bacteria 11522
252 Ga0209675_1003283 3300025291 Bacteria 7775
253 Ga0209675_1019065 3300025291 Bacteria 1900
254 Ga0209675_1025320 3300025291 Bacteria 1499
255 Ga0209675_1034908 3300025291 Bacteria 1152
256 Ga0209676_1000005 3300025292 Bacteria 1076001
257 Ga0209676_1000054 3300025292 Bacteria 365890
258 Ga0209676_1000285 3300025292 Bacteria 104459
259 Ga0209676_1000418 3300025292 Bacteria 75214
260 Ga0209676_1000705 3300025292 Bacteria 46561
261 Ga0209676_1002444 3300025292 Bacteria 13185
262 Ga0209676_1003024 3300025292 Bacteria 10913
263 Ga0209676_1004565 3300025292 Bacteria 7663
264 Ga0209676_1024486 3300025292 Bacteria 1954
265 Ga0209025_1000531 3300025294 Bacteria 72578
266 Ga0209025_1000745 3300025294 Bacteria 54850
267 Ga0209025_1001493 3300025294 Bacteria 30271
268 Ga0209025_1003514 3300025294 Bacteria 14717
269 Ga0209025_1003579 3300025294 Bacteria 14523
270 Ga0209025_1006274 3300025294 Bacteria 9300
271 Ga0209025_1008516 3300025294 Bacteria 7370
272 Ga0209564_1000270 3300025295 Bacteria 108503
273 Ga0209564_1000817 3300025295 Bacteria 42412
274 Ga0209564_1000912 3300025295 Bacteria 38636
275 Ga0209564_1001098 3300025295 Bacteria 32197
276 Ga0209758_1000064 3300025297 Bacteria 311812
277 Ga0209758_1006195 3300025297 Bacteria 8737
278 Ga0209758_1024025 3300025297 Bacteria 2731
279 Ga0209050_1000007 3300025298 Bacteria 1187891
280 Ga0209050_1000066 3300025298 Bacteria 305458
281 Ga0209050_1000570 3300025298 Bacteria 59779
282 Ga0209050_1000690 3300025298 Bacteria 50644
283 Ga0209050_1002884 3300025298 Bacteria 13579
284 Ga0209050_1003061 3300025298 Bacteria 12887
285 Ga0209050_1006842 3300025298 Bacteria 6622
286 Ga0209050_1006996 3300025298 Bacteria 6488
287 Ga0209050_1008118 3300025298 Bacteria 5691
288 Ga0209050_1019941 3300025298 Bacteria 2520
289 Ga0209256_1000003 3300025299 Bacteria 1661127
290 Ga0209256_1000020 3300025299 Bacteria 542402
291 Ga0209256_1000356 3300025299 Bacteria 74710
292 Ga0209256_1000577 3300025299 Bacteria 52302
293 Ga0207426_1000001 3300025302 Bacteria 1341301
294 Ga0207426_1000031 3300025302 Bacteria 460699
295 Ga0207426_1000061 3300025302 Bacteria 362507
296 Ga0207426_1001299 3300025302 Bacteria 21465
297 Ga0209051_1000009 3300025303 Bacteria 706778
298 Ga0209051_1000044 3300025303 Bacteria 305458
299 Ga0209051_1000210 3300025303 Bacteria 102629
300 Ga0209051_1000327 3300025303 Bacteria 71493
301 Ga0209051_1000363 3300025303 Bacteria 66432
302 Ga0209051_1000491 3300025303 Bacteria 51059
303 Ga0209051_1000564 3300025303 Bacteria 45000
304 Ga0209051_1018878 3300025303 Bacteria 3033
305 Ga0209257_1000011 3300025304 Bacteria 1112630
306 Ga0209257_1000055 3300025304 Bacteria 415534
307 Ga0209257_1000082 3300025304 Bacteria 305458
308 Ga0209257_1000314 3300025304 Bacteria 102629
309 Ga0209257_1000502 3300025304 Bacteria 69204
310 Ga0209257_1002902 3300025304 Bacteria 15869
311 Ga0209257_1006390 3300025304 Bacteria 7621
312 Ga0209257_1007389 3300025304 Bacteria 6645
313 Ga0209257_1011545 3300025304 Bacteria 4235
314 Ga0207655_1001588 3300025728 Bacteria 20387
315 Ga0207692_10117664 3300025898 Bacteria 1483
316 Ga0207654_10028668 3300025911 Bacteria 3037
317 Ga0207660_10113961 3300025917 Bacteria 2039
318 Ga0207662_10056620 3300025918 Bacteria 2342
319 Ga0207649_10005908 3300025920 Bacteria 6634
320 Ga0207649_10082370 3300025920 Bacteria 2086
321 Ga0207681_10129901 3300025923 Bacteria 1861
322 Ga0207690_10008693 3300025932 Bacteria 6025
323 Ga0207706_10006639 3300025933 Bacteria 10703
324 Ga0207706_10007228 3300025933 Bacteria 10267
325 Ga0207706_10027392 3300025933 Bacteria 5095
326 Ga0207686_10002673 3300025934 Bacteria 9679
327 Ga0207709_10000019 3300025935 Bacteria 402225
328 Ga0207709_10001066 3300025935 Bacteria 20206
329 Ga0207709_10002413 3300025935 Bacteria 11753
330 Ga0207709_10015195 3300025935 Bacteria 4267
331 Ga0207670_10483498 3300025936 Bacteria 1003
332 Ga0207669_10037359 3300025937 Bacteria 2786
333 Ga0207691_10293971 3300025940 Bacteria 1397
334 Ga0207689_10325742 3300025942 Bacteria 1275
335 Ga0207661_10108995 3300025944 Bacteria 2339
336 Ga0207679_10001480 3300025945 Bacteria 14724
337 Ga0207679_10003955 3300025945 Bacteria 9203
338 Ga0207667_10664516 3300025949 Bacteria 1047
339 Ga0207651_10162408 3300025960 Bacteria 1753
340 Ga0207640_10117256 3300025981 Bacteria 1900
341 Ga0207677_10015245 3300026023 Bacteria 4514
342 Ga0207677_10397527 3300026023 Bacteria 1168
343 Ga0207703_10014663 3300026035 Bacteria 6116
344 Ga0207639_10025392 3300026041 Bacteria 4296
345 Ga0207639_10355771 3300026041 Bacteria 1309
346 Ga0207678_10117897 3300026067 Bacteria 2265
347 Ga0207648_10459777 3300026089 Bacteria 1160
348 Ga0207676_10119487 3300026095 Bacteria 2220
349 Ga0207674_10531007 3300026116 Bacteria 1137
350 Ga0207683_10287041 3300026121 Bacteria 1504
351 Ga0207698_10034650 3300026142 Bacteria 3682
352 Ga0207698_10507377 3300026142 Bacteria 1175
353 Ga0209281_1000005 3300027111 Bacteria 1242284
354 Ga0209281_1004678 3300027111 Bacteria 4020
355 Ga0209282_1001130 3300027666 Bacteria 14241
356 Ga0209813_10002277 3300027866 Bacteria 4386
357 Ga0209974_10082148 3300027876 Bacteria 1110
358 Ga0209974_10099729 3300027876 Bacteria 1014
359 Ga0207428_10071917 3300027907 Bacteria 2716
360 Ga0268266_10049385 3300028379 Bacteria 3608
361 Ga0307515_10000026 3300028794 Bacteria 382411
362 Ga0307515_10000028 3300028794 Bacteria 368467
363 Ga0307515_10000358 3300028794 Bacteria 112133
364 Ga0307515_10000702 3300028794 Bacteria 77364
365 Ga0307515_10290805 3300028794 Bacteria 1330
366 Ga0316177_1015869 3300030731 Bacteria 1585
367 Ga0316176_1179678 3300030732 Bacteria 1731
368 Ga0314311_1173925 3300030733 Bacteria 2169
369 Ga0265330_10024749 3300031235 Bacteria 2722
370 Ga0265332_10000002 3300031238 Bacteria 709510
371 Ga0265332_10000003 3300031238 Bacteria 482849
372 Ga0265332_10029887 3300031238 Bacteria 2380
373 Ga0265325_10001303 3300031241 Bacteria 17663
374 Ga0265340_10023487 3300031247 Bacteria 3144
375 Ga0265327_10000293 3300031251 Bacteria 96862
376 Ga0265327_10013279 3300031251 Bacteria 5481
377 Ga0307513_10000012 3300031456 Bacteria 328865
378 Ga0307513_10000021 3300031456 Bacteria 228078
379 Ga0307513_10177396 3300031456 Bacteria 1999
380 Ga0307408_100001814 3300031548 Bacteria 15559
381 Ga0307408_100021024 3300031548 Bacteria 4411
382 Ga0307408_100111097 3300031548 Bacteria 2105
383 Ga0307408_100126179 3300031548 Bacteria 1990
384 Ga0307408_100487569 3300031548 Bacteria 1076
385 Ga0307408_100523765 3300031548 Bacteria 1041
386 Ga0307514_10011048 3300031649 Bacteria 7523
387 Ga0307514_10064235 3300031649 Bacteria 2784
388 Ga0265314_10000066 3300031711 Bacteria 156399
389 Ga0265314_10013569 3300031711 Bacteria 6574
390 Ga0265342_10053711 3300031712 Bacteria 2397
391 Ga0307516_10019825 3300031730 Bacteria 6954
392 Ga0307516_10281440 3300031730 Bacteria 1345
393 Ga0307405_10038723 3300031731 Bacteria 2876
394 Ga0307405_10111779 3300031731 Bacteria 1852
395 Ga0307405_10253448 3300031731 Bacteria 1311
396 Ga0307405_10371177 3300031731 Bacteria 1110
397 Ga0307406_10001092 3300031901 Bacteria 15102
398 Ga0307406_10004344 3300031901 Bacteria 7714
399 Ga0307407_10031017 3300031903 Bacteria 2891
400 Ga0307412_10007370 3300031911 Bacteria 6238
401 Ga0307412_10085187 3300031911 Bacteria 2196
402 Ga0307412_10091354 3300031911 Bacteria 2131
403 Ga0307412_10276440 3300031911 Bacteria 1316
404 Ga0307412_10362637 3300031911 Bacteria 1167
405 Ga0307416_100008192 3300032002 Bacteria 6719
406 Ga0307416_100917673 3300032002 Bacteria 976
407 Ga0307414_10004678 3300032004 Bacteria 7462
408 Ga0307411_10187615 3300032005 Bacteria 1575
409 Ga0307510_10299490 3300033180 Bacteria 1071
410 Ga0373923_0056557 3300035111 Bacteria 1657
411 Ga0373953_0021435 3300035117 Bacteria 2425
412 Ga0373954_0040264 3300035118 Bacteria 2177
413 Ga0373956_0105734 3300035119 Bacteria 1308
414 Ga0373955_0026390 3300035172 Bacteria 2992
415 Ga0373942_0002461 3300035207 Bacteria 4490
416 Ga0373924_0022331 3300035410 Bacteria 2474
417 Ga0373933_0078880 3300035724 Bacteria 2015
418 Ga0373947_0212293 3300035725 Bacteria 1270
419 Ga0373937_0351316 3300036401 Bacteria 1396
420 Ga0395899_0001484 3300037312 Bacteria 19967
421 Ga0395905_0000763 3300037471 Bacteria 42401
422 Ga0395905_0003434 3300037471 Bacteria 16949
423 Ga0395905_0010399 3300037471 Bacteria 9059
424 Ga0395905_0013696 3300037471 Bacteria 7766
425 Ga0395905_0016368 3300037471 Bacteria 7045
426 Ga0395905_0084023 3300037471 Bacteria 2982
427 Ga0395905_0127497 3300037471 Bacteria 2393
428 Ga0395905_0474924 3300037471 Bacteria 1149
429 Ga0395901_0166457 3300038443 Bacteria 2314
430 Ga0395901_0562302 3300038443 Bacteria 1155
431 Ga0436361_0292057 3300039447 Bacteria 25019
432 Ga0436361_0531535 3300039447 Bacteria 9893
433 Ga0439436_0007968 3300041404 Bacteria 3254
434 Ga0439439_0002537 3300041406 Bacteria 3897
435 Ga0439439_0035232 3300041406 Bacteria 1285
436 Ga0451789_0899535 3300041443 Bacteria 1097
437 Ga0451795_0091317 3300041456 Bacteria 4362
438 Ga0451800_0943611 3300041459 Bacteria 1169
439 Ga0451804_0073610 3300041463 Bacteria 1388
440 Ga0439431_0000588 3300041997 Bacteria 7704
441 Ga0439442_020156 3300042002 Bacteria 1381
442 Ga0439432_015682 3300042006 Bacteria 2554
443 Ga0439449_0000431 3300042007 Bacteria 15498
444 Ga0439449_0000884 3300042007 Bacteria 11695
445 Ga0439449_0001803 3300042007 Bacteria 8428
446 Ga0439449_0014807 3300042007 Bacteria 2930
447 Ga0439449_0020448 3300042007 Bacteria 2480
448 Ga0439449_0077836 3300042007 Bacteria 1223
449 Ga0439452_021393 3300042010 Bacteria 1686
450 Ga0439462_0006427 3300042015 Bacteria 2921
451 Ga0439462_0016415 3300042015 Bacteria 1912
452 Ga0450911_000110 3300042115 Bacteria 33959
453 Ga0450919_007990 3300042121 Bacteria 1229
454 Ga0450894_006311 3300042131 Bacteria 1530
455 Ga0450906_006599 3300042145 Bacteria 2333
456 Ga0450910_014396 3300042147 Bacteria 1157
457 Ga0439446_0021019 3300042156 Bacteria 1842
458 Ga0450908_001993 3300042184 Bacteria 3997
459 Ga0439434_0013581 3300042435 Bacteria 2419
460 Ga0439434_0018542 3300042435 Bacteria 2084
461 Ga0439434_0035255 3300042435 Bacteria 1529
462 Ga0450918_000575 3300042531 Bacteria 7811
463 Ga0450893_0003213 3300042532 Bacteria 2569
464 Ga0451577_0000141 3300042876 Bacteria 161372
465 Ga0451577_0000728 3300042876 Bacteria 51004
466 Ga0451577_0011015 3300042876 Bacteria 8588
467 Ga0451577_0175728 3300042876 Bacteria 1930
468 Ga0451577_0328749 3300042876 Bacteria 1386
469 Ga0466969_0114690 3300044656 Bacteria 1258
470 Ga0466972_0002814 3300044658 Bacteria 8620
471 Ga0453683_0000580 3300044673 Bacteria 40538
472 Ga0453683_0028768 3300044673 Bacteria 3517
473 Ga0466965_0062178 3300044683 Bacteria 1867
474 Ga0466965_0136060 3300044683 Bacteria 1277
475 Ga0466966_0038123 3300044684 Bacteria 3097
476 Ga0466964_0019078 3300044706 Bacteria 2635
477 Ga0453684_0000121 3300044712 Bacteria 341067
478 Ga0453684_0000463 3300044712 Bacteria 161665
479 Ga0453684_0158722 3300044712 Bacteria 2677
480 Ga0466970_0052586 3300044765 Bacteria 2174
481 Ga0466960_0034649 3300044901 Bacteria 2354
482 Ga0451576_0003962 3300045051 Bacteria 19723
483 Ga0451576_0009346 3300045051 Bacteria 11372
484 Ga0451576_0038430 3300045051 Bacteria 5065
485 Ga0466958_0199132 3300045836 Bacteria 1274
486 Ga0466967_0000299 3300045976 Bacteria 22210
487 Ga0495627_030565 3300046453 Bacteria 1706
488 Ga0495627_046255 3300046453 Bacteria 1323
489 Ga0495638_0009953 3300046460 Bacteria 6629
490 Ga0495610_0036121 3300046512 Bacteria 2528
491 Ga0495616_0004462 3300046513 Bacteria 8811
492 Ga0495620_0012665 3300046515 Bacteria 4343
493 Ga0495631_0000492 3300046518 Bacteria 26294
494 Ga0495632_0006419 3300046519 Bacteria 7564
495 Ga0495637_0001313 3300046520 Bacteria 14926
496 Ga0495663_0039039 3300046525 Bacteria 1437
497 Ga0495654_0002302 3300046530 Bacteria 12352
498 Ga0495654_0015854 3300046530 Bacteria 3995
499 Ga0495597_0002478 3300046542 Bacteria 11652
500 Ga0495633_0000652 3300046558 Bacteria 32073
501 Ga0495633_0104937 3300046558 Bacteria 1311
502 Ga0495656_0000110 3300046615 Bacteria 32732
503 Ga0495656_0065897 3300046615 Bacteria 1594
504 Ga0495625_0001291 3300046660 Bacteria 31462
505 Ga0495625_0048664 3300046660 Bacteria 3051
506 Ga0495588_0062888 3300046674 Bacteria 1924
507 Ga0495588_0123934 3300046674 Bacteria 1362
508 Ga0495588_0149065 3300046674 Bacteria 1236
509 Ga0495670_0163620 3300046691 Bacteria 1170
510 Ga0495676_0009977 3300047321 Bacteria 8629
511 Ga0495680_0086867 3300047322 Bacteria 2353
512 Ga0495593_0165794 3300047673 Bacteria 1114
513 Ga0495615_0000968 3300048090 Bacteria 4080
514 Ga0496102_0086239 3300048905 Bacteria 2899
515 Ga0496102_0181582 3300048905 Bacteria 1983
516 Ga0496103_0078808 3300048906 Bacteria 2069
517 Ga0496104_0010890 3300048907 Bacteria 8135
518 Ga0496105_0001768 3300048908 Bacteria 15456
519 Ga0496106_0155367 3300048909 Bacteria 1806
520 Ga0496109_0081034 3300048912 Bacteria 2991
521 Ga0496109_0254069 3300048912 Bacteria 1655
522 Ga0496110_0324266 3300048913 Bacteria 1403
523 Ga0496114_0098290 3300048917 Bacteria 2495
524 Ga0496117_0000166 3300048920 Bacteria 138665
525 Ga0496117_0042827 3300048920 Bacteria 3300
526 Ga0496117_0073959 3300048920 Bacteria 2271
527 Ga0496117_0107684 3300048920 Bacteria 1745
528 Ga0496118_0008215 3300048921 Bacteria 10841
529 Ga0496118_0009204 3300048921 Bacteria 10031
530 Ga0496121_0000187 3300048924 Bacteria 138361
531 Ga0496121_0031937 3300048924 Bacteria 4799
532 Ga0496121_0081487 3300048924 Bacteria 2561
533 Ga0496121_0192386 3300048924 Bacteria 1461
534 Ga0496122_0013572 3300048925 Bacteria 7957
535 Ga0496122_0060650 3300048925 Bacteria 2784
536 Ga0496122_0073012 3300048925 Bacteria 2436
537 Ga0496123_0001126 3300048926 Bacteria 39890
538 Ga0496123_0028778 3300048926 Bacteria 4107
539 Ga0496123_0058815 3300048926 Bacteria 2490
540 Ga0496123_0121532 3300048926 Bacteria 1468
541 Ga0496124_0005536 3300048927 Bacteria 14150
542 Ga0496124_0041510 3300048927 Bacteria 3969
543 Ga0496124_0095827 3300048927 Bacteria 2411
544 Ga0496125_0002287 3300048928 Bacteria 25337
545 Ga0496125_0012190 3300048928 Bacteria 8554
546 Ga0496125_0012633 3300048928 Bacteria 8360
547 Ga0496125_0037939 3300048928 Bacteria 4181
548 Ga0496125_0039882 3300048928 Bacteria 4036
549 Ga0496125_0133162 3300048928 Bacteria 1745
550 Ga0501034_0209785 3300049571 Bacteria 1903
551 Ga0501046_0046217 3300049580 Bacteria 3457
552 Ga0501047_0208380 3300049581 Bacteria 1814
553 Ga0501048_0068176 3300049582 Bacteria 2514
554 Ga0501069_0102787 3300049585 Bacteria 1623
555 Ga0501072_0046328 3300049588 Bacteria 3422
556 Ga0501249_002771 3300049679 Bacteria 3528
557 Ga0501257_050029 3300049686 Bacteria 1041
558 Ga0501225_0026111 3300049705 Bacteria 1607
559 Ga0501080_0358444 3300049742 Bacteria 1316
560 Ga0501081_0091872 3300049743 Bacteria 2135
561 Ga0501262_000249 3300049759 Bacteria 6596
562 Ga0501035_0051331 3300049822 Bacteria 3693
563 nmdc:mga03683_2050_c1 3300050489 Bacteria 6177
564 nmdc:mga03683_39668_c2 3300050489 Bacteria 873
565 nmdc:mga03683_47448_c1 3300050489 Bacteria 1782
566 nmdc:mga03683_51802_c1 3300050489 Bacteria 1715
567 nmdc:mga03n38_160566_c1 3300050490 Bacteria 1138
568 nmdc:mga00v17_36402_c1 3300050491 Bacteria 2933
569 nmdc:mga0yw44_24689_c1 3300050492 Bacteria 3405
570 nmdc:mga0k408_14139_c1 3300050493 Bacteria 4391
571 nmdc:mga0k408_14754_c1 3300050493 Bacteria 4311
572 nmdc:mga0k408_194963_c1 3300050493 Bacteria 1209
573 nmdc:mga0k408_197313_c1 3300050493 Bacteria 1201
574 nmdc:mga0k408_34900_c1 3300050493 Bacteria 2882
575 nmdc:mga0k408_40749_c1 3300050493 Bacteria 2673
576 nmdc:mga0k408_56778_c1 3300050493 Bacteria 2272
577 nmdc:mga0k408_5749_c1 3300050493 Bacteria 6599
578 nmdc:mga0k408_9371_c1 3300050493 Bacteria 5276
579 nmdc:mga06z11_253318_c1 3300050494 Bacteria 1037
580 nmdc:mga06z11_320472_c1 3300050494 Bacteria 924
581 nmdc:mga06z11_33598_c1 3300050494 Bacteria 2511
582 nmdc:mga04h51_2488_c1 3300050495 Bacteria 4378
583 nmdc:mga07m45_14730_c1 3300050496 Bacteria 4174
584 nmdc:mga07m45_1917_c1 3300050496 Bacteria 9613
585 nmdc:mga07m45_46008_c1 3300050496 Bacteria 2451
586 nmdc:mga07m45_75177_c1 3300050496 Bacteria 1925
587 nmdc:mga0qj67_82537_c1 3300050509 Bacteria 2577
588 nmdc:mga0n895_58_c1 3300050512 Bacteria 65261
589 nmdc:mga0n895_619_c1 3300050512 Bacteria 24714
590 nmdc:mga0rr50_12556_c1 3300050513 Bacteria 5482
591 nmdc:mga0rr50_3841_c1 3300050513 Bacteria 8723
592 nmdc:mga08x19_727_c1 3300050514 Bacteria 21023
593 nmdc:mga0a205_173783_c1 3300050515 Bacteria 2050
594 nmdc:mga0a205_4300_c1 3300050515 Bacteria 12783
595 nmdc:mga0sz30_37496_c1 3300050516 Bacteria 2029
596 nmdc:mga0sz30_9757_c1 3300050516 Bacteria 3660
597 Ga0500610_0000495 3300053079 Bacteria 12122
598 Ga0500610_0005628 3300053079 Bacteria 5162
599 Ga0500643_002223 3300053087 Bacteria 10250
600 Ga0500644_0056391 3300053088 Bacteria 1367
601 Ga0500647_0088775 3300053091 Bacteria 1481
602 Ga0500583_0105989 3300053092 Bacteria 1381
603 Ga0500651_0000353 3300053093 Bacteria 25788
604 Ga0500651_0012001 3300053093 Bacteria 5240
605 Ga0500566_0053538 3300053094 Bacteria 2303
606 Ga0500650_0000718 3300053098 Bacteria 8906
607 Ga0500650_0031206 3300053098 Bacteria 2421
608 Ga0500562_003594 3300053108 Bacteria 3892
609 Ga0500571_000114 3300053110 Bacteria 26125
610 Ga0500593_002014 3300053117 Bacteria 7371
611 Ga0500593_003386 3300053117 Bacteria 6013
612 Ga0500594_0020643 3300053118 Bacteria 1645
613 Ga0500618_001358 3300053125 Bacteria 11139
614 Ga0500623_035386 3300053127 Bacteria 2571
615 Ga0500642_0001092 3300053130 Bacteria 7776
616 Ga0500652_000099 3300053131 Bacteria 34685
617 Ga0500655_001134 3300053133 Bacteria 5067
618 Ga0500655_012038 3300053133 Bacteria 1571
619 Ga0500559_0065092 3300053136 Bacteria 1632
620 Ga0500568_0008532 3300053139 Bacteria 4931
621 Ga0500568_0021455 3300053139 Bacteria 2777
622 Ga0500574_018941 3300053141 Bacteria 1706
623 Ga0500616_0009122 3300053153 Bacteria 6064
624 Ga0500622_0000097 3300053156 Bacteria 89802
625 Ga0500627_0000364 3300053158 Bacteria 12279
626 Ga0500634_0034126 3300053161 Bacteria 2772
627 Ga0500625_048548 3300053729 Bacteria 1970
628 Ga0500645_000274 3300053730 Bacteria 36869
629 Ga0500645_001839 3300053730 Bacteria 10172
630 Ga0501084_0020258 3300054114 Bacteria 5545
631 Ga0500661_002343 3300055283 Bacteria 3573
632 Ga0590071_000677 3300059421 Bacteria 9667

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0000166 Ga0496117_0000166_14554_15255 226
2 3300053098 Ga0500650_0000718 Ga0500650_0000718_6565_7368 249
3 3300053117 Ga0500593_002014 Ga0500593_002014_2927_3751 249
4 3300041406 Ga0439439_0035232 Ga0439439_0035232_372_1190 250
5 3300059421 Ga0590071_000677 Ga0590071_000677_7370_8206 250
6 3300003791 Ga0055530_10006721 Ga0055530_100067212 251
7 3300003792 Ga0055540_1000086 Ga0055540_100008684 251
8 3300003794 Ga0055531_10010642 Ga0055531_100106422 251
9 3300006195 Ga0075366_10007976 Ga0075366_100079762 251
10 3300006946 Ga0079104_1000100 Ga0079104_1000100109 251
11 3300025298 Ga0209050_1002884 Ga0209050_10028849 251
12 3300025303 Ga0209051_1000210 Ga0209051_100021083 251
13 3300025304 Ga0209257_1000314 Ga0209257_100031483 251
14 3300027111 Ga0209281_1004678 Ga0209281_10046782 251
15 3300050493 nmdc:mga0k408_5749_c1 nmdc:mga0k408_5749_c1_1786_2622 251
16 3300005328 Ga0070676_10081865 Ga0070676_100818652 252
17 3300005329 Ga0070683_100096688 Ga0070683_1000966882 252
18 3300005330 Ga0070690_100046592 Ga0070690_1000465923 252
19 3300005343 Ga0070687_100028560 Ga0070687_1000285603 252
20 3300005544 Ga0070686_100013770 Ga0070686_1000137703 252
21 3300005615 Ga0070702_100354814 Ga0070702_1003548142 252
22 3300005842 Ga0068858_100088828 Ga0068858_1000888282 252
23 3300006237 Ga0097621_100001352 Ga0097621_1000013527 252
24 3300006358 Ga0068871_100072909 Ga0068871_1000729093 252
25 3300006871 Ga0075434_100001022 Ga0075434_10000102216 252
26 3300006914 Ga0075436_100039260 Ga0075436_1000392602 252
27 3300007076 Ga0075435_100013976 Ga0075435_1000139763 252
28 3300009148 Ga0105243_10007155 Ga0105243_100071555 252
29 3300014969 Ga0157376_10021945 Ga0157376_100219453 252
30 3300025918 Ga0207662_10056620 Ga0207662_100566203 252
31 3300025935 Ga0207709_10015195 Ga0207709_100151953 252
32 3300025944 Ga0207661_10108995 Ga0207661_101089953 252
33 3300027907 Ga0207428_10071917 Ga0207428_100719172 252
34 3300035119 Ga0373956_0105734 Ga0373956_0105734_222_992 252
35 3300035207 Ga0373942_0002461 Ga0373942_0002461_267_1115 252
36 3300042156 Ga0439446_0021019 Ga0439446_0021019_408_1178 252
37 3300042435 Ga0439434_0035255 Ga0439434_0035255_464_1234 252
38 3300049582 Ga0501048_0068176 Ga0501048_0068176_925_1695 252
39 3300049588 Ga0501072_0046328 Ga0501072_0046328_1154_1924 252
40 3300049743 Ga0501081_0091872 Ga0501081_0091872_301_1071 252
41 3300050512 nmdc:mga0n895_619_c1 nmdc:mga0n895_619_c1_4777_5547 252
42 3300050513 nmdc:mga0rr50_3841_c1 nmdc:mga0rr50_3841_c1_4541_5311 252
43 3300050515 nmdc:mga0a205_173783_c1 nmdc:mga0a205_173783_c1_1237_2025 252
44 3300005340 Ga0070689_100167342 Ga0070689_1001673422 253
45 3300005437 Ga0070710_10028644 Ga0070710_100286442 253
46 3300005617 Ga0068859_100101309 Ga0068859_1001013093 253
47 3300005985 Ga0081539_10001356 Ga0081539_1000135622 253
48 3300006852 Ga0075433_10000369 Ga0075433_1000036926 253
49 3300006871 Ga0075434_100000187 Ga0075434_10000018714 253
50 3300006914 Ga0075436_100016561 Ga0075436_1000165614 253
51 3300006931 Ga0097620_100101314 Ga0097620_1001013143 253
52 3300007076 Ga0075435_100000126 Ga0075435_1000001266 253
53 3300007265 Ga0099794_10001777 Ga0099794_100017774 253
54 3300009094 Ga0111539_10055258 Ga0111539_100552584 253
55 3300025898 Ga0207692_10117664 Ga0207692_101176642 253
56 3300025936 Ga0207670_10483498 Ga0207670_104834982 253
57 3300026035 Ga0207703_10014663 Ga0207703_100146633 253
58 3300026095 Ga0207676_10119487 Ga0207676_101194872 253
59 3300035111 Ga0373923_0056557 Ga0373923_0056557_464_1249 253
60 3300035117 Ga0373953_0021435 Ga0373953_0021435_222_1061 253
61 3300035118 Ga0373954_0040264 Ga0373954_0040264_604_1389 253
62 3300035172 Ga0373955_0026390 Ga0373955_0026390_1443_2228 253
63 3300035410 Ga0373924_0022331 Ga0373924_0022331_415_1200 253
64 3300035724 Ga0373933_0078880 Ga0373933_0078880_382_1167 253
65 3300035725 Ga0373947_0212293 Ga0373947_0212293_380_1153 253
66 3300036401 Ga0373937_0351316 Ga0373937_0351316_232_1017 253
67 3300044706 Ga0466964_0019078 Ga0466964_0019078_441_1223 253
68 3300045836 Ga0466958_0199132 Ga0466958_0199132_410_1192 253
69 3300045976 Ga0466967_0000299 Ga0466967_0000299_8553_9335 253
70 3300047322 Ga0495680_0086867 Ga0495680_0086867_805_1590 253
71 3300049585 Ga0501069_0102787 Ga0501069_0102787_209_982 253
72 3300050512 nmdc:mga0n895_58_c1 nmdc:mga0n895_58_c1_7989_8765 253
73 3300050513 nmdc:mga0rr50_12556_c1 nmdc:mga0rr50_12556_c1_4254_5030 253
74 3300050514 nmdc:mga08x19_727_c1 nmdc:mga08x19_727_c1_14695_15471 253
75 3300050515 nmdc:mga0a205_4300_c1 nmdc:mga0a205_4300_c1_2830_3606 253
76 3300054114 Ga0501084_0020258 Ga0501084_0020258_3143_3916 253
77 3300028794 Ga0307515_10000026 Ga0307515_10000026131 254
78 3300037471 Ga0395905_0010399 Ga0395905_0010399_4724_5527 254
79 3300048924 Ga0496121_0000187 Ga0496121_0000187_21109_22008 254
80 3300037471 Ga0395905_0013696 Ga0395905_0013696_5745_6548 255
81 iso_pu_bacteria 2842733646 2842735539 255
82 iso_pu_bacteria 2919704043 2919704792 255
83 3300042145 Ga0450906_006599 Ga0450906_006599_1451_2263 256
84 3300042876 Ga0451577_0000141 Ga0451577_0000141_149049_149867 256
85 3300044673 Ga0453683_0000580 Ga0453683_0000580_38881_39699 256
86 3300044683 Ga0466965_0062178 Ga0466965_0062178_418_1227 256
87 3300044712 Ga0453684_0000463 Ga0453684_0000463_11811_12629 256
88 3300044901 Ga0466960_0034649 Ga0466960_0034649_1128_1937 256
89 3300045051 Ga0451576_0038430 Ga0451576_0038430_1132_1950 256
90 3300048927 Ga0496124_0005536 Ga0496124_0005536_9866_10699 256
91 3300053125 Ga0500618_001358 Ga0500618_001358_1576_2490 256
92 iso_pu_bacteria 2511231002 2511245562 256
93 3300005564 Ga0070664_100599947 Ga0070664_1005999471 257
94 3300005577 Ga0068857_100030969 Ga0068857_1000309692 257
95 3300005616 Ga0068852_100007651 Ga0068852_1000076513 257
96 3300006038 Ga0075365_10021178 Ga0075365_100211783 257
97 3300006042 Ga0075368_10002580 Ga0075368_100025803 257
98 3300006048 Ga0075363_100009495 Ga0075363_1000094955 257
99 3300006051 Ga0075364_10096910 Ga0075364_100969102 257
100 3300006177 Ga0075362_10004271 Ga0075362_100042716 257
101 3300006178 Ga0075367_10003242 Ga0075367_100032427 257
102 3300006353 Ga0075370_10016758 Ga0075370_100167585 257
103 3300006353 Ga0075370_10019514 Ga0075370_100195142 257
104 3300006353 Ga0075370_10027582 Ga0075370_100275824 257
105 3300009093 Ga0105240_10085376 Ga0105240_100853763 257
106 3300009174 Ga0105241_10312537 Ga0105241_103125373 257
107 3300009545 Ga0105237_10011096 Ga0105237_100110969 257
108 3300025933 Ga0207706_10027392 Ga0207706_100273924 257
109 3300026067 Ga0207678_10117897 Ga0207678_101178973 257
110 3300027866 Ga0209813_10002277 Ga0209813_100022776 257
111 3300028794 Ga0307515_10000358 Ga0307515_1000035884 257
112 3300046691 Ga0495670_0163620 Ga0495670_0163620_263_1081 257
113 3300050493 nmdc:mga0k408_14754_c1 nmdc:mga0k408_14754_c1_2465_3271 257
114 3300050493 nmdc:mga0k408_197313_c1 nmdc:mga0k408_197313_c1_272_1078 257
115 3300050493 nmdc:mga0k408_34900_c1 nmdc:mga0k408_34900_c1_892_1698 257
116 3300050494 nmdc:mga06z11_33598_c1 nmdc:mga06z11_33598_c1_356_1162 257
117 3300050495 nmdc:mga04h51_2488_c1 nmdc:mga04h51_2488_c1_1217_2023 257
118 3300050496 nmdc:mga07m45_14730_c1 nmdc:mga07m45_14730_c1_2157_2963 257
119 3300050496 nmdc:mga07m45_1917_c1 nmdc:mga07m45_1917_c1_7904_8710 257
120 3300050496 nmdc:mga07m45_75177_c1 nmdc:mga07m45_75177_c1_981_1787 257
121 3300050516 nmdc:mga0sz30_9757_c1 nmdc:mga0sz30_9757_c1_1185_1991 257
122 iso_pu_bacteria 2643221660 2644340150 257
123 iso_pu_bacteria 2842747753 2842751368 257
124 iso_pu_bacteria 2885192300 2885192840 257
125 iso_pu_bacteria 2928115317 2928116220 257
126 3300031235 Ga0265330_10024749 Ga0265330_100247492 258
127 3300031238 Ga0265332_10029887 Ga0265332_100298872 258
128 3300031456 Ga0307513_10000012 Ga0307513_1000001290 258
129 3300031711 Ga0265314_10013569 Ga0265314_100135695 258
130 3300031911 Ga0307412_10085187 Ga0307412_100851873 258
131 3300048927 Ga0496124_0095827 Ga0496124_0095827_437_1240 258
132 3300049571 Ga0501034_0209785 Ga0501034_0209785_52_891 258
133 3300049580 Ga0501046_0046217 Ga0501046_0046217_1512_2351 258
134 3300049742 Ga0501080_0358444 Ga0501080_0358444_61_900 258
135 3300049822 Ga0501035_0051331 Ga0501035_0051331_438_1277 258
136 iso_pu_bacteria 2881101125 2881102349 258
137 3300006353 Ga0075370_10034068 Ga0075370_100340682 259
138 3300015683 Ga0183362_10001 Ga0183362_100011481 259
139 3300026089 Ga0207648_10459777 Ga0207648_104597772 259
140 3300028794 Ga0307515_10000028 Ga0307515_10000028305 259
141 3300028794 Ga0307515_10000702 Ga0307515_1000070212 259
142 3300028794 Ga0307515_10290805 Ga0307515_102908051 259
143 3300031548 Ga0307408_100021024 Ga0307408_1000210242 259
144 3300031649 Ga0307514_10064235 Ga0307514_100642352 259
145 3300033180 Ga0307510_10299490 Ga0307510_102994901 259
146 3300042876 Ga0451577_0000728 Ga0451577_0000728_42539_43348 259
147 3300042876 Ga0451577_0011015 Ga0451577_0011015_1418_2230 259
148 3300042876 Ga0451577_0328749 Ga0451577_0328749_228_1040 259
149 3300044673 Ga0453683_0028768 Ga0453683_0028768_268_1080 259
150 3300044712 Ga0453684_0000121 Ga0453684_0000121_299220_300029 259
151 3300044712 Ga0453684_0158722 Ga0453684_0158722_1629_2441 259
152 3300045051 Ga0451576_0003962 Ga0451576_0003962_11055_11864 259
153 3300045051 Ga0451576_0009346 Ga0451576_0009346_6815_7627 259
154 3300046453 Ga0495627_046255 Ga0495627_046255_437_1261 259
155 3300046515 Ga0495620_0012665 Ga0495620_0012665_420_1244 259
156 3300046520 Ga0495637_0001313 Ga0495637_0001313_13817_14641 259
157 3300053079 Ga0500610_0000495 Ga0500610_0000495_8899_9723 259
158 3300053079 Ga0500610_0005628 Ga0500610_0005628_2401_3225 259
159 3300053158 Ga0500627_0000364 Ga0500627_0000364_3126_3950 259
160 iso_pu_bacteria 2513020051 2513227396 259
161 iso_pu_bacteria 2599185214 2599624499 259
162 iso_pu_bacteria 2599185226 2599672639 259
163 iso_pu_bacteria 2599185227 2599683639 259
164 iso_pu_bacteria 2599185229 2599694248 259
165 iso_pu_bacteria 2643221628 2644159451 259
166 iso_pu_bacteria 2643221658 2644328068 259
167 iso_pu_bacteria 2643221672 2644398623 259
168 iso_pu_bacteria 2643221683 2644468576 259
169 iso_pu_bacteria 2738543013 2739250885 259
170 iso_pu_bacteria 2842677519 2842678809 259
171 iso_pu_bacteria 2894023352 2894026654 259
172 iso_pu_bacteria 2904449895 2904454574 259
173 iso_pu_bacteria 2904456579 2904460983 259
174 iso_pu_bacteria 2919462493 2919465861 259
175 iso_pu_bacteria 2928084124 2928084958 259
176 iso_pu_bacteria 2929520902 2929526866 259
177 iso_pu_bacteria 2945909444 2945912418 259
178 iso_pu_bacteria 2945945610 2945948332 259
179 iso_pu_bacteria 2945972063 2945977027 259
180 3300002705 JGI25156J39149_1000002 JGI25156J39149_1000002158 260
181 3300002738 JGI25154J39366_1000010 JGI25154J39366_1000010159 260
182 3300002741 JGI25157J39369_1000001 JGI25157J39369_1000001179 260
183 3300002774 JGI25150J39212_1011673 JGI25150J39212_10116731 260
184 3300002987 JGI25159J45721_1001031 JGI25159J45721_100103110 260
185 3300002987 JGI25159J45721_1001487 JGI25159J45721_10014877 260
186 3300003187 JGI25151J46595_10005377 JGI25151J46595_100053777 260
187 3300003187 JGI25151J46595_10005605 JGI25151J46595_100056053 260
188 3300003354 JGI25160J50197_1000301 JGI25160J50197_100030110 260
189 3300003354 JGI25160J50197_1015284 JGI25160J50197_10152842 260
190 3300003374 JGI25161J50226_1000043 JGI25161J50226_1000043105 260
191 3300003771 Ga0055526_1000766 Ga0055526_10007669 260
192 3300003771 Ga0055526_1005571 Ga0055526_10055713 260
193 3300003773 Ga0055537_1000365 Ga0055537_10003657 260
194 3300003773 Ga0055537_1000479 Ga0055537_10004796 260
195 3300003775 Ga0055524_1000130 Ga0055524_100013018 260
196 3300003781 Ga0055536_1000896 Ga0055536_10008968 260
197 3300003790 Ga0055528_1000145 Ga0055528_100014535 260
198 3300003791 Ga0055530_10000265 Ga0055530_100002657 260
199 3300003792 Ga0055540_1000079 Ga0055540_100007916 260
200 3300003794 Ga0055531_10001363 Ga0055531_100013637 260
201 3300004625 Ga0055543_1000805 Ga0055543_10008055 260
202 3300005262 Ga0065165_1008339 Ga0065165_10083392 260
203 3300005262 Ga0065165_1008653 Ga0065165_10086534 260
204 3300005353 Ga0070669_100198122 Ga0070669_1001981223 260
205 3300005578 Ga0068854_100221493 Ga0068854_1002214932 260
206 3300006051 Ga0075364_10006781 Ga0075364_100067813 260
207 3300006177 Ga0075362_10010016 Ga0075362_100100163 260
208 3300006195 Ga0075366_10027503 Ga0075366_100275032 260
209 3300006946 Ga0079104_1011656 Ga0079104_10116564 260
210 3300021361 Ga0213872_10012229 Ga0213872_100122293 260
211 3300025206 Ga0209435_100001 Ga0209435_1000011139 260
212 3300025245 Ga0207425_1000959 Ga0207425_10009599 260
213 3300025245 Ga0207425_1005184 Ga0207425_10051844 260
214 3300025246 Ga0209646_1000001 Ga0209646_10000011508 260
215 3300025250 Ga0209026_1000001 Ga0209026_1000001160 260
216 3300025256 Ga0209759_1000001 Ga0209759_10000011139 260
217 3300025263 Ga0209565_1000096 Ga0209565_100009692 260
218 3300025263 Ga0209565_1001491 Ga0209565_10014916 260
219 3300025273 Ga0209673_1000232 Ga0209673_100023238 260
220 3300025284 Ga0209130_1000041 Ga0209130_1000041176 260
221 3300025284 Ga0209130_1000508 Ga0209130_100050831 260
222 3300025291 Ga0209675_1001714 Ga0209675_10017146 260
223 3300025291 Ga0209675_1019065 Ga0209675_10190652 260
224 3300025292 Ga0209676_1000054 Ga0209676_1000054196 260
225 3300025292 Ga0209676_1003024 Ga0209676_10030246 260
226 3300025294 Ga0209025_1003579 Ga0209025_10035794 260
227 3300025294 Ga0209025_1006274 Ga0209025_10062745 260
228 3300025295 Ga0209564_1000912 Ga0209564_100091219 260
229 3300025295 Ga0209564_1001098 Ga0209564_100109813 260
230 3300025297 Ga0209758_1024025 Ga0209758_10240253 260
231 3300025298 Ga0209050_1000066 Ga0209050_1000066196 260
232 3300025298 Ga0209050_1006842 Ga0209050_10068423 260
233 3300025298 Ga0209050_1019941 Ga0209050_10199413 260
234 3300025299 Ga0209256_1000003 Ga0209256_10000031469 260
235 3300025302 Ga0207426_1000061 Ga0207426_100006165 260
236 3300025302 Ga0207426_1001299 Ga0207426_10012994 260
237 3300025303 Ga0209051_1000044 Ga0209051_1000044196 260
238 3300025304 Ga0209257_1000082 Ga0209257_1000082196 260
239 3300025304 Ga0209257_1011545 Ga0209257_10115454 260
240 3300025923 Ga0207681_10129901 Ga0207681_101299012 260
241 3300027876 Ga0209974_10082148 Ga0209974_100821482 260
242 3300031456 Ga0307513_10000021 Ga0307513_1000002188 260
243 3300031730 Ga0307516_10019825 Ga0307516_100198253 260
244 3300031730 Ga0307516_10281440 Ga0307516_102814402 260
245 3300039447 Ga0436361_0531535 Ga0436361_0531535_7456_8265 260
246 3300041443 Ga0451789_0899535 Ga0451789_0899535_197_1060 260
247 3300046453 Ga0495627_030565 Ga0495627_030565_796_1626 260
248 3300046530 Ga0495654_0002302 Ga0495654_0002302_4653_5462 260
249 3300048925 Ga0496122_0013572 Ga0496122_0013572_1536_2345 260
250 3300048925 Ga0496122_0060650 Ga0496122_0060650_1681_2511 260
251 3300048926 Ga0496123_0001126 Ga0496123_0001126_18049_18858 260
252 3300048926 Ga0496123_0028778 Ga0496123_0028778_2236_3066 260
253 3300050493 nmdc:mga0k408_40749_c1 nmdc:mga0k408_40749_c1_1691_2506 260
254 3300053088 Ga0500644_0056391 Ga0500644_0056391_342_1157 260
255 3300053094 Ga0500566_0053538 Ga0500566_0053538_1412_2227 260
256 3300053117 Ga0500593_003386 Ga0500593_003386_1938_2753 260
257 3300053730 Ga0500645_000274 Ga0500645_000274_18725_19531 260
258 3300053730 Ga0500645_001839 Ga0500645_001839_3746_4552 260
259 3300055283 Ga0500661_002343 Ga0500661_002343_728_1543 260
260 iso_pu_bacteria 2643221644 2644248993 260
261 iso_pu_bacteria 2818991446 2819595912 260
262 iso_pu_bacteria 2899924645 2899925260 260
263 3300003578 Ga0006562J51391_1151955 Ga0006562J51391_11519552 261
264 3300003578 Ga0006562J51391_1151956 Ga0006562J51391_11519563 261
265 3300003792 Ga0055540_1001104 Ga0055540_10011046 261
266 3300005288 Ga0065714_10124086 Ga0065714_101240861 261
267 3300005336 Ga0070680_100098501 Ga0070680_1000985011 261
268 3300005367 Ga0070667_100162647 Ga0070667_1001626471 261
269 3300005459 Ga0068867_100160666 Ga0068867_1001606661 261
270 3300005548 Ga0070665_100279277 Ga0070665_1002792772 261
271 3300005548 Ga0070665_100334758 Ga0070665_1003347582 261
272 3300006038 Ga0075365_10051968 Ga0075365_100519683 261
273 3300006177 Ga0075362_10008739 Ga0075362_100087394 261
274 3300006186 Ga0075369_10047418 Ga0075369_100474182 261
275 3300009176 Ga0105242_10410953 Ga0105242_104109531 261
276 3300013104 Ga0157370_10730574 Ga0157370_107305741 261
277 3300014325 Ga0163163_10652925 Ga0163163_106529251 261
278 3300014497 Ga0182008_10000418 Ga0182008_100004186 261
279 3300014497 Ga0182008_10008154 Ga0182008_100081544 261
280 3300014497 Ga0182008_10096862 Ga0182008_100968622 261
281 3300015262 Ga0182007_10002274 Ga0182007_1000227411 261
282 3300015265 Ga0182005_1048620 Ga0182005_10486202 261
283 3300021361 Ga0213872_10000074 Ga0213872_1000007412 261
284 3300025303 Ga0209051_1000363 Ga0209051_100036351 261
285 3300025917 Ga0207660_10113961 Ga0207660_101139611 261
286 3300025937 Ga0207669_10037359 Ga0207669_100373592 261
287 3300025940 Ga0207691_10293971 Ga0207691_102939711 261
288 3300025960 Ga0207651_10162408 Ga0207651_101624082 261
289 3300026121 Ga0207683_10287041 Ga0207683_102870412 261
290 3300026142 Ga0207698_10507377 Ga0207698_105073771 261
291 3300027876 Ga0209974_10099729 Ga0209974_100997292 261
292 3300028379 Ga0268266_10049385 Ga0268266_100493852 261
293 3300031238 Ga0265332_10000003 Ga0265332_10000003238 261
294 3300031251 Ga0265327_10013279 Ga0265327_100132792 261
295 3300031548 Ga0307408_100487569 Ga0307408_1004875692 261
296 3300031731 Ga0307405_10253448 Ga0307405_102534482 261
297 3300031901 Ga0307406_10004344 Ga0307406_100043446 261
298 3300032004 Ga0307414_10004678 Ga0307414_100046786 261
299 3300037471 Ga0395905_0003434 Ga0395905_0003434_6445_7263 261
300 3300037471 Ga0395905_0016368 Ga0395905_0016368_1572_2375 261
301 3300039447 Ga0436361_0292057 Ga0436361_0292057_1316_2161 261
302 3300041404 Ga0439436_0007968 Ga0439436_0007968_475_1326 261
303 3300041997 Ga0439431_0000588 Ga0439431_0000588_1630_2460 261
304 3300042006 Ga0439432_015682 Ga0439432_015682_185_1036 261
305 3300042007 Ga0439449_0000884 Ga0439449_0000884_6084_6914 261
306 3300042007 Ga0439449_0001803 Ga0439449_0001803_7462_8295 261
307 3300042007 Ga0439449_0014807 Ga0439449_0014807_536_1366 261
308 3300042007 Ga0439449_0077836 Ga0439449_0077836_222_1037 261
309 3300042010 Ga0439452_021393 Ga0439452_021393_782_1615 261
310 3300042015 Ga0439462_0016415 Ga0439462_0016415_611_1462 261
311 3300042131 Ga0450894_006311 Ga0450894_006311_179_991 261
312 3300042435 Ga0439434_0018542 Ga0439434_0018542_539_1390 261
313 3300046525 Ga0495663_0039039 Ga0495663_0039039_183_1010 261
314 3300046558 Ga0495633_0104937 Ga0495633_0104937_263_1090 261
315 3300046615 Ga0495656_0000110 Ga0495656_0000110_14493_15320 261
316 3300046615 Ga0495656_0065897 Ga0495656_0065897_97_924 261
317 3300046674 Ga0495588_0149065 Ga0495588_0149065_288_1115 261
318 3300048905 Ga0496102_0086239 Ga0496102_0086239_1402_2229 261
319 3300048906 Ga0496103_0078808 Ga0496103_0078808_998_1825 261
320 3300048907 Ga0496104_0010890 Ga0496104_0010890_5236_6063 261
321 3300048908 Ga0496105_0001768 Ga0496105_0001768_2211_3038 261
322 3300048909 Ga0496106_0155367 Ga0496106_0155367_188_1015 261
323 3300048912 Ga0496109_0081034 Ga0496109_0081034_1323_2225 261
324 3300048912 Ga0496109_0254069 Ga0496109_0254069_389_1216 261
325 3300048913 Ga0496110_0324266 Ga0496110_0324266_463_1365 261
326 3300050489 nmdc:mga03683_47448_c1 nmdc:mga03683_47448_c1_735_1553 261
327 3300050489 nmdc:mga03683_51802_c1 nmdc:mga03683_51802_c1_692_1525 261
328 3300050516 nmdc:mga0sz30_37496_c1 nmdc:mga0sz30_37496_c1_381_1196 261
329 3300053136 Ga0500559_0065092 Ga0500559_0065092_657_1478 261
330 iso_pu_bacteria 2547132374 2548498315 261
331 iso_pu_bacteria 2643221717 2644648849 261
332 iso_pu_bacteria 2738541277 2738720199 261
333 iso_pu_bacteria 2738541307 2738881741 261
334 iso_pu_bacteria 2738543019 2739279398 261
335 iso_pu_bacteria 2842718218 2842720273 261
336 iso_pu_bacteria 2885198086 2885199007 261
337 iso_pu_bacteria 2885211737 2885212730 261
338 iso_pu_bacteria 2919688452 2919688522 261
339 iso_pu_bacteria 2928070936 2928071101 261
340 iso_pu_bacteria 2932422444 2932423624 261
341 iso_pu_bacteria 2945984333 2945985264 261
342 iso_pu_bacteria 2974320154 2974322737 261
343 3300003187 JGI25151J46595_10006891 JGI25151J46595_100068911 262
344 3300003775 Ga0055524_1000167 Ga0055524_10001676 262
345 3300003781 Ga0055536_1016391 Ga0055536_10163912 262
346 3300003791 Ga0055530_10018585 Ga0055530_100185855 262
347 3300003794 Ga0055531_10020052 Ga0055531_100200524 262
348 3300005262 Ga0065165_1012867 Ga0065165_10128676 262
349 3300005338 Ga0068868_100439366 Ga0068868_1004393662 262
350 3300005344 Ga0070661_100002671 Ga0070661_1000026712 262
351 3300005366 Ga0070659_100133938 Ga0070659_1001339383 262
352 3300005564 Ga0070664_100298088 Ga0070664_1002980882 262
353 3300025263 Ga0209565_1019267 Ga0209565_10192671 262
354 3300025291 Ga0209675_1025320 Ga0209675_10253202 262
355 3300025291 Ga0209675_1034908 Ga0209675_10349081 262
356 3300025292 Ga0209676_1002444 Ga0209676_10024449 262
357 3300025294 Ga0209025_1003514 Ga0209025_10035149 262
358 3300025298 Ga0209050_1003061 Ga0209050_10030616 262
359 3300025298 Ga0209050_1008118 Ga0209050_10081186 262
360 3300025299 Ga0209256_1000356 Ga0209256_10003566 262
361 3300025304 Ga0209257_1002902 Ga0209257_100290212 262
362 3300025920 Ga0207649_10005908 Ga0207649_100059082 262
363 3300025932 Ga0207690_10008693 Ga0207690_100086937 262
364 3300025945 Ga0207679_10001480 Ga0207679_1000148017 262
365 3300031251 Ga0265327_10000293 Ga0265327_1000029337 262
366 3300037471 Ga0395905_0127497 Ga0395905_0127497_666_1493 262
367 3300046558 Ga0495633_0000652 Ga0495633_0000652_11124_11954 262
368 3300048917 Ga0496114_0098290 Ga0496114_0098290_891_1700 262
369 3300053118 Ga0500594_0020643 Ga0500594_0020643_481_1305 262
370 iso_pu_bacteria 2643221570 2643867582 262
371 iso_pu_bacteria 2643221596 2643990502 262
372 iso_pu_bacteria 2643221609 2644062927 262
373 iso_pu_bacteria 2643221611 2644070610 262
374 iso_pu_bacteria 2738543012 2739243748 262
375 iso_pu_bacteria 2816332133 2816472587 262
376 iso_pu_bacteria 2831265667 2831266938 262
377 iso_pu_bacteria 2838054893 2838056997 262
378 iso_pu_bacteria 2904541872 2904548365 262
379 iso_pu_bacteria 2928037797 2928038617 262
380 iso_pu_bacteria 2928044640 2928045778 262
381 iso_pu_bacteria 2928051484 2928053395 262
382 iso_pu_bacteria 2928064002 2928067000 262
383 iso_pu_bacteria 2929160207 2929163758 262
384 iso_pu_bacteria 2990710928 2990713096 262
385 3300003187 JGI25151J46595_10000849 JGI25151J46595_1000084915 263
386 3300003773 Ga0055537_1000124 Ga0055537_100012453 263
387 3300003781 Ga0055536_1001627 Ga0055536_10016275 263
388 3300003781 Ga0055536_1013807 Ga0055536_10138073 263
389 3300003784 Ga0055534_1000117 Ga0055534_10001178 263
390 3300003790 Ga0055528_1001213 Ga0055528_10012138 263
391 3300003790 Ga0055528_1022869 Ga0055528_10228692 263
392 3300003791 Ga0055530_10013110 Ga0055530_100131102 263
393 3300003792 Ga0055540_1000578 Ga0055540_10005786 263
394 3300003792 Ga0055540_1004004 Ga0055540_10040043 263
395 3300003794 Ga0055531_10013529 Ga0055531_100135293 263
396 3300005289 Ga0065704_10081381 Ga0065704_100813813 263
397 3300005457 Ga0070662_100009317 Ga0070662_1000093172 263
398 3300005530 Ga0070679_100187766 Ga0070679_1001877662 263
399 3300005530 Ga0070679_100614913 Ga0070679_1006149131 263
400 3300005563 Ga0068855_100096209 Ga0068855_1000962092 263
401 3300005564 Ga0070664_100027002 Ga0070664_1000270023 263
402 3300005616 Ga0068852_100030084 Ga0068852_1000300843 263
403 3300006038 Ga0075365_10059315 Ga0075365_100593152 263
404 3300006048 Ga0075363_100011657 Ga0075363_1000116573 263
405 3300006177 Ga0075362_10020067 Ga0075362_100200672 263
406 3300006177 Ga0075362_10072510 Ga0075362_100725102 263
407 3300006177 Ga0075362_10138525 Ga0075362_101385252 263
408 3300006178 Ga0075367_10160279 Ga0075367_101602792 263
409 3300006195 Ga0075366_10001774 Ga0075366_100017743 263
410 3300006195 Ga0075366_10067359 Ga0075366_100673592 263
411 3300006195 Ga0075366_10078028 Ga0075366_100780282 263
412 3300006353 Ga0075370_10000855 Ga0075370_100008552 263
413 3300006353 Ga0075370_10000948 Ga0075370_100009487 263
414 3300006353 Ga0075370_10003921 Ga0075370_100039213 263
415 3300006358 Ga0068871_100293739 Ga0068871_1002937392 263
416 3300006948 Ga0099826_10000831 Ga0099826_1000083111 263
417 3300009093 Ga0105240_10088473 Ga0105240_100884731 263
418 3300009551 Ga0105238_10289003 Ga0105238_102890031 263
419 3300011119 Ga0105246_10071480 Ga0105246_100714803 263
420 3300013100 Ga0157373_10075329 Ga0157373_100753291 263
421 3300014497 Ga0182008_10032416 Ga0182008_100324163 263
422 3300015261 Ga0182006_1055366 Ga0182006_10553661 263
423 3300017792 Ga0163161_10031156 Ga0163161_100311564 263
424 3300017792 Ga0163161_10037236 Ga0163161_100372363 263
425 3300025258 Ga0209129_1001811 Ga0209129_100181111 263
426 3300025263 Ga0209565_1000114 Ga0209565_1000114113 263
427 3300025273 Ga0209673_1000572 Ga0209673_10005728 263
428 3300025273 Ga0209673_1002127 Ga0209673_100212710 263
429 3300025291 Ga0209675_1000029 Ga0209675_1000029278 263
430 3300025292 Ga0209676_1000418 Ga0209676_100041827 263
431 3300025292 Ga0209676_1000705 Ga0209676_100070523 263
432 3300025292 Ga0209676_1024486 Ga0209676_10244862 263
433 3300025294 Ga0209025_1000531 Ga0209025_100053140 263
434 3300025298 Ga0209050_1000570 Ga0209050_100057020 263
435 3300025298 Ga0209050_1006996 Ga0209050_10069964 263
436 3300025303 Ga0209051_1000327 Ga0209051_100032764 263
437 3300025303 Ga0209051_1000564 Ga0209051_10005647 263
438 3300025304 Ga0209257_1000502 Ga0209257_100050223 263
439 3300025304 Ga0209257_1007389 Ga0209257_10073894 263
440 3300025728 Ga0207655_1001588 Ga0207655_10015885 263
441 3300025933 Ga0207706_10006639 Ga0207706_100066396 263
442 3300025935 Ga0207709_10001066 Ga0207709_1000106618 263
443 3300025935 Ga0207709_10002413 Ga0207709_100024138 263
444 3300025945 Ga0207679_10003955 Ga0207679_100039553 263
445 3300025981 Ga0207640_10117256 Ga0207640_101172562 263
446 3300026041 Ga0207639_10025392 Ga0207639_100253924 263
447 3300026041 Ga0207639_10355771 Ga0207639_103557712 263
448 3300026116 Ga0207674_10531007 Ga0207674_105310071 263
449 3300026142 Ga0207698_10034650 Ga0207698_100346503 263
450 3300027666 Ga0209282_1001130 Ga0209282_10011307 263
451 3300030731 Ga0316177_1015869 Ga0316177_10158692 263
452 3300030732 Ga0316176_1179678 Ga0316176_11796782 263
453 3300030733 Ga0314311_1173925 Ga0314311_11739253 263
454 3300031456 Ga0307513_10177396 Ga0307513_101773962 263
455 3300031548 Ga0307408_100126179 Ga0307408_1001261792 263
456 3300031548 Ga0307408_100523765 Ga0307408_1005237652 263
457 3300031649 Ga0307514_10011048 Ga0307514_100110482 263
458 3300031731 Ga0307405_10038723 Ga0307405_100387232 263
459 3300031731 Ga0307405_10371177 Ga0307405_103711772 263
460 3300031903 Ga0307407_10031017 Ga0307407_100310172 263
461 3300031911 Ga0307412_10007370 Ga0307412_100073705 263
462 3300031911 Ga0307412_10091354 Ga0307412_100913542 263
463 3300031911 Ga0307412_10276440 Ga0307412_102764402 263
464 3300031911 Ga0307412_10362637 Ga0307412_103626371 263
465 3300032005 Ga0307411_10187615 Ga0307411_101876151 263
466 3300037471 Ga0395905_0000763 Ga0395905_0000763_35578_36402 263
467 3300037471 Ga0395905_0084023 Ga0395905_0084023_754_1581 263
468 3300038443 Ga0395901_0562302 Ga0395901_0562302_48_872 263
469 3300042002 Ga0439442_020156 Ga0439442_020156_248_1069 263
470 3300042007 Ga0439449_0020448 Ga0439449_0020448_403_1218 263
471 3300042115 Ga0450911_000110 Ga0450911_000110_4924_5745 263
472 3300042147 Ga0450910_014396 Ga0450910_014396_320_1141 263
473 3300042184 Ga0450908_001993 Ga0450908_001993_2132_2953 263
474 3300042435 Ga0439434_0013581 Ga0439434_0013581_100_921 263
475 3300042876 Ga0451577_0175728 Ga0451577_0175728_258_1082 263
476 3300044683 Ga0466965_0136060 Ga0466965_0136060_41_871 263
477 3300046660 Ga0495625_0001291 Ga0495625_0001291_28913_29734 263
478 3300046674 Ga0495588_0123934 Ga0495588_0123934_39_863 263
479 3300048924 Ga0496121_0031937 Ga0496121_0031937_3593_4414 263
480 3300048926 Ga0496123_0058815 Ga0496123_0058815_1375_2199 263
481 3300048928 Ga0496125_0002287 Ga0496125_0002287_16927_17760 263
482 3300048928 Ga0496125_0012190 Ga0496125_0012190_510_1331 263
483 3300048928 Ga0496125_0037939 Ga0496125_0037939_2060_2884 263
484 3300048928 Ga0496125_0133162 Ga0496125_0133162_914_1735 263
485 3300049679 Ga0501249_002771 Ga0501249_002771_1557_2378 263
486 3300049686 Ga0501257_050029 Ga0501257_050029_83_904 263
487 3300049705 Ga0501225_0026111 Ga0501225_0026111_125_946 263
488 3300049759 Ga0501262_000249 Ga0501262_000249_807_1628 263
489 3300050489 nmdc:mga03683_2050_c1 nmdc:mga03683_2050_c1_4061_4882 263
490 3300050490 nmdc:mga03n38_160566_c1 nmdc:mga03n38_160566_c1_155_976 263
491 3300050491 nmdc:mga00v17_36402_c1 nmdc:mga00v17_36402_c1_1991_2812 263
492 3300050493 nmdc:mga0k408_194963_c1 nmdc:mga0k408_194963_c1_337_1167 263
493 3300050493 nmdc:mga0k408_56778_c1 nmdc:mga0k408_56778_c1_293_1117 263
494 3300050493 nmdc:mga0k408_9371_c1 nmdc:mga0k408_9371_c1_4143_4964 263
495 iso_pu_bacteria 2547132374 2548501295 263
496 iso_pu_bacteria 2585428057 2587727937 263
497 iso_pu_bacteria 2585428058 2587733756 263
498 iso_pu_bacteria 2643221717 2644649161 263
499 iso_pu_bacteria 2839138175 2839143197 263
500 3300002773 JGI25152J39213_1003097 JGI25152J39213_10030973 264
501 3300002773 JGI25152J39213_1006587 JGI25152J39213_10065873 264
502 3300002774 JGI25150J39212_1002336 JGI25150J39212_10023362 264
503 3300002987 JGI25159J45721_1008017 JGI25159J45721_10080172 264
504 3300003187 JGI25151J46595_10009023 JGI25151J46595_100090232 264
505 3300003187 JGI25151J46595_10011921 JGI25151J46595_100119213 264
506 3300003215 JGI25153J46596_10006648 JGI25153J46596_100066483 264
507 3300003374 JGI25161J50226_1002461 JGI25161J50226_10024612 264
508 3300003761 Ga0055535_1000263 Ga0055535_100026314 264
509 3300003762 Ga0055542_1000004 Ga0055542_1000004118 264
510 3300003771 Ga0055526_1009308 Ga0055526_10093082 264
511 3300003771 Ga0055526_1009358 Ga0055526_10093582 264
512 3300003773 Ga0055537_1003569 Ga0055537_10035692 264
513 3300003775 Ga0055524_1007210 Ga0055524_10072102 264
514 3300003775 Ga0055524_1013103 Ga0055524_10131032 264
515 3300003781 Ga0055536_1002373 Ga0055536_100237311 264
516 3300003784 Ga0055534_1005542 Ga0055534_10055423 264
517 3300003784 Ga0055534_1006602 Ga0055534_10066023 264
518 3300003790 Ga0055528_1007631 Ga0055528_10076312 264
519 3300003791 Ga0055530_10005615 Ga0055530_100056156 264
520 3300003792 Ga0055540_1014383 Ga0055540_10143833 264
521 3300003792 Ga0055540_1017767 Ga0055540_10177673 264
522 3300003794 Ga0055531_10022816 Ga0055531_100228162 264
523 3300003794 Ga0055531_10022924 Ga0055531_100229242 264
524 3300004625 Ga0055543_1001896 Ga0055543_10018965 264
525 3300004625 Ga0055543_1002001 Ga0055543_10020014 264
526 3300005262 Ga0065165_1005107 Ga0065165_10051075 264
527 3300005564 Ga0070664_100259811 Ga0070664_1002598112 264
528 3300006048 Ga0075363_100118134 Ga0075363_1001181342 264
529 3300006177 Ga0075362_10017847 Ga0075362_100178472 264
530 3300006353 Ga0075370_10159443 Ga0075370_101594432 264
531 3300006353 Ga0075370_10192607 Ga0075370_101926072 264
532 3300025208 Ga0209436_105671 Ga0209436_1056713 264
533 3300025228 Ga0209672_100775 Ga0209672_10077513 264
534 3300025229 Ga0209147_100541 Ga0209147_1005416 264
535 3300025242 Ga0209258_100022 Ga0209258_100022118 264
536 3300025245 Ga0207425_1000154 Ga0207425_10001546 264
537 3300025245 Ga0207425_1002619 Ga0207425_10026196 264
538 3300025254 Ga0209148_1000034 Ga0209148_1000034118 264
539 3300025258 Ga0209129_1000023 Ga0209129_1000023198 264
540 3300025258 Ga0209129_1003387 Ga0209129_10033875 264
541 3300025258 Ga0209129_1026680 Ga0209129_10266801 264
542 3300025263 Ga0209565_1000125 Ga0209565_10001256 264
543 3300025263 Ga0209565_1004038 Ga0209565_10040383 264
544 3300025273 Ga0209673_1000192 Ga0209673_100019211 264
545 3300025273 Ga0209673_1000583 Ga0209673_10005836 264
546 3300025284 Ga0209130_1000113 Ga0209130_1000113103 264
547 3300025284 Ga0209130_1000752 Ga0209130_100075220 264
548 3300025291 Ga0209675_1001840 Ga0209675_10018404 264
549 3300025291 Ga0209675_1003283 Ga0209675_10032836 264
550 3300025292 Ga0209676_1000005 Ga0209676_1000005604 264
551 3300025292 Ga0209676_1000285 Ga0209676_100028511 264
552 3300025292 Ga0209676_1004565 Ga0209676_10045654 264
553 3300025294 Ga0209025_1000745 Ga0209025_100074543 264
554 3300025294 Ga0209025_1001493 Ga0209025_10014934 264
555 3300025294 Ga0209025_1008516 Ga0209025_10085163 264
556 3300025295 Ga0209564_1000270 Ga0209564_100027092 264
557 3300025295 Ga0209564_1000817 Ga0209564_10008176 264
558 3300025297 Ga0209758_1000064 Ga0209758_100006499 264
559 3300025297 Ga0209758_1006195 Ga0209758_10061954 264
560 3300025298 Ga0209050_1000007 Ga0209050_1000007493 264
561 3300025298 Ga0209050_1000690 Ga0209050_100069021 264
562 3300025299 Ga0209256_1000020 Ga0209256_1000020470 264
563 3300025299 Ga0209256_1000577 Ga0209256_100057725 264
564 3300025302 Ga0207426_1000001 Ga0207426_10000011105 264
565 3300025302 Ga0207426_1000031 Ga0207426_1000031122 264
566 3300025303 Ga0209051_1000009 Ga0209051_1000009604 264
567 3300025303 Ga0209051_1018878 Ga0209051_10188784 264
568 3300025304 Ga0209257_1000011 Ga0209257_1000011578 264
569 3300025304 Ga0209257_1006390 Ga0209257_10063906 264
570 3300025920 Ga0207649_10082370 Ga0207649_100823703 264
571 3300025933 Ga0207706_10007228 Ga0207706_100072287 264
572 3300026023 Ga0207677_10397527 Ga0207677_103975272 264
573 3300037312 Ga0395899_0001484 Ga0395899_0001484_16224_17057 264
574 3300037471 Ga0395905_0474924 Ga0395905_0474924_136_978 264
575 3300038443 Ga0395901_0166457 Ga0395901_0166457_1409_2242 264
576 3300042121 Ga0450919_007990 Ga0450919_007990_59_874 264
577 3300042531 Ga0450918_000575 Ga0450918_000575_2537_3352 264
578 3300044656 Ga0466969_0114690 Ga0466969_0114690_158_1000 264
579 3300044658 Ga0466972_0002814 Ga0466972_0002814_2088_2897 264
580 3300044684 Ga0466966_0038123 Ga0466966_0038123_1785_2627 264
581 3300044765 Ga0466970_0052586 Ga0466970_0052586_1317_2159 264
582 3300046542 Ga0495597_0002478 Ga0495597_0002478_1669_2490 264
583 3300050489 nmdc:mga03683_39668_c2 nmdc:mga03683_39668_c2_28_855 264
584 3300002987 JGI25159J45721_1012808 JGI25159J45721_10128082 265
585 3300003781 Ga0055536_1019956 Ga0055536_10199562 265
586 3300003784 Ga0055534_1003009 Ga0055534_10030095 265
587 3300003784 Ga0055534_1004914 Ga0055534_10049143 265
588 3300006038 Ga0075365_10027325 Ga0075365_100273252 265
589 3300009036 Ga0105244_10000699 Ga0105244_1000069927 265
590 3300009148 Ga0105243_10009092 Ga0105243_100090924 265
591 3300009148 Ga0105243_10034358 Ga0105243_100343583 265
592 3300009148 Ga0105243_10042495 Ga0105243_100424952 265
593 3300009176 Ga0105242_10006957 Ga0105242_100069577 265
594 3300009176 Ga0105242_10350059 Ga0105242_103500591 265
595 3300009551 Ga0105238_10197750 Ga0105238_101977501 265
596 3300010375 Ga0105239_10594363 Ga0105239_105943631 265
597 3300011119 Ga0105246_10291497 Ga0105246_102914972 265
598 3300011119 Ga0105246_10309044 Ga0105246_103090442 265
599 3300013100 Ga0157373_10158989 Ga0157373_101589891 265
600 3300013104 Ga0157370_10022578 Ga0157370_100225783 265
601 3300013105 Ga0157369_10044036 Ga0157369_100440364 265
602 3300015261 Ga0182006_1000867 Ga0182006_10008676 265
603 3300015262 Ga0182007_10000627 Ga0182007_1000062719 265
604 3300025284 Ga0209130_1001465 Ga0209130_100146511 265
605 3300025291 Ga0209675_1000705 Ga0209675_100070522 265
606 3300025934 Ga0207686_10002673 Ga0207686_100026737 265
607 3300031731 Ga0307405_10111779 Ga0307405_101117792 265
608 3300032002 Ga0307416_100917673 Ga0307416_1009176731 265
609 3300042532 Ga0450893_0003213 Ga0450893_0003213_1511_2347 265
610 3300046512 Ga0495610_0036121 Ga0495610_0036121_485_1315 265
611 3300046513 Ga0495616_0004462 Ga0495616_0004462_5327_6157 265
612 3300046518 Ga0495631_0000492 Ga0495631_0000492_22940_23770 265
613 3300046530 Ga0495654_0015854 Ga0495654_0015854_2350_3180 265
614 3300046660 Ga0495625_0048664 Ga0495625_0048664_1011_1835 265
615 3300046674 Ga0495588_0062888 Ga0495588_0062888_170_994 265
616 3300047321 Ga0495676_0009977 Ga0495676_0009977_103_933 265
617 3300047673 Ga0495593_0165794 Ga0495593_0165794_41_871 265
618 3300048905 Ga0496102_0181582 Ga0496102_0181582_961_1791 265
619 3300048920 Ga0496117_0042827 Ga0496117_0042827_261_1091 265
620 3300048920 Ga0496117_0073959 Ga0496117_0073959_595_1425 265
621 3300048920 Ga0496117_0107684 Ga0496117_0107684_90_920 265
622 3300048921 Ga0496118_0008215 Ga0496118_0008215_5444_6274 265
623 3300048921 Ga0496118_0009204 Ga0496118_0009204_5796_6626 265
624 3300048924 Ga0496121_0081487 Ga0496121_0081487_1624_2454 265
625 3300048924 Ga0496121_0192386 Ga0496121_0192386_400_1230 265
626 3300048925 Ga0496122_0073012 Ga0496122_0073012_1468_2298 265
627 3300048926 Ga0496123_0121532 Ga0496123_0121532_607_1437 265
628 3300048927 Ga0496124_0041510 Ga0496124_0041510_580_1410 265
629 3300048928 Ga0496125_0012633 Ga0496125_0012633_5118_5945 265
630 3300048928 Ga0496125_0039882 Ga0496125_0039882_1460_2290 265
631 3300050492 nmdc:mga0yw44_24689_c1 nmdc:mga0yw44_24689_c1_1854_2684 265
632 3300050493 nmdc:mga0k408_14139_c1 nmdc:mga0k408_14139_c1_132_956 265
633 3300050494 nmdc:mga06z11_253318_c1 nmdc:mga06z11_253318_c1_87_911 265
634 3300050494 nmdc:mga06z11_320472_c1 nmdc:mga06z11_320472_c1_45_893 265
635 3300050496 nmdc:mga07m45_46008_c1 nmdc:mga07m45_46008_c1_976_1800 265
636 3300053087 Ga0500643_002223 Ga0500643_002223_1139_1969 265
637 3300053091 Ga0500647_0088775 Ga0500647_0088775_602_1432 265
638 3300053093 Ga0500651_0000353 Ga0500651_0000353_7331_8161 265
639 3300053108 Ga0500562_003594 Ga0500562_003594_1359_2207 265
640 3300053110 Ga0500571_000114 Ga0500571_000114_22720_23550 265
641 3300053133 Ga0500655_001134 Ga0500655_001134_1289_2119 265
642 3300053139 Ga0500568_0008532 Ga0500568_0008532_2205_3035 265
643 3300053141 Ga0500574_018941 Ga0500574_018941_787_1617 265
644 3300053153 Ga0500616_0009122 Ga0500616_0009122_2504_3334 265
645 3300053161 Ga0500634_0034126 Ga0500634_0034126_855_1685 265
646 3300053729 Ga0500625_048548 Ga0500625_048548_264_1094 265
647 3300009174 Ga0105241_10055398 Ga0105241_100553983 266
648 3300025911 Ga0207654_10028668 Ga0207654_100286683 266
649 3300025942 Ga0207689_10325742 Ga0207689_103257421 266
650 3300031548 Ga0307408_100001814 Ga0307408_1000018144 266
651 3300031901 Ga0307406_10001092 Ga0307406_100010924 266
652 3300048090 Ga0495615_0000968 Ga0495615_0000968_1972_2811 266
653 iso_pu_bacteria 2643221652 2644294982 266
654 3300003794 Ga0055531_10000536 Ga0055531_1000053629 267
655 3300006353 Ga0075370_10031657 Ga0075370_100316573 267
656 3300006880 Ga0075429_100090684 Ga0075429_1000906842 267
657 3300006946 Ga0079104_1000034 Ga0079104_1000034157 267
658 3300009092 Ga0105250_10028913 Ga0105250_100289132 267
659 3300009148 Ga0105243_10003962 Ga0105243_100039623 267
660 3300013100 Ga0157373_10132358 Ga0157373_101323582 267
661 3300014969 Ga0157376_10932236 Ga0157376_109322361 267
662 3300025303 Ga0209051_1000491 Ga0209051_100049112 267
663 3300025304 Ga0209257_1000055 Ga0209257_100005521 267
664 3300025935 Ga0207709_10000019 Ga0207709_1000001926 267
665 3300025949 Ga0207667_10664516 Ga0207667_106645162 267
666 3300026023 Ga0207677_10015245 Ga0207677_100152455 267
667 3300027111 Ga0209281_1000005 Ga0209281_1000005155 267
668 3300031238 Ga0265332_10000002 Ga0265332_10000002486 267
669 3300031241 Ga0265325_10001303 Ga0265325_1000130312 267
670 3300031247 Ga0265340_10023487 Ga0265340_100234871 267
671 3300031548 Ga0307408_100111097 Ga0307408_1001110972 267
672 3300031711 Ga0265314_10000066 Ga0265314_1000006656 267
673 3300031712 Ga0265342_10053711 Ga0265342_100537112 267
674 3300032002 Ga0307416_100008192 Ga0307416_1000081924 267
675 3300041406 Ga0439439_0002537 Ga0439439_0002537_2093_2932 267
676 3300041456 Ga0451795_0091317 Ga0451795_0091317_488_1321 267
677 3300041459 Ga0451800_0943611 Ga0451800_0943611_48_884 267
678 3300041463 Ga0451804_0073610 Ga0451804_0073610_191_1024 267
679 3300042007 Ga0439449_0000431 Ga0439449_0000431_29_868 267
680 3300042015 Ga0439462_0006427 Ga0439462_0006427_592_1431 267
681 3300046460 Ga0495638_0009953 Ga0495638_0009953_662_1495 267
682 3300046519 Ga0495632_0006419 Ga0495632_0006419_1011_1844 267
683 3300049581 Ga0501047_0208380 Ga0501047_0208380_624_1463 267
684 3300050509 nmdc:mga0qj67_82537_c1 nmdc:mga0qj67_82537_c1_1485_2333 267
685 3300053092 Ga0500583_0105989 Ga0500583_0105989_32_865 267
686 3300053093 Ga0500651_0012001 Ga0500651_0012001_3375_4208 267
687 3300053098 Ga0500650_0031206 Ga0500650_0031206_25_858 267
688 3300053127 Ga0500623_035386 Ga0500623_035386_242_1075 267
689 3300053130 Ga0500642_0001092 Ga0500642_0001092_2895_3728 267
690 3300053131 Ga0500652_000099 Ga0500652_000099_18155_18988 267
691 3300053133 Ga0500655_012038 Ga0500655_012038_588_1421 267
692 3300053139 Ga0500568_0021455 Ga0500568_0021455_1092_1925 267
693 3300053156 Ga0500622_0000097 Ga0500622_0000097_35050_35883 267
694 iso_pu_bacteria 2721755523 2722884597 267
695 3300001979 JGI24740J21852_10011138 JGI24740J21852_100111381 268
696 3300001979 JGI24740J21852_10013604 JGI24740J21852_100136042 268
697 3300006195 Ga0075366_10013528 Ga0075366_100135286 268
698 3300013297 Ga0157378_10069662 Ga0157378_100696624 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01790

LGT

Prolipoprotein diacylglyceryl transferase

52

306

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7944 2 263
5azc-assembly1.cif.gz_A crystal structure of escherichia coli lgt in complex with phosphatidylglycerol 0.7753 2 263
4u99-assembly2.cif.gz_B crystal structure of an h-nox protein from s. oneidensis in the fe(ii) ligation state, q154a/q155a/k156a mutant 0.6131 95 142
7d3e-assembly1.cif.gz_B cryo-em structure of human duox1-duoxa1 in low-calcium state 0.5272 176 261
2zzf-assembly1.cif.gz_A crystal structure of alanyl-trna synthetase without oligomerization domain 0.3857 109 260
ID Description Score Start End Superfamily
af_Q7K1I4_1_105_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.6599 187 259 1.20.120.350
af_Q8L7H8_5_108_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5661 178 260 1.10.10.1740
af_Q8LD38_5_108_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5637 178 260 1.10.10.1740
af_O01578_26_133_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.5467 187 260 1.10.10.1740
af_A0A1D6PYC9_52_155_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.4462 21 145 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A519M239-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9746 123 268 GO:0005886
GO:0008961
GO:0042158
AF-A0A655YEH0-F1-model_v4 Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-) 0.9711 112 260 GO:0005886
GO:0008961
GO:0042158
AF-A0A1E7YRZ7-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.969 119 260 GO:0005886
GO:0008961
GO:0042158
AF-A0A6N9SNN2-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.9678 143 260 GO:0005886
GO:0008961
GO:0042158
AF-A0A348ZWD3-F1-model_v4 Prolipoprotein diacylglyceryl transferase 0.961 128 254 GO:0005886
GO:0008961
GO:0042158

Feature Viewer

pLDDT pTM Quality
93.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map