F475987
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 349 | 1396 | 224 |
Family's Representative Sequence
| Representative Sequence | 3300049588|Ga0501072_0023500|Ga0501072_0023500_2579_3355 |
| Length | 258 |
| Sequence | VNATVGQGRVDLRNRLTAPNPAFHFSFILRRSLWCEDEVKMASLIRRGLRREGIAADVAIKGEDALWMAEATEYDAIVLDLMLPGIDGLEVCRRLRAEGVWSPILMLTARDAVRDRVAGLDGGADDYVTKPFSYAELLARLRALVRRGPAERPTQLEVGDLRLDPATRRVWRDDTEIELSAKEFAILEIFMRRAGEVLSRFQLLEHAWDYDYENRSNVVDSYVRFLRRKIDKPFGVESIETVRGAGYRLRDDGGGRES |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 58 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 97 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 143 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 148 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 149 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 150 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 160 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 168 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 169 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 170 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 171 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 172 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 173 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 174 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 175 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 176 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 177 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 178 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 179 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 180 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 181 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 182 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 183 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 188 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 248 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 260 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 261 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 262 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 263 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 264 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 314 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 315 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 317 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 318 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 319 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 320 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 321 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 322 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 323 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 324 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 326 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 327 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 328 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 329 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 330 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 331 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 332 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 334 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 335 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 336 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 340 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 341 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 342 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 343 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 344 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 345 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 346 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 347 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 348 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 349 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.57 |
| Metatranscriptomes | 0.14 |
| Isolates | 1.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.44 |
| Nodule | 0 |
| Rhizoplane | 5.3 |
| Rhizosphere | 82.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501072_0023500 | 3300049588 | Bacteria | 4789 |
| 2 | JGI25406J46586_10016300 | 3300003203 | Bacteria | 3101 |
| 3 | Ga0065712_10134679 | 3300005290 | Bacteria | 1487 |
| 4 | Ga0070658_10167205 | 3300005327 | Bacteria | 1847 |
| 5 | Ga0070683_100001023 | 3300005329 | Bacteria | 20987 |
| 6 | Ga0070683_100426284 | 3300005329 | Bacteria | 1266 |
| 7 | Ga0070690_100220633 | 3300005330 | Bacteria | 1328 |
| 8 | Ga0068869_100055969 | 3300005334 | Bacteria | 2875 |
| 9 | Ga0070680_100167508 | 3300005336 | Bacteria | 1848 |
| 10 | Ga0070682_100124198 | 3300005337 | Bacteria | 1737 |
| 11 | Ga0068868_100030488 | 3300005338 | Bacteria | 4136 |
| 12 | Ga0070668_100326753 | 3300005347 | Bacteria | 1292 |
| 13 | Ga0070669_100120823 | 3300005353 | Bacteria | 1998 |
| 14 | Ga0070669_100475705 | 3300005353 | Bacteria | 1033 |
| 15 | Ga0070674_100280002 | 3300005356 | Bacteria | 1321 |
| 16 | Ga0070673_100579406 | 3300005364 | Bacteria | 1022 |
| 17 | Ga0070659_100145991 | 3300005366 | Bacteria | 1927 |
| 18 | Ga0070667_100000223 | 3300005367 | Bacteria | 65543 |
| 19 | Ga0070709_10263492 | 3300005434 | Bacteria | 1246 |
| 20 | Ga0070714_100177698 | 3300005435 | Bacteria | 1935 |
| 21 | Ga0070713_100873452 | 3300005436 | Bacteria | 864 |
| 22 | Ga0070701_10072885 | 3300005438 | Bacteria | 1840 |
| 23 | Ga0070705_100096968 | 3300005440 | Bacteria | 1852 |
| 24 | Ga0070700_100168651 | 3300005441 | Bacteria | 1514 |
| 25 | Ga0070694_100018986 | 3300005444 | Bacteria | 4369 |
| 26 | Ga0070708_100364018 | 3300005445 | Bacteria | 1363 |
| 27 | Ga0070663_100406052 | 3300005455 | Bacteria | 1115 |
| 28 | Ga0070663_100497112 | 3300005455 | Bacteria | 1012 |
| 29 | Ga0070678_100088450 | 3300005456 | Bacteria | 2368 |
| 30 | Ga0070678_100174377 | 3300005456 | Bacteria | 1754 |
| 31 | Ga0070662_100279092 | 3300005457 | Bacteria | 1352 |
| 32 | Ga0070681_10039140 | 3300005458 | Bacteria | 4753 |
| 33 | Ga0068867_100158097 | 3300005459 | Bacteria | 1785 |
| 34 | Ga0070698_100000518 | 3300005471 | Bacteria | 41042 |
| 35 | Ga0070698_100011475 | 3300005471 | Bacteria | 9402 |
| 36 | Ga0070698_100128964 | 3300005471 | Bacteria | 2485 |
| 37 | Ga0070699_100003005 | 3300005518 | Bacteria | 14987 |
| 38 | Ga0070699_100756683 | 3300005518 | Bacteria | 889 |
| 39 | Ga0070679_100150861 | 3300005530 | Bacteria | 2301 |
| 40 | Ga0070684_100150171 | 3300005535 | Bacteria | 2110 |
| 41 | Ga0070684_100452029 | 3300005535 | Bacteria | 1187 |
| 42 | Ga0070684_100631378 | 3300005535 | Bacteria | 997 |
| 43 | Ga0070697_100110630 | 3300005536 | Bacteria | 2289 |
| 44 | Ga0070697_100274165 | 3300005536 | Bacteria | 1446 |
| 45 | Ga0070686_100002743 | 3300005544 | Bacteria | 9696 |
| 46 | Ga0070686_100070463 | 3300005544 | Bacteria | 2286 |
| 47 | Ga0070696_100081602 | 3300005546 | Bacteria | 2291 |
| 48 | Ga0070665_100005604 | 3300005548 | Bacteria | 12910 |
| 49 | Ga0070665_100309521 | 3300005548 | Bacteria | 1583 |
| 50 | Ga0070704_100077141 | 3300005549 | Bacteria | 2440 |
| 51 | Ga0070704_100110388 | 3300005549 | Bacteria | 2092 |
| 52 | Ga0070664_100475507 | 3300005564 | Bacteria | 1149 |
| 53 | Ga0068856_100197319 | 3300005614 | Bacteria | 2027 |
| 54 | Ga0068856_100913195 | 3300005614 | Bacteria | 897 |
| 55 | Ga0070702_100308501 | 3300005615 | Bacteria | 1098 |
| 56 | Ga0068852_100068387 | 3300005616 | Bacteria | 3108 |
| 57 | Ga0068852_100920085 | 3300005616 | Bacteria | 892 |
| 58 | Ga0068859_100000174 | 3300005617 | Bacteria | 62740 |
| 59 | Ga0068859_100254743 | 3300005617 | Bacteria | 1846 |
| 60 | Ga0068859_100308206 | 3300005617 | Bacteria | 1677 |
| 61 | Ga0068859_100568932 | 3300005617 | Bacteria | 1227 |
| 62 | Ga0068864_100333323 | 3300005618 | Bacteria | 1428 |
| 63 | Ga0068861_100458385 | 3300005719 | Bacteria | 1144 |
| 64 | Ga0068870_10069329 | 3300005840 | Bacteria | 1918 |
| 65 | Ga0068863_100032761 | 3300005841 | Bacteria | 4951 |
| 66 | Ga0068863_100848734 | 3300005841 | Bacteria | 912 |
| 67 | Ga0068858_100003020 | 3300005842 | Bacteria | 16880 |
| 68 | Ga0068858_100765347 | 3300005842 | Bacteria | 941 |
| 69 | Ga0068860_100000044 | 3300005843 | Bacteria | 225595 |
| 70 | Ga0068862_100000003 | 3300005844 | Bacteria | 369793 |
| 71 | Ga0068862_100188980 | 3300005844 | Bacteria | 1852 |
| 72 | Ga0081455_10048160 | 3300005937 | Bacteria | 3685 |
| 73 | Ga0081455_10052144 | 3300005937 | Bacteria | 3504 |
| 74 | Ga0081455_10085651 | 3300005937 | Bacteria | 2569 |
| 75 | Ga0081455_10087914 | 3300005937 | Bacteria | 2527 |
| 76 | Ga0081455_10217123 | 3300005937 | Bacteria | 1420 |
| 77 | Ga0081538_10000058 | 3300005981 | Bacteria | 102121 |
| 78 | Ga0081538_10000068 | 3300005981 | Bacteria | 97659 |
| 79 | Ga0081538_10009031 | 3300005981 | Bacteria | 8371 |
| 80 | Ga0081538_10045943 | 3300005981 | Bacteria | 2701 |
| 81 | Ga0081538_10058172 | 3300005981 | Bacteria | 2245 |
| 82 | Ga0081538_10089618 | 3300005981 | Bacteria | 1596 |
| 83 | Ga0081540_1008210 | 3300005983 | Bacteria | 7311 |
| 84 | Ga0081540_1123603 | 3300005983 | Bacteria | 1069 |
| 85 | Ga0081539_10000062 | 3300005985 | Bacteria | 249871 |
| 86 | Ga0081539_10003738 | 3300005985 | Bacteria | 18103 |
| 87 | Ga0081539_10076839 | 3300005985 | Bacteria | 1768 |
| 88 | Ga0075365_10001599 | 3300006038 | Bacteria | 10423 |
| 89 | Ga0075365_10004931 | 3300006038 | Bacteria | 7139 |
| 90 | Ga0075364_10025626 | 3300006051 | Bacteria | 3754 |
| 91 | Ga0075432_10001916 | 3300006058 | Bacteria | 6895 |
| 92 | Ga0070715_10050541 | 3300006163 | Bacteria | 1785 |
| 93 | Ga0070716_100019767 | 3300006173 | Bacteria | 3525 |
| 94 | Ga0070716_100026506 | 3300006173 | Bacteria | 3105 |
| 95 | Ga0070712_100004298 | 3300006175 | Bacteria | 8773 |
| 96 | Ga0070712_100144546 | 3300006175 | Bacteria | 1819 |
| 97 | Ga0070712_100252379 | 3300006175 | Bacteria | 1410 |
| 98 | Ga0075427_10010851 | 3300006194 | Bacteria | 1368 |
| 99 | Ga0097621_100254557 | 3300006237 | Bacteria | 1539 |
| 100 | Ga0075428_100166500 | 3300006844 | Bacteria | 2391 |
| 101 | Ga0075428_100203234 | 3300006844 | Bacteria | 2141 |
| 102 | Ga0075430_100017770 | 3300006846 | Bacteria | 6054 |
| 103 | Ga0075431_100035185 | 3300006847 | Bacteria | 5157 |
| 104 | Ga0075431_100091392 | 3300006847 | Bacteria | 3142 |
| 105 | Ga0075431_100137307 | 3300006847 | Bacteria | 2521 |
| 106 | Ga0075431_100245311 | 3300006847 | Bacteria | 1821 |
| 107 | Ga0075433_10000057 | 3300006852 | Bacteria | 48581 |
| 108 | Ga0075433_10000692 | 3300006852 | Bacteria | 22971 |
| 109 | Ga0075433_10000817 | 3300006852 | Bacteria | 21667 |
| 110 | Ga0075433_10060813 | 3300006852 | Bacteria | 3308 |
| 111 | Ga0075433_10073546 | 3300006852 | Bacteria | 3006 |
| 112 | Ga0075433_10677539 | 3300006852 | Bacteria | 904 |
| 113 | Ga0075434_100000070 | 3300006871 | Bacteria | 53323 |
| 114 | Ga0075434_100001271 | 3300006871 | Bacteria | 21016 |
| 115 | Ga0075434_100016441 | 3300006871 | Bacteria | 7112 |
| 116 | Ga0075434_100041745 | 3300006871 | Bacteria | 4545 |
| 117 | Ga0075434_100227155 | 3300006871 | Bacteria | 1886 |
| 118 | Ga0075434_100313659 | 3300006871 | Bacteria | 1588 |
| 119 | Ga0075429_100000551 | 3300006880 | Bacteria | 28615 |
| 120 | Ga0075429_100269171 | 3300006880 | Bacteria | 1492 |
| 121 | Ga0075436_100009326 | 3300006914 | Bacteria | 6712 |
| 122 | Ga0075436_100274265 | 3300006914 | Bacteria | 1205 |
| 123 | Ga0097620_100000174 | 3300006931 | Bacteria | 62740 |
| 124 | Ga0097620_100254750 | 3300006931 | Bacteria | 1846 |
| 125 | Ga0097620_100308234 | 3300006931 | Bacteria | 1677 |
| 126 | Ga0097620_100568864 | 3300006931 | Bacteria | 1227 |
| 127 | Ga0075435_100003936 | 3300007076 | Bacteria | 10154 |
| 128 | Ga0075435_100128729 | 3300007076 | Bacteria | 2117 |
| 129 | Ga0075435_100147833 | 3300007076 | Bacteria | 1974 |
| 130 | Ga0075435_100161829 | 3300007076 | Bacteria | 1885 |
| 131 | Ga0105240_10003784 | 3300009093 | Bacteria | 23373 |
| 132 | Ga0111539_10006167 | 3300009094 | Bacteria | 15472 |
| 133 | Ga0111539_10043947 | 3300009094 | Bacteria | 5354 |
| 134 | Ga0111539_10194210 | 3300009094 | Bacteria | 2368 |
| 135 | Ga0111539_10960808 | 3300009094 | Bacteria | 993 |
| 136 | Ga0111539_11308523 | 3300009094 | Bacteria | 841 |
| 137 | Ga0105245_10256364 | 3300009098 | Bacteria | 1701 |
| 138 | Ga0105245_10473949 | 3300009098 | Bacteria | 1264 |
| 139 | Ga0105247_10000006 | 3300009101 | Bacteria | 416061 |
| 140 | Ga0105247_10564892 | 3300009101 | Bacteria | 838 |
| 141 | Ga0105247_10705981 | 3300009101 | Bacteria | 760 |
| 142 | Ga0114129_10003427 | 3300009147 | Bacteria | 22298 |
| 143 | Ga0114129_10020642 | 3300009147 | Bacteria | 9366 |
| 144 | Ga0114129_10039391 | 3300009147 | Bacteria | 6662 |
| 145 | Ga0114129_10056028 | 3300009147 | Bacteria | 5524 |
| 146 | Ga0114129_10162497 | 3300009147 | Bacteria | 3049 |
| 147 | Ga0114129_10177752 | 3300009147 | Bacteria | 2898 |
| 148 | Ga0114129_10191292 | 3300009147 | Bacteria | 2778 |
| 149 | Ga0114129_10463333 | 3300009147 | Bacteria | 1661 |
| 150 | Ga0114129_10621532 | 3300009147 | Bacteria | 1397 |
| 151 | Ga0105248_10000042 | 3300009177 | Bacteria | 167583 |
| 152 | Ga0105237_10003213 | 3300009545 | Bacteria | 19575 |
| 153 | Ga0105238_10139425 | 3300009551 | Bacteria | 2402 |
| 154 | Ga0105249_10000008 | 3300009553 | Bacteria | 341271 |
| 155 | Ga0105249_10042148 | 3300009553 | Bacteria | 4150 |
| 156 | Ga0105239_10002098 | 3300010375 | Bacteria | 25810 |
| 157 | Ga0105239_10264408 | 3300010375 | Bacteria | 1934 |
| 158 | Ga0105239_10686263 | 3300010375 | Bacteria | 1171 |
| 159 | Ga0105246_10698399 | 3300011119 | Bacteria | 889 |
| 160 | Ga0105246_10926369 | 3300011119 | Bacteria | 783 |
| 161 | Ga0157373_10589954 | 3300013100 | Bacteria | 808 |
| 162 | Ga0157369_10652771 | 3300013105 | Bacteria | 1085 |
| 163 | Ga0157374_10911282 | 3300013296 | Bacteria | 897 |
| 164 | Ga0157378_10115802 | 3300013297 | Bacteria | 2464 |
| 165 | Ga0163162_10075007 | 3300013306 | Bacteria | 3442 |
| 166 | Ga0163162_10748547 | 3300013306 | Bacteria | 1097 |
| 167 | Ga0157372_10102699 | 3300013307 | Bacteria | 3266 |
| 168 | Ga0157372_10493931 | 3300013307 | Bacteria | 1427 |
| 169 | Ga0157375_10085668 | 3300013308 | Bacteria | 3201 |
| 170 | Ga0157375_10607816 | 3300013308 | Bacteria | 1252 |
| 171 | Ga0163163_10026112 | 3300014325 | Bacteria | 5578 |
| 172 | Ga0163163_10539231 | 3300014325 | Bacteria | 1229 |
| 173 | Ga0157377_10281418 | 3300014745 | Bacteria | 1090 |
| 174 | Ga0157379_10064509 | 3300014968 | Bacteria | 3273 |
| 175 | Ga0157379_10091350 | 3300014968 | Bacteria | 2731 |
| 176 | Ga0157379_10098519 | 3300014968 | Bacteria | 2624 |
| 177 | Ga0157376_10807614 | 3300014969 | Bacteria | 951 |
| 178 | Ga0213874_10149487 | 3300021377 | Bacteria | 814 |
| 179 | Ga0213876_10002484 | 3300021384 | Bacteria | 10824 |
| 180 | Ga0213876_10008534 | 3300021384 | Bacteria | 5547 |
| 181 | Ga0213875_10010077 | 3300021388 | Bacteria | 4749 |
| 182 | Ga0224712_10151098 | 3300022467 | Bacteria | 1029 |
| 183 | Ga0207710_10000025 | 3300025900 | Bacteria | 314658 |
| 184 | Ga0207688_10026271 | 3300025901 | Bacteria | 3201 |
| 185 | Ga0207688_10032083 | 3300025901 | Bacteria | 2902 |
| 186 | Ga0207685_10017601 | 3300025905 | Bacteria | 2315 |
| 187 | Ga0207699_10068340 | 3300025906 | Bacteria | 2163 |
| 188 | Ga0207705_10148417 | 3300025909 | Bacteria | 1755 |
| 189 | Ga0207707_10080111 | 3300025912 | Bacteria | 2851 |
| 190 | Ga0207695_10021148 | 3300025913 | Bacteria | 7432 |
| 191 | Ga0207671_10254159 | 3300025914 | Bacteria | 1382 |
| 192 | Ga0207693_10003509 | 3300025915 | Bacteria | 13395 |
| 193 | Ga0207663_10020210 | 3300025916 | Bacteria | 3768 |
| 194 | Ga0207660_10089411 | 3300025917 | Bacteria | 2280 |
| 195 | Ga0207662_10395429 | 3300025918 | Bacteria | 936 |
| 196 | Ga0207657_10471073 | 3300025919 | Bacteria | 985 |
| 197 | Ga0207649_10189872 | 3300025920 | Bacteria | 1444 |
| 198 | Ga0207652_10063291 | 3300025921 | Bacteria | 3199 |
| 199 | Ga0207646_10029718 | 3300025922 | Bacteria | 4963 |
| 200 | Ga0207681_10003522 | 3300025923 | Bacteria | 9749 |
| 201 | Ga0207681_10039925 | 3300025923 | Bacteria | 3120 |
| 202 | Ga0207694_10038810 | 3300025924 | Bacteria | 3662 |
| 203 | Ga0207700_10536007 | 3300025928 | Bacteria | 1038 |
| 204 | Ga0207690_10140429 | 3300025932 | Bacteria | 1779 |
| 205 | Ga0207706_10755230 | 3300025933 | Bacteria | 828 |
| 206 | Ga0207709_10337115 | 3300025935 | Bacteria | 1134 |
| 207 | Ga0207670_10785840 | 3300025936 | Bacteria | 792 |
| 208 | Ga0207665_10002519 | 3300025939 | Bacteria | 12318 |
| 209 | Ga0207691_10121496 | 3300025940 | Bacteria | 2314 |
| 210 | Ga0207711_10000697 | 3300025941 | Bacteria | 33164 |
| 211 | Ga0207689_10211621 | 3300025942 | Bacteria | 1602 |
| 212 | Ga0207661_10000165 | 3300025944 | Bacteria | 43066 |
| 213 | Ga0207661_10318622 | 3300025944 | Bacteria | 1397 |
| 214 | Ga0207712_10000011 | 3300025961 | Bacteria | 412321 |
| 215 | Ga0207658_10000307 | 3300025986 | Bacteria | 50415 |
| 216 | Ga0207677_10349080 | 3300026023 | Bacteria | 1239 |
| 217 | Ga0207703_10006939 | 3300026035 | Bacteria | 9013 |
| 218 | Ga0207703_10784658 | 3300026035 | Bacteria | 909 |
| 219 | Ga0207702_10086087 | 3300026078 | Bacteria | 2740 |
| 220 | Ga0207641_10005680 | 3300026088 | Bacteria | 10618 |
| 221 | Ga0207641_10174683 | 3300026088 | Bacteria | 1964 |
| 222 | Ga0207641_10489469 | 3300026088 | Bacteria | 1193 |
| 223 | Ga0207674_10342550 | 3300026116 | Bacteria | 1445 |
| 224 | Ga0207675_100337725 | 3300026118 | Bacteria | 1474 |
| 225 | Ga0207675_100474986 | 3300026118 | Bacteria | 1242 |
| 226 | Ga0207683_10094478 | 3300026121 | Bacteria | 2665 |
| 227 | Ga0207683_10135838 | 3300026121 | Bacteria | 2214 |
| 228 | Ga0207683_10456413 | 3300026121 | Bacteria | 1178 |
| 229 | Ga0207698_11124577 | 3300026142 | Bacteria | 798 |
| 230 | Ga0207428_10004233 | 3300027907 | Bacteria | 13743 |
| 231 | Ga0207428_10064722 | 3300027907 | Bacteria | 2886 |
| 232 | Ga0207428_10222926 | 3300027907 | Bacteria | 1412 |
| 233 | Ga0268266_11116063 | 3300028379 | Bacteria | 763 |
| 234 | Ga0268265_10000010 | 3300028380 | Bacteria | 370129 |
| 235 | Ga0268265_10171061 | 3300028380 | Bacteria | 1857 |
| 236 | Ga0268264_10000007 | 3300028381 | Bacteria | 815790 |
| 237 | Ga0268264_10248645 | 3300028381 | Bacteria | 1651 |
| 238 | Ga0307517_10012865 | 3300028786 | Bacteria | 11430 |
| 239 | Ga0307517_10032621 | 3300028786 | Bacteria | 6012 |
| 240 | Ga0307515_10000163 | 3300028794 | Bacteria | 163159 |
| 241 | Ga0307515_10164805 | 3300028794 | Bacteria | 2240 |
| 242 | Ga0307515_10234109 | 3300028794 | Bacteria | 1622 |
| 243 | Ga0307511_10000494 | 3300030521 | Bacteria | 42578 |
| 244 | Ga0307511_10000801 | 3300030521 | Bacteria | 33509 |
| 245 | Ga0307511_10120475 | 3300030521 | Bacteria | 1625 |
| 246 | Ga0307512_10001435 | 3300030522 | Bacteria | 33817 |
| 247 | Ga0307512_10058755 | 3300030522 | Bacteria | 2992 |
| 248 | Ga0307513_10034717 | 3300031456 | Bacteria | 5654 |
| 249 | Ga0307513_10050056 | 3300031456 | Bacteria | 4520 |
| 250 | Ga0307513_10123893 | 3300031456 | Bacteria | 2545 |
| 251 | Ga0307513_10161848 | 3300031456 | Bacteria | 2129 |
| 252 | Ga0307509_10020007 | 3300031507 | Bacteria | 7610 |
| 253 | Ga0307509_10039639 | 3300031507 | Bacteria | 5130 |
| 254 | Ga0307408_100082670 | 3300031548 | Bacteria | 2404 |
| 255 | Ga0307508_10014309 | 3300031616 | Bacteria | 7236 |
| 256 | Ga0307508_10052288 | 3300031616 | Bacteria | 3629 |
| 257 | Ga0307508_10099898 | 3300031616 | Bacteria | 2496 |
| 258 | Ga0307514_10023148 | 3300031649 | Bacteria | 5044 |
| 259 | Ga0316576_10056436 | 3300031727 | Bacteria | 2868 |
| 260 | Ga0307516_10015329 | 3300031730 | Bacteria | 8066 |
| 261 | Ga0307405_10589755 | 3300031731 | Bacteria | 905 |
| 262 | Ga0307413_10405346 | 3300031824 | Bacteria | 1070 |
| 263 | Ga0307406_10105694 | 3300031901 | Bacteria | 1927 |
| 264 | Ga0307409_101036879 | 3300031995 | Bacteria | 839 |
| 265 | Ga0307415_100669090 | 3300032126 | Bacteria | 933 |
| 266 | Ga0307507_10005111 | 3300033179 | Bacteria | 22037 |
| 267 | Ga0307507_10025071 | 3300033179 | Bacteria | 6476 |
| 268 | Ga0307510_10017005 | 3300033180 | Bacteria | 8581 |
| 269 | Ga0373945_0055237 | 3300035116 | Bacteria | 1470 |
| 270 | Ga0373955_0062090 | 3300035172 | Bacteria | 2066 |
| 271 | Ga0316584_0131404 | 3300036712 | Bacteria | 1870 |
| 272 | Ga0395899_0040078 | 3300037312 | Bacteria | 3504 |
| 273 | Ga0395899_0323239 | 3300037312 | Bacteria | 1039 |
| 274 | Ga0395899_0370446 | 3300037312 | Bacteria | 954 |
| 275 | Ga0395900_0006221 | 3300037418 | Bacteria | 12464 |
| 276 | Ga0395900_0056291 | 3300037418 | Bacteria | 4048 |
| 277 | Ga0395900_0102383 | 3300037418 | Bacteria | 2942 |
| 278 | Ga0395900_0224038 | 3300037418 | Bacteria | 1894 |
| 279 | Ga0395900_0235542 | 3300037418 | Bacteria | 1839 |
| 280 | Ga0395900_0253799 | 3300037418 | Bacteria | 1759 |
| 281 | Ga0395900_0773571 | 3300037418 | Bacteria | 889 |
| 282 | Ga0395898_0002063 | 3300037466 | Bacteria | 25012 |
| 283 | Ga0395898_0015070 | 3300037466 | Bacteria | 7936 |
| 284 | Ga0395898_0068716 | 3300037466 | Bacteria | 3428 |
| 285 | Ga0395898_0106523 | 3300037466 | Bacteria | 2689 |
| 286 | Ga0395898_0306852 | 3300037466 | Bacteria | 1514 |
| 287 | Ga0395898_0755317 | 3300037466 | Bacteria | 914 |
| 288 | Ga0395905_0008033 | 3300037471 | Bacteria | 10426 |
| 289 | Ga0395905_0075385 | 3300037471 | Bacteria | 3162 |
| 290 | Ga0395905_0128247 | 3300037471 | Bacteria | 2386 |
| 291 | Ga0395905_0214925 | 3300037471 | Bacteria | 1801 |
| 292 | Ga0436364_0034902 | 3300037853 | Bacteria | 12619 |
| 293 | Ga0395901_0008507 | 3300038443 | Bacteria | 10370 |
| 294 | Ga0395901_0009883 | 3300038443 | Bacteria | 9672 |
| 295 | Ga0395901_0011587 | 3300038443 | Bacteria | 8934 |
| 296 | Ga0395901_0021241 | 3300038443 | Bacteria | 6649 |
| 297 | Ga0395901_0137204 | 3300038443 | Bacteria | 2570 |
| 298 | Ga0395901_0190780 | 3300038443 | Bacteria | 2149 |
| 299 | Ga0395901_0439690 | 3300038443 | Bacteria | 1335 |
| 300 | Ga0395901_0510093 | 3300038443 | Bacteria | 1223 |
| 301 | Ga0242420_026583 | 3300038996 | Bacteria | 1057 |
| 302 | Ga0400483_143088 | 3300039062 | Bacteria | 1250 |
| 303 | Ga0436365_0418544 | 3300039437 | Bacteria | 5953 |
| 304 | Ga0436365_1447684 | 3300039437 | Bacteria | 34467 |
| 305 | Ga0436363_0708183 | 3300039450 | Bacteria | 1614 |
| 306 | Ga0436363_0743096 | 3300039450 | Bacteria | 1030 |
| 307 | Ga0436363_0936359 | 3300039450 | Bacteria | 1228 |
| 308 | Ga0436363_1563078 | 3300039450 | Bacteria | 742 |
| 309 | Ga0436362_0942942 | 3300039453 | Bacteria | 2294 |
| 310 | Ga0451837_0199012 | 3300041494 | Bacteria | 3502 |
| 311 | Ga0451837_1576622 | 3300041494 | Bacteria | 1113 |
| 312 | Ga0450892_008350 | 3300042130 | Bacteria | 883 |
| 313 | Ga0450916_004973 | 3300042530 | Bacteria | 1520 |
| 314 | Ga0451577_0039770 | 3300042876 | Bacteria | 4225 |
| 315 | Ga0451577_0607297 | 3300042876 | Bacteria | 993 |
| 316 | Ga0466965_0005651 | 3300044683 | Bacteria | 5642 |
| 317 | Ga0466965_0153501 | 3300044683 | Bacteria | 1204 |
| 318 | Ga0466966_0010361 | 3300044684 | Bacteria | 6188 |
| 319 | Ga0466966_0303688 | 3300044684 | Bacteria | 959 |
| 320 | Ga0466961_0040499 | 3300044693 | Bacteria | 2987 |
| 321 | Ga0466961_0084742 | 3300044693 | Bacteria | 2004 |
| 322 | Ga0466963_0011503 | 3300044694 | Bacteria | 5390 |
| 323 | Ga0466963_0023198 | 3300044694 | Bacteria | 3936 |
| 324 | Ga0466963_0032705 | 3300044694 | Bacteria | 3370 |
| 325 | Ga0466963_0035507 | 3300044694 | Bacteria | 3248 |
| 326 | Ga0466963_0039164 | 3300044694 | Bacteria | 3103 |
| 327 | Ga0466963_0069974 | 3300044694 | Bacteria | 2360 |
| 328 | Ga0466963_0135672 | 3300044694 | Bacteria | 1702 |
| 329 | Ga0466963_0222415 | 3300044694 | Bacteria | 1322 |
| 330 | Ga0466963_0605066 | 3300044694 | Bacteria | 774 |
| 331 | Ga0466964_0015320 | 3300044706 | Bacteria | 2917 |
| 332 | Ga0466971_0003662 | 3300044719 | Bacteria | 6572 |
| 333 | Ga0466971_0036214 | 3300044719 | Bacteria | 2213 |
| 334 | Ga0466971_0056136 | 3300044719 | Bacteria | 1776 |
| 335 | Ga0466968_0029833 | 3300044735 | Bacteria | 2257 |
| 336 | Ga0466968_0032795 | 3300044735 | Bacteria | 2162 |
| 337 | Ga0466968_0147930 | 3300044735 | Bacteria | 1078 |
| 338 | Ga0466970_0168959 | 3300044765 | Bacteria | 1211 |
| 339 | Ga0466970_0259865 | 3300044765 | Bacteria | 974 |
| 340 | Ga0466957_0003743 | 3300044842 | Bacteria | 8406 |
| 341 | Ga0466957_0286027 | 3300044842 | Bacteria | 1104 |
| 342 | Ga0466960_0025585 | 3300044901 | Bacteria | 2672 |
| 343 | Ga0466960_0131085 | 3300044901 | Bacteria | 1323 |
| 344 | Ga0466960_0163557 | 3300044901 | Bacteria | 1196 |
| 345 | Ga0466959_0278242 | 3300045049 | Bacteria | 1149 |
| 346 | Ga0466959_0319021 | 3300045049 | Bacteria | 1062 |
| 347 | Ga0466959_0364863 | 3300045049 | Bacteria | 984 |
| 348 | Ga0466958_0003197 | 3300045836 | Bacteria | 8449 |
| 349 | Ga0466958_0059539 | 3300045836 | Bacteria | 2323 |
| 350 | Ga0466958_0175435 | 3300045836 | Bacteria | 1359 |
| 351 | Ga0466967_0011207 | 3300045976 | Bacteria | 6776 |
| 352 | Ga0466967_0031038 | 3300045976 | Bacteria | 4493 |
| 353 | Ga0466967_0050443 | 3300045976 | Bacteria | 3644 |
| 354 | Ga0466967_0195130 | 3300045976 | Bacteria | 1915 |
| 355 | Ga0466967_0307203 | 3300045976 | Bacteria | 1527 |
| 356 | Ga0466967_0695030 | 3300045976 | Bacteria | 1007 |
| 357 | Ga0466967_0723810 | 3300045976 | Bacteria | 986 |
| 358 | Ga0495592_0001429 | 3300046454 | Bacteria | 16573 |
| 359 | Ga0495592_0011840 | 3300046454 | Bacteria | 6607 |
| 360 | Ga0495603_0099638 | 3300046455 | Bacteria | 1697 |
| 361 | Ga0495629_0100871 | 3300046459 | Bacteria | 2014 |
| 362 | Ga0495629_0153332 | 3300046459 | Bacteria | 1601 |
| 363 | Ga0495629_0178483 | 3300046459 | Bacteria | 1472 |
| 364 | Ga0495638_0016925 | 3300046460 | Bacteria | 4874 |
| 365 | Ga0495638_0458505 | 3300046460 | Bacteria | 649 |
| 366 | Ga0495641_0036246 | 3300046461 | Bacteria | 2319 |
| 367 | Ga0495641_0050692 | 3300046461 | Bacteria | 1897 |
| 368 | Ga0495641_0161695 | 3300046461 | Bacteria | 1001 |
| 369 | Ga0495651_0003189 | 3300046462 | Bacteria | 12609 |
| 370 | Ga0495651_0020082 | 3300046462 | Bacteria | 5185 |
| 371 | Ga0495651_0047909 | 3300046462 | Bacteria | 3301 |
| 372 | Ga0495653_0010780 | 3300046463 | Bacteria | 7484 |
| 373 | Ga0495653_0265686 | 3300046463 | Bacteria | 1132 |
| 374 | Ga0495582_0054187 | 3300046473 | Bacteria | 2212 |
| 375 | Ga0495662_0006967 | 3300046476 | Bacteria | 5617 |
| 376 | Ga0495662_0024405 | 3300046476 | Bacteria | 2917 |
| 377 | Ga0495664_0000570 | 3300046477 | Bacteria | 18511 |
| 378 | Ga0495664_0003276 | 3300046477 | Bacteria | 8801 |
| 379 | Ga0495584_0199194 | 3300046491 | Bacteria | 1018 |
| 380 | Ga0495608_0033506 | 3300046511 | Bacteria | 3470 |
| 381 | Ga0495608_0035457 | 3300046511 | Bacteria | 3365 |
| 382 | Ga0495618_0144431 | 3300046514 | Bacteria | 1521 |
| 383 | Ga0495628_0013118 | 3300046516 | Bacteria | 6977 |
| 384 | Ga0495628_0030865 | 3300046516 | Bacteria | 4337 |
| 385 | Ga0495628_0082218 | 3300046516 | Bacteria | 2501 |
| 386 | Ga0495630_0001009 | 3300046517 | Bacteria | 19504 |
| 387 | Ga0495630_0173220 | 3300046517 | Bacteria | 1644 |
| 388 | Ga0495630_0176522 | 3300046517 | Bacteria | 1628 |
| 389 | Ga0495632_0078164 | 3300046519 | Bacteria | 1581 |
| 390 | Ga0495643_0002747 | 3300046522 | Bacteria | 13517 |
| 391 | Ga0495666_0001180 | 3300046526 | Bacteria | 12574 |
| 392 | Ga0495652_0174380 | 3300046529 | Bacteria | 1656 |
| 393 | Ga0495652_0363247 | 3300046529 | Bacteria | 1034 |
| 394 | Ga0495665_0124723 | 3300046531 | Bacteria | 1348 |
| 395 | Ga0495640_0010017 | 3300046533 | Bacteria | 7349 |
| 396 | Ga0495640_0010089 | 3300046533 | Bacteria | 7321 |
| 397 | Ga0495640_0025254 | 3300046533 | Bacteria | 4312 |
| 398 | Ga0495586_0085245 | 3300046535 | Bacteria | 1740 |
| 399 | Ga0495587_0020918 | 3300046536 | Bacteria | 4036 |
| 400 | Ga0495587_0022547 | 3300046536 | Bacteria | 3876 |
| 401 | Ga0495645_0009902 | 3300046543 | Bacteria | 6670 |
| 402 | Ga0495645_0032965 | 3300046543 | Bacteria | 3778 |
| 403 | Ga0495622_0086664 | 3300046557 | Bacteria | 1440 |
| 404 | Ga0495667_0011057 | 3300046559 | Bacteria | 6103 |
| 405 | Ga0495667_0115710 | 3300046559 | Bacteria | 1732 |
| 406 | Ga0495656_0053442 | 3300046615 | Bacteria | 1736 |
| 407 | Ga0495634_0002883 | 3300046642 | Bacteria | 14108 |
| 408 | Ga0495634_0015084 | 3300046642 | Bacteria | 5554 |
| 409 | Ga0495634_0029640 | 3300046642 | Bacteria | 3787 |
| 410 | Ga0495635_0004228 | 3300046663 | Bacteria | 9957 |
| 411 | Ga0495635_0038686 | 3300046663 | Bacteria | 3301 |
| 412 | Ga0495588_0038469 | 3300046674 | Bacteria | 2433 |
| 413 | Ga0495588_0069978 | 3300046674 | Bacteria | 1824 |
| 414 | Ga0495657_0011045 | 3300046675 | Bacteria | 6771 |
| 415 | Ga0495657_0033976 | 3300046675 | Bacteria | 3545 |
| 416 | Ga0495657_0175477 | 3300046675 | Bacteria | 1318 |
| 417 | Ga0495657_0265421 | 3300046675 | Bacteria | 1030 |
| 418 | Ga0495599_0079066 | 3300046678 | Bacteria | 2053 |
| 419 | Ga0495599_0170704 | 3300046678 | Bacteria | 1342 |
| 420 | Ga0495599_0461554 | 3300046678 | Bacteria | 751 |
| 421 | Ga0495623_0024618 | 3300046679 | Bacteria | 3876 |
| 422 | Ga0495646_0002533 | 3300046680 | Bacteria | 11230 |
| 423 | Ga0495646_0004122 | 3300046680 | Bacteria | 9123 |
| 424 | Ga0495646_0193009 | 3300046680 | Bacteria | 1112 |
| 425 | Ga0495658_0069007 | 3300046683 | Bacteria | 2048 |
| 426 | Ga0495658_0461387 | 3300046683 | Bacteria | 812 |
| 427 | Ga0495613_0001149 | 3300046689 | Bacteria | 20199 |
| 428 | Ga0495613_0001262 | 3300046689 | Bacteria | 19287 |
| 429 | Ga0495613_0115036 | 3300046689 | Bacteria | 1936 |
| 430 | Ga0495624_0090309 | 3300046690 | Bacteria | 1890 |
| 431 | Ga0495670_0022785 | 3300046691 | Bacteria | 3093 |
| 432 | Ga0495671_0006048 | 3300046692 | Bacteria | 7034 |
| 433 | Ga0495600_0025515 | 3300046809 | Bacteria | 3809 |
| 434 | Ga0495600_0046346 | 3300046809 | Bacteria | 2836 |
| 435 | Ga0495600_0203305 | 3300046809 | Bacteria | 1271 |
| 436 | Ga0495660_0061919 | 3300046810 | Bacteria | 2007 |
| 437 | Ga0495581_0029246 | 3300047315 | Bacteria | 3194 |
| 438 | Ga0495604_0001320 | 3300047317 | Bacteria | 20245 |
| 439 | Ga0495604_0003274 | 3300047317 | Bacteria | 12943 |
| 440 | Ga0495604_0070049 | 3300047317 | Bacteria | 2657 |
| 441 | Ga0495636_0008797 | 3300047318 | Bacteria | 3979 |
| 442 | Ga0495674_0000568 | 3300047319 | Bacteria | 34477 |
| 443 | Ga0495674_0017715 | 3300047319 | Bacteria | 6631 |
| 444 | Ga0495676_0011223 | 3300047321 | Bacteria | 8099 |
| 445 | Ga0495676_0117228 | 3300047321 | Bacteria | 1943 |
| 446 | Ga0495680_0000393 | 3300047322 | Bacteria | 48867 |
| 447 | Ga0495683_0230133 | 3300047323 | Bacteria | 822 |
| 448 | Ga0495687_003574 | 3300047443 | Bacteria | 11151 |
| 449 | Ga0495687_019625 | 3300047443 | Bacteria | 3311 |
| 450 | Ga0495685_002401 | 3300047447 | Bacteria | 5871 |
| 451 | Ga0495681_0003284 | 3300047470 | Bacteria | 11278 |
| 452 | Ga0495684_0014945 | 3300047471 | Bacteria | 5979 |
| 453 | Ga0495684_0018965 | 3300047471 | Bacteria | 5296 |
| 454 | Ga0495684_0022203 | 3300047471 | Bacteria | 4886 |
| 455 | Ga0495686_0117098 | 3300047472 | Bacteria | 1592 |
| 456 | Ga0495686_0287729 | 3300047472 | Bacteria | 911 |
| 457 | Ga0495593_0008831 | 3300047673 | Bacteria | 5850 |
| 458 | Ga0495593_0031569 | 3300047673 | Bacteria | 2893 |
| 459 | Ga0495602_0049695 | 3300048088 | Bacteria | 3754 |
| 460 | Ga0495614_0017478 | 3300048089 | Bacteria | 3115 |
| 461 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 462 | Ga0496100_0010810 | 3300048903 | Bacteria | 5179 |
| 463 | Ga0496100_0098453 | 3300048903 | Bacteria | 2010 |
| 464 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 465 | Ga0496101_0020411 | 3300048904 | Bacteria | 4535 |
| 466 | Ga0496101_0080653 | 3300048904 | Bacteria | 2404 |
| 467 | Ga0496102_0000060 | 3300048905 | Bacteria | 167774 |
| 468 | Ga0496102_0015718 | 3300048905 | Bacteria | 6594 |
| 469 | Ga0496102_0139345 | 3300048905 | Bacteria | 2274 |
| 470 | Ga0496103_0000500 | 3300048906 | Bacteria | 32364 |
| 471 | Ga0496103_0003635 | 3300048906 | Bacteria | 9395 |
| 472 | Ga0496104_0537280 | 3300048907 | Bacteria | 1080 |
| 473 | Ga0496105_0011383 | 3300048908 | Bacteria | 7027 |
| 474 | Ga0496105_0529556 | 3300048908 | Bacteria | 922 |
| 475 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 476 | Ga0496106_0008284 | 3300048909 | Bacteria | 7692 |
| 477 | Ga0496106_0355496 | 3300048909 | Bacteria | 1177 |
| 478 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 479 | Ga0496107_0083153 | 3300048910 | Bacteria | 2334 |
| 480 | Ga0496107_0283088 | 3300048910 | Bacteria | 1234 |
| 481 | Ga0496108_0032225 | 3300048911 | Bacteria | 4352 |
| 482 | Ga0496108_0330652 | 3300048911 | Bacteria | 1329 |
| 483 | Ga0496110_0174763 | 3300048913 | Bacteria | 1949 |
| 484 | Ga0496110_0844618 | 3300048913 | Bacteria | 821 |
| 485 | Ga0496111_0020922 | 3300048914 | Bacteria | 4561 |
| 486 | Ga0496111_0064521 | 3300048914 | Bacteria | 2657 |
| 487 | Ga0496111_0298048 | 3300048914 | Bacteria | 1195 |
| 488 | Ga0496111_0688734 | 3300048914 | Bacteria | 744 |
| 489 | Ga0496112_0037377 | 3300048915 | Bacteria | 4739 |
| 490 | Ga0496112_1017341 | 3300048915 | Bacteria | 748 |
| 491 | Ga0496113_0006265 | 3300048916 | Bacteria | 7518 |
| 492 | Ga0496113_0089085 | 3300048916 | Bacteria | 2375 |
| 493 | Ga0496114_0002542 | 3300048917 | Bacteria | 13922 |
| 494 | Ga0496114_0241857 | 3300048917 | Bacteria | 1587 |
| 495 | Ga0496115_0000815 | 3300048918 | Bacteria | 22850 |
| 496 | Ga0496115_0270508 | 3300048918 | Bacteria | 1396 |
| 497 | Ga0496116_0046069 | 3300048919 | Bacteria | 2946 |
| 498 | Ga0496117_0002026 | 3300048920 | Bacteria | 26844 |
| 499 | Ga0496118_0001179 | 3300048921 | Bacteria | 40343 |
| 500 | Ga0496119_0016754 | 3300048922 | Bacteria | 5554 |
| 501 | Ga0496120_0004413 | 3300048923 | Bacteria | 11807 |
| 502 | Ga0496121_0085248 | 3300048924 | Bacteria | 2487 |
| 503 | Ga0496121_0181465 | 3300048924 | Bacteria | 1519 |
| 504 | Ga0496124_0088633 | 3300048927 | Bacteria | 2528 |
| 505 | Ga0496125_0003753 | 3300048928 | Bacteria | 18091 |
| 506 | Ga0496125_0012912 | 3300048928 | Bacteria | 8246 |
| 507 | Ga0496126_0008248 | 3300048929 | Bacteria | 11251 |
| 508 | Ga0501031_0073698 | 3300049568 | Bacteria | 2223 |
| 509 | Ga0501031_0389206 | 3300049568 | Bacteria | 902 |
| 510 | Ga0501032_0031810 | 3300049569 | Bacteria | 3617 |
| 511 | Ga0501033_0102558 | 3300049570 | Bacteria | 2087 |
| 512 | Ga0501033_0210416 | 3300049570 | Bacteria | 1387 |
| 513 | Ga0501034_0326431 | 3300049571 | Bacteria | 1467 |
| 514 | Ga0501036_0001457 | 3300049572 | Bacteria | 18189 |
| 515 | Ga0501036_0017262 | 3300049572 | Bacteria | 6032 |
| 516 | Ga0501036_0045229 | 3300049572 | Bacteria | 3730 |
| 517 | Ga0501036_0064238 | 3300049572 | Bacteria | 3107 |
| 518 | Ga0501036_0298324 | 3300049572 | Bacteria | 1348 |
| 519 | Ga0501036_0352087 | 3300049572 | Bacteria | 1230 |
| 520 | Ga0501037_0049852 | 3300049573 | Bacteria | 3065 |
| 521 | Ga0501038_0055443 | 3300049574 | Bacteria | 3404 |
| 522 | Ga0501039_0003396 | 3300049575 | Bacteria | 11900 |
| 523 | Ga0501039_0003643 | 3300049575 | Bacteria | 11549 |
| 524 | Ga0501039_0101275 | 3300049575 | Bacteria | 2248 |
| 525 | Ga0501040_0000515 | 3300049576 | Bacteria | 23152 |
| 526 | Ga0501040_0006488 | 3300049576 | Bacteria | 7598 |
| 527 | Ga0501040_0048027 | 3300049576 | Bacteria | 2916 |
| 528 | Ga0501040_0056481 | 3300049576 | Bacteria | 2694 |
| 529 | Ga0501040_0130371 | 3300049576 | Bacteria | 1768 |
| 530 | Ga0501041_0017542 | 3300049577 | Bacteria | 4259 |
| 531 | Ga0501041_0023411 | 3300049577 | Bacteria | 3704 |
| 532 | Ga0501041_0025760 | 3300049577 | Bacteria | 3535 |
| 533 | Ga0501041_0154381 | 3300049577 | Bacteria | 1434 |
| 534 | Ga0501042_0019543 | 3300049578 | Bacteria | 4706 |
| 535 | Ga0501042_0039878 | 3300049578 | Bacteria | 3338 |
| 536 | Ga0501042_0096001 | 3300049578 | Bacteria | 2130 |
| 537 | Ga0501042_0112336 | 3300049578 | Bacteria | 1962 |
| 538 | Ga0501043_0170030 | 3300049579 | Bacteria | 1700 |
| 539 | Ga0501046_0019768 | 3300049580 | Bacteria | 5580 |
| 540 | Ga0501046_0103554 | 3300049580 | Bacteria | 2181 |
| 541 | Ga0501046_0137248 | 3300049580 | Bacteria | 1852 |
| 542 | Ga0501046_0501763 | 3300049580 | Bacteria | 869 |
| 543 | Ga0501048_0009811 | 3300049582 | Bacteria | 7178 |
| 544 | Ga0501048_0109180 | 3300049582 | Bacteria | 1953 |
| 545 | Ga0501048_0144990 | 3300049582 | Bacteria | 1679 |
| 546 | Ga0501067_0001773 | 3300049583 | Bacteria | 11851 |
| 547 | Ga0501068_0275327 | 3300049584 | Bacteria | 1075 |
| 548 | Ga0501068_0312935 | 3300049584 | Bacteria | 1006 |
| 549 | Ga0501069_0025346 | 3300049585 | Bacteria | 3240 |
| 550 | Ga0501069_0189605 | 3300049585 | Bacteria | 1189 |
| 551 | Ga0501070_0014832 | 3300049586 | Bacteria | 6556 |
| 552 | Ga0501071_0001164 | 3300049587 | Bacteria | 14751 |
| 553 | Ga0501071_0045033 | 3300049587 | Bacteria | 3166 |
| 554 | Ga0501071_0066901 | 3300049587 | Bacteria | 2612 |
| 555 | Ga0501071_0127405 | 3300049587 | Bacteria | 1890 |
| 556 | Ga0501072_0000894 | 3300049588 | Bacteria | 21861 |
| 557 | Ga0501072_0003415 | 3300049588 | Bacteria | 11964 |
| 558 | Ga0501072_0025305 | 3300049588 | Bacteria | 4623 |
| 559 | Ga0501072_0055650 | 3300049588 | Bacteria | 3117 |
| 560 | Ga0501073_0002737 | 3300049589 | Bacteria | 13216 |
| 561 | Ga0501073_0348937 | 3300049589 | Bacteria | 1022 |
| 562 | Ga0501074_0009393 | 3300049590 | Bacteria | 7108 |
| 563 | Ga0501074_0030239 | 3300049590 | Bacteria | 3925 |
| 564 | Ga0501074_0112760 | 3300049590 | Bacteria | 1946 |
| 565 | Ga0501074_0121445 | 3300049590 | Bacteria | 1868 |
| 566 | Ga0501075_0003952 | 3300049591 | Bacteria | 9988 |
| 567 | Ga0501075_0004349 | 3300049591 | Bacteria | 9582 |
| 568 | Ga0501075_0130354 | 3300049591 | Bacteria | 1916 |
| 569 | Ga0501075_0138435 | 3300049591 | Bacteria | 1854 |
| 570 | Ga0501075_0372971 | 3300049591 | Bacteria | 1088 |
| 571 | Ga0501076_0003103 | 3300049592 | Bacteria | 11568 |
| 572 | Ga0501076_0007818 | 3300049592 | Bacteria | 7792 |
| 573 | Ga0501076_0029116 | 3300049592 | Bacteria | 4293 |
| 574 | Ga0501076_0082896 | 3300049592 | Bacteria | 2574 |
| 575 | Ga0501076_0085597 | 3300049592 | Bacteria | 2533 |
| 576 | Ga0501076_0086792 | 3300049592 | Bacteria | 2515 |
| 577 | Ga0501076_0472224 | 3300049592 | Bacteria | 1033 |
| 578 | Ga0501077_0027075 | 3300049593 | Bacteria | 3640 |
| 579 | Ga0501077_0030118 | 3300049593 | Bacteria | 3452 |
| 580 | Ga0501077_0078121 | 3300049593 | Bacteria | 2097 |
| 581 | Ga0501077_0309307 | 3300049593 | Bacteria | 1007 |
| 582 | Ga0501079_0002701 | 3300049741 | Bacteria | 12919 |
| 583 | Ga0501079_0153559 | 3300049741 | Bacteria | 1794 |
| 584 | Ga0501079_0276149 | 3300049741 | Bacteria | 1314 |
| 585 | Ga0501079_0387385 | 3300049741 | Bacteria | 1096 |
| 586 | Ga0501079_0406984 | 3300049741 | Bacteria | 1067 |
| 587 | Ga0501080_0174268 | 3300049742 | Bacteria | 1982 |
| 588 | Ga0501080_0322871 | 3300049742 | Bacteria | 1397 |
| 589 | Ga0501081_0016708 | 3300049743 | Bacteria | 4852 |
| 590 | Ga0501081_0032249 | 3300049743 | Bacteria | 3553 |
| 591 | Ga0501081_0313777 | 3300049743 | Bacteria | 1151 |
| 592 | Ga0501083_0015377 | 3300049744 | Bacteria | 5360 |
| 593 | Ga0501035_0020722 | 3300049822 | Bacteria | 6042 |
| 594 | Ga0501035_0055381 | 3300049822 | Bacteria | 3541 |
| 595 | Ga0501035_0056570 | 3300049822 | Bacteria | 3499 |
| 596 | Ga0501035_0309722 | 3300049822 | Bacteria | 1329 |
| 597 | Ga0501044_0332749 | 3300049823 | Bacteria | 1441 |
| 598 | Ga0501045_0004075 | 3300049824 | Bacteria | 10084 |
| 599 | Ga0501045_0116512 | 3300049824 | Bacteria | 1982 |
| 600 | Ga0501045_0139177 | 3300049824 | Bacteria | 1805 |
| 601 | nmdc:mga0yw44_140119_c1 | 3300050492 | Bacteria | 1571 |
| 602 | nmdc:mga0yw44_51785_c1 | 3300050492 | Bacteria | 2487 |
| 603 | nmdc:mga0yw44_88951_c1 | 3300050492 | Bacteria | 1948 |
| 604 | nmdc:mga05p37_10310_c1 | 3300050507 | Bacteria | 11097 |
| 605 | nmdc:mga05p37_1215725_c1 | 3300050507 | Bacteria | 777 |
| 606 | nmdc:mga05p37_130523_c1 | 3300050507 | Bacteria | 3083 |
| 607 | nmdc:mga05p37_142939_c1 | 3300050507 | Bacteria | 2931 |
| 608 | nmdc:mga05p37_147460_c1 | 3300050507 | Bacteria | 2880 |
| 609 | nmdc:mga05p37_21214_c1 | 3300050507 | Bacteria | 7864 |
| 610 | nmdc:mga05p37_21516_c1 | 3300050507 | Bacteria | 7812 |
| 611 | nmdc:mga05p37_482142_c1 | 3300050507 | Bacteria | 1428 |
| 612 | nmdc:mga05p37_48686_c1 | 3300050507 | Bacteria | 5212 |
| 613 | nmdc:mga09592_169501_c1 | 3300050508 | Bacteria | 1888 |
| 614 | nmdc:mga0qj67_91666_c1 | 3300050509 | Bacteria | 2443 |
| 615 | nmdc:mga06r32_13499_c1 | 3300050510 | Bacteria | 7403 |
| 616 | nmdc:mga06r32_330200_c1 | 3300050510 | Bacteria | 1510 |
| 617 | nmdc:mga06r32_438984_c1 | 3300050510 | Bacteria | 1286 |
| 618 | nmdc:mga06r32_79753_c1 | 3300050510 | Bacteria | 3184 |
| 619 | nmdc:mga08y16_45205_c1 | 3300050511 | Bacteria | 4614 |
| 620 | nmdc:mga08y16_80546_c1 | 3300050511 | Bacteria | 3395 |
| 621 | nmdc:mga08y16_953155_c1 | 3300050511 | Bacteria | 841 |
| 622 | nmdc:mga0n895_320921_c1 | 3300050512 | Bacteria | 1570 |
| 623 | nmdc:mga0n895_56427_c1 | 3300050512 | Bacteria | 3869 |
| 624 | nmdc:mga0n895_57126_c1 | 3300050512 | Bacteria | 3846 |
| 625 | nmdc:mga0n895_63695_c1 | 3300050512 | Bacteria | 3646 |
| 626 | nmdc:mga0n895_743_c1 | 3300050512 | Bacteria | 23050 |
| 627 | nmdc:mga0n895_9556_c1 | 3300050512 | Bacteria | 8493 |
| 628 | nmdc:mga0rr50_135216_c1 | 3300050513 | Bacteria | 1978 |
| 629 | nmdc:mga0rr50_135655_c1 | 3300050513 | Bacteria | 1975 |
| 630 | nmdc:mga0rr50_333702_c1 | 3300050513 | Bacteria | 1273 |
| 631 | nmdc:mga0rr50_3537_c1 | 3300050513 | Bacteria | 9016 |
| 632 | nmdc:mga0rr50_43998_c1 | 3300050513 | Bacteria | 3272 |
| 633 | nmdc:mga08x19_3507_c1 | 3300050514 | Bacteria | 9335 |
| 634 | nmdc:mga08x19_636081_c1 | 3300050514 | Bacteria | 756 |
| 635 | nmdc:mga0a205_102371_c1 | 3300050515 | Bacteria | 2762 |
| 636 | nmdc:mga0a205_115185_c1 | 3300050515 | Bacteria | 2587 |
| 637 | nmdc:mga0a205_1_c2 | 3300050515 | Bacteria | 266330 |
| 638 | nmdc:mga0a205_20197_c1 | 3300050515 | Bacteria | 6284 |
| 639 | nmdc:mga0a205_22022_c1 | 3300050515 | Bacteria | 2198 |
| 640 | nmdc:mga0a205_32312_c1 | 3300050515 | Bacteria | 5019 |
| 641 | nmdc:mga0a205_33485_c1 | 3300050515 | Bacteria | 4926 |
| 642 | nmdc:mga0a205_68679_c1 | 3300050515 | Bacteria | 3422 |
| 643 | Ga0495601_0087095 | 3300053077 | Bacteria | 2008 |
| 644 | Ga0495655_0113043 | 3300053083 | Bacteria | 818 |
| 645 | Ga0495619_0040632 | 3300053085 | Bacteria | 3040 |
| 646 | Ga0495619_0180766 | 3300053085 | Bacteria | 1459 |
| 647 | Ga0500578_0012444 | 3300053086 | Bacteria | 5489 |
| 648 | Ga0500640_023966 | 3300053095 | Bacteria | 2647 |
| 649 | Ga0500654_058339 | 3300053099 | Bacteria | 2002 |
| 650 | Ga0500660_039633 | 3300053100 | Bacteria | 2405 |
| 651 | Ga0500553_136757 | 3300053101 | Bacteria | 975 |
| 652 | Ga0500560_000468 | 3300053107 | Bacteria | 5622 |
| 653 | Ga0500569_001500 | 3300053109 | Bacteria | 4422 |
| 654 | Ga0500572_088713 | 3300053111 | Bacteria | 977 |
| 655 | Ga0500614_004794 | 3300053123 | Bacteria | 2845 |
| 656 | Ga0500614_018592 | 3300053123 | Bacteria | 1583 |
| 657 | Ga0500628_005693 | 3300053129 | Bacteria | 2089 |
| 658 | Ga0500652_007135 | 3300053131 | Bacteria | 3639 |
| 659 | Ga0500658_0033416 | 3300053134 | Bacteria | 2022 |
| 660 | Ga0500559_0165501 | 3300053136 | Bacteria | 1040 |
| 661 | Ga0500561_0000775 | 3300053137 | Bacteria | 5069 |
| 662 | Ga0500573_0114554 | 3300053140 | Bacteria | 1506 |
| 663 | Ga0500577_0068266 | 3300053142 | Bacteria | 1388 |
| 664 | Ga0500588_0126179 | 3300053146 | Bacteria | 907 |
| 665 | Ga0500600_0001718 | 3300053149 | Bacteria | 11846 |
| 666 | Ga0500603_036123 | 3300053150 | Bacteria | 1299 |
| 667 | Ga0500616_0106578 | 3300053153 | Bacteria | 1361 |
| 668 | Ga0500624_006191 | 3300053157 | Bacteria | 1613 |
| 669 | Ga0500633_0025426 | 3300053160 | Bacteria | 1851 |
| 670 | Ga0500634_0001300 | 3300053161 | Bacteria | 9512 |
| 671 | Ga0500656_001260 | 3300053732 | Bacteria | 2149 |
| 672 | Ga0501084_0004385 | 3300054114 | Bacteria | 11502 |
| 673 | Ga0501084_0029398 | 3300054114 | Bacteria | 4597 |
| 674 | Ga0501084_0081060 | 3300054114 | Bacteria | 2721 |
| 675 | Ga0501084_0660664 | 3300054114 | Bacteria | 882 |
| 676 | Ga0501082_0070632 | 3300060353 | Bacteria | 3006 |
| 677 | Ga0501082_0105889 | 3300060353 | Bacteria | 2433 |
| 678 | Ga0501082_0136813 | 3300060353 | Bacteria | 2125 |
| 679 | Ga0501082_0172521 | 3300060353 | Bacteria | 1880 |
| 680 | Ga0501082_0589463 | 3300060353 | Bacteria | 973 |
| 681 | Ga0466962_0001045 | 3300061719 | Bacteria | 12703 |
| 682 | Ga0466962_0004738 | 3300061719 | Bacteria | 6537 |
| 683 | Ga0466962_0070878 | 3300061719 | Bacteria | 1665 |
| 684 | Ga0466962_0118825 | 3300061719 | Bacteria | 1275 |
| 685 | Ga0530510_0005561 | 3300061734 | Bacteria | 8734 |
| 686 | Ga0530510_0009858 | 3300061734 | Bacteria | 6701 |
| 687 | Ga0530510_0020967 | 3300061734 | Bacteria | 4647 |
| 688 | Ga0530510_0035126 | 3300061734 | Bacteria | 3612 |
| 689 | Ga0530510_0184960 | 3300061734 | Bacteria | 1546 |
| 690 | 2793975290 | 2791355406 | Bacteria | 11364898 |
| 691 | 2809590728 | 2808606522 | Bacteria | 9488490 |
| 692 | 2867347304 | 2867346516 | Bacteria | 7608576 |
| 693 | 2899368960 | 2899359706 | Bacteria | 10940472 |
| 694 | 8047719701 | 8047710418 | Bacteria | 11023148 |
| 695 | 8047900553 | 8047893842 | Bacteria | 11723082 |
| 696 | 8048358349 | 8048356638 | Bacteria | 11044339 |
| 697 | 8048377493 | 8048369669 | Bacteria | 11666822 |
| 698 | 8048386591 | 8048379754 | Bacteria | 11877923 |
| 699 | Ga0501072_0023500 | |||
| 700 | JGI25406J46586_10016300 | |||
| 701 | Ga0065712_10134679 | |||
| 702 | Ga0070658_10167205 | |||
| 703 | Ga0070683_100001023 | |||
| 704 | Ga0070683_100426284 | |||
| 705 | Ga0070690_100220633 | |||
| 706 | Ga0068869_100055969 | |||
| 707 | Ga0070680_100167508 | |||
| 708 | Ga0070682_100124198 | |||
| 709 | Ga0068868_100030488 | |||
| 710 | Ga0070668_100326753 | |||
| 711 | Ga0070669_100120823 | |||
| 712 | Ga0070669_100475705 | |||
| 713 | Ga0070674_100280002 | |||
| 714 | Ga0070673_100579406 | |||
| 715 | Ga0070659_100145991 | |||
| 716 | Ga0070667_100000223 | |||
| 717 | Ga0070709_10263492 | |||
| 718 | Ga0070714_100177698 | |||
| 719 | Ga0070713_100873452 | |||
| 720 | Ga0070701_10072885 | |||
| 721 | Ga0070705_100096968 | |||
| 722 | Ga0070700_100168651 | |||
| 723 | Ga0070694_100018986 | |||
| 724 | Ga0070708_100364018 | |||
| 725 | Ga0070663_100406052 | |||
| 726 | Ga0070663_100497112 | |||
| 727 | Ga0070678_100088450 | |||
| 728 | Ga0070678_100174377 | |||
| 729 | Ga0070662_100279092 | |||
| 730 | Ga0070681_10039140 | |||
| 731 | Ga0068867_100158097 | |||
| 732 | Ga0070698_100000518 | |||
| 733 | Ga0070698_100011475 | |||
| 734 | Ga0070698_100128964 | |||
| 735 | Ga0070699_100003005 | |||
| 736 | Ga0070699_100756683 | |||
| 737 | Ga0070679_100150861 | |||
| 738 | Ga0070684_100150171 | |||
| 739 | Ga0070684_100452029 | |||
| 740 | Ga0070684_100631378 | |||
| 741 | Ga0070697_100110630 | |||
| 742 | Ga0070697_100274165 | |||
| 743 | Ga0070686_100002743 | |||
| 744 | Ga0070686_100070463 | |||
| 745 | Ga0070696_100081602 | |||
| 746 | Ga0070665_100005604 | |||
| 747 | Ga0070665_100309521 | |||
| 748 | Ga0070704_100077141 | |||
| 749 | Ga0070704_100110388 | |||
| 750 | Ga0070664_100475507 | |||
| 751 | Ga0068856_100197319 | |||
| 752 | Ga0068856_100913195 | |||
| 753 | Ga0070702_100308501 | |||
| 754 | Ga0068852_100068387 | |||
| 755 | Ga0068852_100920085 | |||
| 756 | Ga0068859_100000174 | |||
| 757 | Ga0068859_100254743 | |||
| 758 | Ga0068859_100308206 | |||
| 759 | Ga0068859_100568932 | |||
| 760 | Ga0068864_100333323 | |||
| 761 | Ga0068861_100458385 | |||
| 762 | Ga0068870_10069329 | |||
| 763 | Ga0068863_100032761 | |||
| 764 | Ga0068863_100848734 | |||
| 765 | Ga0068858_100003020 | |||
| 766 | Ga0068858_100765347 | |||
| 767 | Ga0068860_100000044 | |||
| 768 | Ga0068862_100000003 | |||
| 769 | Ga0068862_100188980 | |||
| 770 | Ga0081455_10048160 | |||
| 771 | Ga0081455_10052144 | |||
| 772 | Ga0081455_10085651 | |||
| 773 | Ga0081455_10087914 | |||
| 774 | Ga0081455_10217123 | |||
| 775 | Ga0081538_10000058 | |||
| 776 | Ga0081538_10000068 | |||
| 777 | Ga0081538_10009031 | |||
| 778 | Ga0081538_10045943 | |||
| 779 | Ga0081538_10058172 | |||
| 780 | Ga0081538_10089618 | |||
| 781 | Ga0081540_1008210 | |||
| 782 | Ga0081540_1123603 | |||
| 783 | Ga0081539_10000062 | |||
| 784 | Ga0081539_10003738 | |||
| 785 | Ga0081539_10076839 | |||
| 786 | Ga0075365_10001599 | |||
| 787 | Ga0075365_10004931 | |||
| 788 | Ga0075364_10025626 | |||
| 789 | Ga0075432_10001916 | |||
| 790 | Ga0070715_10050541 | |||
| 791 | Ga0070716_100019767 | |||
| 792 | Ga0070716_100026506 | |||
| 793 | Ga0070712_100004298 | |||
| 794 | Ga0070712_100144546 | |||
| 795 | Ga0070712_100252379 | |||
| 796 | Ga0075427_10010851 | |||
| 797 | Ga0097621_100254557 | |||
| 798 | Ga0075428_100166500 | |||
| 799 | Ga0075428_100203234 | |||
| 800 | Ga0075430_100017770 | |||
| 801 | Ga0075431_100035185 | |||
| 802 | Ga0075431_100091392 | |||
| 803 | Ga0075431_100137307 | |||
| 804 | Ga0075431_100245311 | |||
| 805 | Ga0075433_10000057 | |||
| 806 | Ga0075433_10000692 | |||
| 807 | Ga0075433_10000817 | |||
| 808 | Ga0075433_10060813 | |||
| 809 | Ga0075433_10073546 | |||
| 810 | Ga0075433_10677539 | |||
| 811 | Ga0075434_100000070 | |||
| 812 | Ga0075434_100001271 | |||
| 813 | Ga0075434_100016441 | |||
| 814 | Ga0075434_100041745 | |||
| 815 | Ga0075434_100227155 | |||
| 816 | Ga0075434_100313659 | |||
| 817 | Ga0075429_100000551 | |||
| 818 | Ga0075429_100269171 | |||
| 819 | Ga0075436_100009326 | |||
| 820 | Ga0075436_100274265 | |||
| 821 | Ga0097620_100000174 | |||
| 822 | Ga0097620_100254750 | |||
| 823 | Ga0097620_100308234 | |||
| 824 | Ga0097620_100568864 | |||
| 825 | Ga0075435_100003936 | |||
| 826 | Ga0075435_100128729 | |||
| 827 | Ga0075435_100147833 | |||
| 828 | Ga0075435_100161829 | |||
| 829 | Ga0105240_10003784 | |||
| 830 | Ga0111539_10006167 | |||
| 831 | Ga0111539_10043947 | |||
| 832 | Ga0111539_10194210 | |||
| 833 | Ga0111539_10960808 | |||
| 834 | Ga0111539_11308523 | |||
| 835 | Ga0105245_10256364 | |||
| 836 | Ga0105245_10473949 | |||
| 837 | Ga0105247_10000006 | |||
| 838 | Ga0105247_10564892 | |||
| 839 | Ga0105247_10705981 | |||
| 840 | Ga0114129_10003427 | |||
| 841 | Ga0114129_10020642 | |||
| 842 | Ga0114129_10039391 | |||
| 843 | Ga0114129_10056028 | |||
| 844 | Ga0114129_10162497 | |||
| 845 | Ga0114129_10177752 | |||
| 846 | Ga0114129_10191292 | |||
| 847 | Ga0114129_10463333 | |||
| 848 | Ga0114129_10621532 | |||
| 849 | Ga0105248_10000042 | |||
| 850 | Ga0105237_10003213 | |||
| 851 | Ga0105238_10139425 | |||
| 852 | Ga0105249_10000008 | |||
| 853 | Ga0105249_10042148 | |||
| 854 | Ga0105239_10002098 | |||
| 855 | Ga0105239_10264408 | |||
| 856 | Ga0105239_10686263 | |||
| 857 | Ga0105246_10698399 | |||
| 858 | Ga0105246_10926369 | |||
| 859 | Ga0157373_10589954 | |||
| 860 | Ga0157369_10652771 | |||
| 861 | Ga0157374_10911282 | |||
| 862 | Ga0157378_10115802 | |||
| 863 | Ga0163162_10075007 | |||
| 864 | Ga0163162_10748547 | |||
| 865 | Ga0157372_10102699 | |||
| 866 | Ga0157372_10493931 | |||
| 867 | Ga0157375_10085668 | |||
| 868 | Ga0157375_10607816 | |||
| 869 | Ga0163163_10026112 | |||
| 870 | Ga0163163_10539231 | |||
| 871 | Ga0157377_10281418 | |||
| 872 | Ga0157379_10064509 | |||
| 873 | Ga0157379_10091350 | |||
| 874 | Ga0157379_10098519 | |||
| 875 | Ga0157376_10807614 | |||
| 876 | Ga0213874_10149487 | |||
| 877 | Ga0213876_10002484 | |||
| 878 | Ga0213876_10008534 | |||
| 879 | Ga0213875_10010077 | |||
| 880 | Ga0224712_10151098 | |||
| 881 | Ga0207710_10000025 | |||
| 882 | Ga0207688_10026271 | |||
| 883 | Ga0207688_10032083 | |||
| 884 | Ga0207685_10017601 | |||
| 885 | Ga0207699_10068340 | |||
| 886 | Ga0207705_10148417 | |||
| 887 | Ga0207707_10080111 | |||
| 888 | Ga0207695_10021148 | |||
| 889 | Ga0207671_10254159 | |||
| 890 | Ga0207693_10003509 | |||
| 891 | Ga0207663_10020210 | |||
| 892 | Ga0207660_10089411 | |||
| 893 | Ga0207662_10395429 | |||
| 894 | Ga0207657_10471073 | |||
| 895 | Ga0207649_10189872 | |||
| 896 | Ga0207652_10063291 | |||
| 897 | Ga0207646_10029718 | |||
| 898 | Ga0207681_10003522 | |||
| 899 | Ga0207681_10039925 | |||
| 900 | Ga0207694_10038810 | |||
| 901 | Ga0207700_10536007 | |||
| 902 | Ga0207690_10140429 | |||
| 903 | Ga0207706_10755230 | |||
| 904 | Ga0207709_10337115 | |||
| 905 | Ga0207670_10785840 | |||
| 906 | Ga0207665_10002519 | |||
| 907 | Ga0207691_10121496 | |||
| 908 | Ga0207711_10000697 | |||
| 909 | Ga0207689_10211621 | |||
| 910 | Ga0207661_10000165 | |||
| 911 | Ga0207661_10318622 | |||
| 912 | Ga0207712_10000011 | |||
| 913 | Ga0207658_10000307 | |||
| 914 | Ga0207677_10349080 | |||
| 915 | Ga0207703_10006939 | |||
| 916 | Ga0207703_10784658 | |||
| 917 | Ga0207702_10086087 | |||
| 918 | Ga0207641_10005680 | |||
| 919 | Ga0207641_10174683 | |||
| 920 | Ga0207641_10489469 | |||
| 921 | Ga0207674_10342550 | |||
| 922 | Ga0207675_100337725 | |||
| 923 | Ga0207675_100474986 | |||
| 924 | Ga0207683_10094478 | |||
| 925 | Ga0207683_10135838 | |||
| 926 | Ga0207683_10456413 | |||
| 927 | Ga0207698_11124577 | |||
| 928 | Ga0207428_10004233 | |||
| 929 | Ga0207428_10064722 | |||
| 930 | Ga0207428_10222926 | |||
| 931 | Ga0268266_11116063 | |||
| 932 | Ga0268265_10000010 | |||
| 933 | Ga0268265_10171061 | |||
| 934 | Ga0268264_10000007 | |||
| 935 | Ga0268264_10248645 | |||
| 936 | Ga0307517_10012865 | |||
| 937 | Ga0307517_10032621 | |||
| 938 | Ga0307515_10000163 | |||
| 939 | Ga0307515_10164805 | |||
| 940 | Ga0307515_10234109 | |||
| 941 | Ga0307511_10000494 | |||
| 942 | Ga0307511_10000801 | |||
| 943 | Ga0307511_10120475 | |||
| 944 | Ga0307512_10001435 | |||
| 945 | Ga0307512_10058755 | |||
| 946 | Ga0307513_10034717 | |||
| 947 | Ga0307513_10050056 | |||
| 948 | Ga0307513_10123893 | |||
| 949 | Ga0307513_10161848 | |||
| 950 | Ga0307509_10020007 | |||
| 951 | Ga0307509_10039639 | |||
| 952 | Ga0307408_100082670 | |||
| 953 | Ga0307508_10014309 | |||
| 954 | Ga0307508_10052288 | |||
| 955 | Ga0307508_10099898 | |||
| 956 | Ga0307514_10023148 | |||
| 957 | Ga0316576_10056436 | |||
| 958 | Ga0307516_10015329 | |||
| 959 | Ga0307405_10589755 | |||
| 960 | Ga0307413_10405346 | |||
| 961 | Ga0307406_10105694 | |||
| 962 | Ga0307409_101036879 | |||
| 963 | Ga0307415_100669090 | |||
| 964 | Ga0307507_10005111 | |||
| 965 | Ga0307507_10025071 | |||
| 966 | Ga0307510_10017005 | |||
| 967 | Ga0373945_0055237 | |||
| 968 | Ga0373955_0062090 | |||
| 969 | Ga0316584_0131404 | |||
| 970 | Ga0395899_0040078 | |||
| 971 | Ga0395899_0323239 | |||
| 972 | Ga0395899_0370446 | |||
| 973 | Ga0395900_0006221 | |||
| 974 | Ga0395900_0056291 | |||
| 975 | Ga0395900_0102383 | |||
| 976 | Ga0395900_0224038 | |||
| 977 | Ga0395900_0235542 | |||
| 978 | Ga0395900_0253799 | |||
| 979 | Ga0395900_0773571 | |||
| 980 | Ga0395898_0002063 | |||
| 981 | Ga0395898_0015070 | |||
| 982 | Ga0395898_0068716 | |||
| 983 | Ga0395898_0106523 | |||
| 984 | Ga0395898_0306852 | |||
| 985 | Ga0395898_0755317 | |||
| 986 | Ga0395905_0008033 | |||
| 987 | Ga0395905_0075385 | |||
| 988 | Ga0395905_0128247 | |||
| 989 | Ga0395905_0214925 | |||
| 990 | Ga0436364_0034902 | |||
| 991 | Ga0395901_0008507 | |||
| 992 | Ga0395901_0009883 | |||
| 993 | Ga0395901_0011587 | |||
| 994 | Ga0395901_0021241 | |||
| 995 | Ga0395901_0137204 | |||
| 996 | Ga0395901_0190780 | |||
| 997 | Ga0395901_0439690 | |||
| 998 | Ga0395901_0510093 | |||
| 999 | Ga0242420_026583 | |||
| 1000 | Ga0400483_143088 | |||
| 1001 | Ga0436365_0418544 | |||
| 1002 | Ga0436365_1447684 | |||
| 1003 | Ga0436363_0708183 | |||
| 1004 | Ga0436363_0743096 | |||
| 1005 | Ga0436363_0936359 | |||
| 1006 | Ga0436363_1563078 | |||
| 1007 | Ga0436362_0942942 | |||
| 1008 | Ga0451837_0199012 | |||
| 1009 | Ga0451837_1576622 | |||
| 1010 | Ga0450892_008350 | |||
| 1011 | Ga0450916_004973 | |||
| 1012 | Ga0451577_0039770 | |||
| 1013 | Ga0451577_0607297 | |||
| 1014 | Ga0466965_0005651 | |||
| 1015 | Ga0466965_0153501 | |||
| 1016 | Ga0466966_0010361 | |||
| 1017 | Ga0466966_0303688 | |||
| 1018 | Ga0466961_0040499 | |||
| 1019 | Ga0466961_0084742 | |||
| 1020 | Ga0466963_0011503 | |||
| 1021 | Ga0466963_0023198 | |||
| 1022 | Ga0466963_0032705 | |||
| 1023 | Ga0466963_0035507 | |||
| 1024 | Ga0466963_0039164 | |||
| 1025 | Ga0466963_0069974 | |||
| 1026 | Ga0466963_0135672 | |||
| 1027 | Ga0466963_0222415 | |||
| 1028 | Ga0466963_0605066 | |||
| 1029 | Ga0466964_0015320 | |||
| 1030 | Ga0466971_0003662 | |||
| 1031 | Ga0466971_0036214 | |||
| 1032 | Ga0466971_0056136 | |||
| 1033 | Ga0466968_0029833 | |||
| 1034 | Ga0466968_0032795 | |||
| 1035 | Ga0466968_0147930 | |||
| 1036 | Ga0466970_0168959 | |||
| 1037 | Ga0466970_0259865 | |||
| 1038 | Ga0466957_0003743 | |||
| 1039 | Ga0466957_0286027 | |||
| 1040 | Ga0466960_0025585 | |||
| 1041 | Ga0466960_0131085 | |||
| 1042 | Ga0466960_0163557 | |||
| 1043 | Ga0466959_0278242 | |||
| 1044 | Ga0466959_0319021 | |||
| 1045 | Ga0466959_0364863 | |||
| 1046 | Ga0466958_0003197 | |||
| 1047 | Ga0466958_0059539 | |||
| 1048 | Ga0466958_0175435 | |||
| 1049 | Ga0466967_0011207 | |||
| 1050 | Ga0466967_0031038 | |||
| 1051 | Ga0466967_0050443 | |||
| 1052 | Ga0466967_0195130 | |||
| 1053 | Ga0466967_0307203 | |||
| 1054 | Ga0466967_0695030 | |||
| 1055 | Ga0466967_0723810 | |||
| 1056 | Ga0495592_0001429 | |||
| 1057 | Ga0495592_0011840 | |||
| 1058 | Ga0495603_0099638 | |||
| 1059 | Ga0495629_0100871 | |||
| 1060 | Ga0495629_0153332 | |||
| 1061 | Ga0495629_0178483 | |||
| 1062 | Ga0495638_0016925 | |||
| 1063 | Ga0495638_0458505 | |||
| 1064 | Ga0495641_0036246 | |||
| 1065 | Ga0495641_0050692 | |||
| 1066 | Ga0495641_0161695 | |||
| 1067 | Ga0495651_0003189 | |||
| 1068 | Ga0495651_0020082 | |||
| 1069 | Ga0495651_0047909 | |||
| 1070 | Ga0495653_0010780 | |||
| 1071 | Ga0495653_0265686 | |||
| 1072 | Ga0495582_0054187 | |||
| 1073 | Ga0495662_0006967 | |||
| 1074 | Ga0495662_0024405 | |||
| 1075 | Ga0495664_0000570 | |||
| 1076 | Ga0495664_0003276 | |||
| 1077 | Ga0495584_0199194 | |||
| 1078 | Ga0495608_0033506 | |||
| 1079 | Ga0495608_0035457 | |||
| 1080 | Ga0495618_0144431 | |||
| 1081 | Ga0495628_0013118 | |||
| 1082 | Ga0495628_0030865 | |||
| 1083 | Ga0495628_0082218 | |||
| 1084 | Ga0495630_0001009 | |||
| 1085 | Ga0495630_0173220 | |||
| 1086 | Ga0495630_0176522 | |||
| 1087 | Ga0495632_0078164 | |||
| 1088 | Ga0495643_0002747 | |||
| 1089 | Ga0495666_0001180 | |||
| 1090 | Ga0495652_0174380 | |||
| 1091 | Ga0495652_0363247 | |||
| 1092 | Ga0495665_0124723 | |||
| 1093 | Ga0495640_0010017 | |||
| 1094 | Ga0495640_0010089 | |||
| 1095 | Ga0495640_0025254 | |||
| 1096 | Ga0495586_0085245 | |||
| 1097 | Ga0495587_0020918 | |||
| 1098 | Ga0495587_0022547 | |||
| 1099 | Ga0495645_0009902 | |||
| 1100 | Ga0495645_0032965 | |||
| 1101 | Ga0495622_0086664 | |||
| 1102 | Ga0495667_0011057 | |||
| 1103 | Ga0495667_0115710 | |||
| 1104 | Ga0495656_0053442 | |||
| 1105 | Ga0495634_0002883 | |||
| 1106 | Ga0495634_0015084 | |||
| 1107 | Ga0495634_0029640 | |||
| 1108 | Ga0495635_0004228 | |||
| 1109 | Ga0495635_0038686 | |||
| 1110 | Ga0495588_0038469 | |||
| 1111 | Ga0495588_0069978 | |||
| 1112 | Ga0495657_0011045 | |||
| 1113 | Ga0495657_0033976 | |||
| 1114 | Ga0495657_0175477 | |||
| 1115 | Ga0495657_0265421 | |||
| 1116 | Ga0495599_0079066 | |||
| 1117 | Ga0495599_0170704 | |||
| 1118 | Ga0495599_0461554 | |||
| 1119 | Ga0495623_0024618 | |||
| 1120 | Ga0495646_0002533 | |||
| 1121 | Ga0495646_0004122 | |||
| 1122 | Ga0495646_0193009 | |||
| 1123 | Ga0495658_0069007 | |||
| 1124 | Ga0495658_0461387 | |||
| 1125 | Ga0495613_0001149 | |||
| 1126 | Ga0495613_0001262 | |||
| 1127 | Ga0495613_0115036 | |||
| 1128 | Ga0495624_0090309 | |||
| 1129 | Ga0495670_0022785 | |||
| 1130 | Ga0495671_0006048 | |||
| 1131 | Ga0495600_0025515 | |||
| 1132 | Ga0495600_0046346 | |||
| 1133 | Ga0495600_0203305 | |||
| 1134 | Ga0495660_0061919 | |||
| 1135 | Ga0495581_0029246 | |||
| 1136 | Ga0495604_0001320 | |||
| 1137 | Ga0495604_0003274 | |||
| 1138 | Ga0495604_0070049 | |||
| 1139 | Ga0495636_0008797 | |||
| 1140 | Ga0495674_0000568 | |||
| 1141 | Ga0495674_0017715 | |||
| 1142 | Ga0495676_0011223 | |||
| 1143 | Ga0495676_0117228 | |||
| 1144 | Ga0495680_0000393 | |||
| 1145 | Ga0495683_0230133 | |||
| 1146 | Ga0495687_003574 | |||
| 1147 | Ga0495687_019625 | |||
| 1148 | Ga0495685_002401 | |||
| 1149 | Ga0495681_0003284 | |||
| 1150 | Ga0495684_0014945 | |||
| 1151 | Ga0495684_0018965 | |||
| 1152 | Ga0495684_0022203 | |||
| 1153 | Ga0495686_0117098 | |||
| 1154 | Ga0495686_0287729 | |||
| 1155 | Ga0495593_0008831 | |||
| 1156 | Ga0495593_0031569 | |||
| 1157 | Ga0495602_0049695 | |||
| 1158 | Ga0495614_0017478 | |||
| 1159 | Ga0496100_0000004 | |||
| 1160 | Ga0496100_0010810 | |||
| 1161 | Ga0496100_0098453 | |||
| 1162 | Ga0496101_0000007 | |||
| 1163 | Ga0496101_0020411 | |||
| 1164 | Ga0496101_0080653 | |||
| 1165 | Ga0496102_0000060 | |||
| 1166 | Ga0496102_0015718 | |||
| 1167 | Ga0496102_0139345 | |||
| 1168 | Ga0496103_0000500 | |||
| 1169 | Ga0496103_0003635 | |||
| 1170 | Ga0496104_0537280 | |||
| 1171 | Ga0496105_0011383 | |||
| 1172 | Ga0496105_0529556 | |||
| 1173 | Ga0496106_0000004 | |||
| 1174 | Ga0496106_0008284 | |||
| 1175 | Ga0496106_0355496 | |||
| 1176 | Ga0496107_0000001 | |||
| 1177 | Ga0496107_0083153 | |||
| 1178 | Ga0496107_0283088 | |||
| 1179 | Ga0496108_0032225 | |||
| 1180 | Ga0496108_0330652 | |||
| 1181 | Ga0496110_0174763 | |||
| 1182 | Ga0496110_0844618 | |||
| 1183 | Ga0496111_0020922 | |||
| 1184 | Ga0496111_0064521 | |||
| 1185 | Ga0496111_0298048 | |||
| 1186 | Ga0496111_0688734 | |||
| 1187 | Ga0496112_0037377 | |||
| 1188 | Ga0496112_1017341 | |||
| 1189 | Ga0496113_0006265 | |||
| 1190 | Ga0496113_0089085 | |||
| 1191 | Ga0496114_0002542 | |||
| 1192 | Ga0496114_0241857 | |||
| 1193 | Ga0496115_0000815 | |||
| 1194 | Ga0496115_0270508 | |||
| 1195 | Ga0496116_0046069 | |||
| 1196 | Ga0496117_0002026 | |||
| 1197 | Ga0496118_0001179 | |||
| 1198 | Ga0496119_0016754 | |||
| 1199 | Ga0496120_0004413 | |||
| 1200 | Ga0496121_0085248 | |||
| 1201 | Ga0496121_0181465 | |||
| 1202 | Ga0496124_0088633 | |||
| 1203 | Ga0496125_0003753 | |||
| 1204 | Ga0496125_0012912 | |||
| 1205 | Ga0496126_0008248 | |||
| 1206 | Ga0501031_0073698 | |||
| 1207 | Ga0501031_0389206 | |||
| 1208 | Ga0501032_0031810 | |||
| 1209 | Ga0501033_0102558 | |||
| 1210 | Ga0501033_0210416 | |||
| 1211 | Ga0501034_0326431 | |||
| 1212 | Ga0501036_0001457 | |||
| 1213 | Ga0501036_0017262 | |||
| 1214 | Ga0501036_0045229 | |||
| 1215 | Ga0501036_0064238 | |||
| 1216 | Ga0501036_0298324 | |||
| 1217 | Ga0501036_0352087 | |||
| 1218 | Ga0501037_0049852 | |||
| 1219 | Ga0501038_0055443 | |||
| 1220 | Ga0501039_0003396 | |||
| 1221 | Ga0501039_0003643 | |||
| 1222 | Ga0501039_0101275 | |||
| 1223 | Ga0501040_0000515 | |||
| 1224 | Ga0501040_0006488 | |||
| 1225 | Ga0501040_0048027 | |||
| 1226 | Ga0501040_0056481 | |||
| 1227 | Ga0501040_0130371 | |||
| 1228 | Ga0501041_0017542 | |||
| 1229 | Ga0501041_0023411 | |||
| 1230 | Ga0501041_0025760 | |||
| 1231 | Ga0501041_0154381 | |||
| 1232 | Ga0501042_0019543 | |||
| 1233 | Ga0501042_0039878 | |||
| 1234 | Ga0501042_0096001 | |||
| 1235 | Ga0501042_0112336 | |||
| 1236 | Ga0501043_0170030 | |||
| 1237 | Ga0501046_0019768 | |||
| 1238 | Ga0501046_0103554 | |||
| 1239 | Ga0501046_0137248 | |||
| 1240 | Ga0501046_0501763 | |||
| 1241 | Ga0501048_0009811 | |||
| 1242 | Ga0501048_0109180 | |||
| 1243 | Ga0501048_0144990 | |||
| 1244 | Ga0501067_0001773 | |||
| 1245 | Ga0501068_0275327 | |||
| 1246 | Ga0501068_0312935 | |||
| 1247 | Ga0501069_0025346 | |||
| 1248 | Ga0501069_0189605 | |||
| 1249 | Ga0501070_0014832 | |||
| 1250 | Ga0501071_0001164 | |||
| 1251 | Ga0501071_0045033 | |||
| 1252 | Ga0501071_0066901 | |||
| 1253 | Ga0501071_0127405 | |||
| 1254 | Ga0501072_0000894 | |||
| 1255 | Ga0501072_0003415 | |||
| 1256 | Ga0501072_0025305 | |||
| 1257 | Ga0501072_0055650 | |||
| 1258 | Ga0501073_0002737 | |||
| 1259 | Ga0501073_0348937 | |||
| 1260 | Ga0501074_0009393 | |||
| 1261 | Ga0501074_0030239 | |||
| 1262 | Ga0501074_0112760 | |||
| 1263 | Ga0501074_0121445 | |||
| 1264 | Ga0501075_0003952 | |||
| 1265 | Ga0501075_0004349 | |||
| 1266 | Ga0501075_0130354 | |||
| 1267 | Ga0501075_0138435 | |||
| 1268 | Ga0501075_0372971 | |||
| 1269 | Ga0501076_0003103 | |||
| 1270 | Ga0501076_0007818 | |||
| 1271 | Ga0501076_0029116 | |||
| 1272 | Ga0501076_0082896 | |||
| 1273 | Ga0501076_0085597 | |||
| 1274 | Ga0501076_0086792 | |||
| 1275 | Ga0501076_0472224 | |||
| 1276 | Ga0501077_0027075 | |||
| 1277 | Ga0501077_0030118 | |||
| 1278 | Ga0501077_0078121 | |||
| 1279 | Ga0501077_0309307 | |||
| 1280 | Ga0501079_0002701 | |||
| 1281 | Ga0501079_0153559 | |||
| 1282 | Ga0501079_0276149 | |||
| 1283 | Ga0501079_0387385 | |||
| 1284 | Ga0501079_0406984 | |||
| 1285 | Ga0501080_0174268 | |||
| 1286 | Ga0501080_0322871 | |||
| 1287 | Ga0501081_0016708 | |||
| 1288 | Ga0501081_0032249 | |||
| 1289 | Ga0501081_0313777 | |||
| 1290 | Ga0501083_0015377 | |||
| 1291 | Ga0501035_0020722 | |||
| 1292 | Ga0501035_0055381 | |||
| 1293 | Ga0501035_0056570 | |||
| 1294 | Ga0501035_0309722 | |||
| 1295 | Ga0501044_0332749 | |||
| 1296 | Ga0501045_0004075 | |||
| 1297 | Ga0501045_0116512 | |||
| 1298 | Ga0501045_0139177 | |||
| 1299 | nmdc:mga0yw44_140119_c1 | |||
| 1300 | nmdc:mga0yw44_51785_c1 | |||
| 1301 | nmdc:mga0yw44_88951_c1 | |||
| 1302 | nmdc:mga05p37_10310_c1 | |||
| 1303 | nmdc:mga05p37_1215725_c1 | |||
| 1304 | nmdc:mga05p37_130523_c1 | |||
| 1305 | nmdc:mga05p37_142939_c1 | |||
| 1306 | nmdc:mga05p37_147460_c1 | |||
| 1307 | nmdc:mga05p37_21214_c1 | |||
| 1308 | nmdc:mga05p37_21516_c1 | |||
| 1309 | nmdc:mga05p37_482142_c1 | |||
| 1310 | nmdc:mga05p37_48686_c1 | |||
| 1311 | nmdc:mga09592_169501_c1 | |||
| 1312 | nmdc:mga0qj67_91666_c1 | |||
| 1313 | nmdc:mga06r32_13499_c1 | |||
| 1314 | nmdc:mga06r32_330200_c1 | |||
| 1315 | nmdc:mga06r32_438984_c1 | |||
| 1316 | nmdc:mga06r32_79753_c1 | |||
| 1317 | nmdc:mga08y16_45205_c1 | |||
| 1318 | nmdc:mga08y16_80546_c1 | |||
| 1319 | nmdc:mga08y16_953155_c1 | |||
| 1320 | nmdc:mga0n895_320921_c1 | |||
| 1321 | nmdc:mga0n895_56427_c1 | |||
| 1322 | nmdc:mga0n895_57126_c1 | |||
| 1323 | nmdc:mga0n895_63695_c1 | |||
| 1324 | nmdc:mga0n895_743_c1 | |||
| 1325 | nmdc:mga0n895_9556_c1 | |||
| 1326 | nmdc:mga0rr50_135216_c1 | |||
| 1327 | nmdc:mga0rr50_135655_c1 | |||
| 1328 | nmdc:mga0rr50_333702_c1 | |||
| 1329 | nmdc:mga0rr50_3537_c1 | |||
| 1330 | nmdc:mga0rr50_43998_c1 | |||
| 1331 | nmdc:mga08x19_3507_c1 | |||
| 1332 | nmdc:mga08x19_636081_c1 | |||
| 1333 | nmdc:mga0a205_102371_c1 | |||
| 1334 | nmdc:mga0a205_115185_c1 | |||
| 1335 | nmdc:mga0a205_1_c2 | |||
| 1336 | nmdc:mga0a205_20197_c1 | |||
| 1337 | nmdc:mga0a205_22022_c1 | |||
| 1338 | nmdc:mga0a205_32312_c1 | |||
| 1339 | nmdc:mga0a205_33485_c1 | |||
| 1340 | nmdc:mga0a205_68679_c1 | |||
| 1341 | Ga0495601_0087095 | |||
| 1342 | Ga0495655_0113043 | |||
| 1343 | Ga0495619_0040632 | |||
| 1344 | Ga0495619_0180766 | |||
| 1345 | Ga0500578_0012444 | |||
| 1346 | Ga0500640_023966 | |||
| 1347 | Ga0500654_058339 | |||
| 1348 | Ga0500660_039633 | |||
| 1349 | Ga0500553_136757 | |||
| 1350 | Ga0500560_000468 | |||
| 1351 | Ga0500569_001500 | |||
| 1352 | Ga0500572_088713 | |||
| 1353 | Ga0500614_004794 | |||
| 1354 | Ga0500614_018592 | |||
| 1355 | Ga0500628_005693 | |||
| 1356 | Ga0500652_007135 | |||
| 1357 | Ga0500658_0033416 | |||
| 1358 | Ga0500559_0165501 | |||
| 1359 | Ga0500561_0000775 | |||
| 1360 | Ga0500573_0114554 | |||
| 1361 | Ga0500577_0068266 | |||
| 1362 | Ga0500588_0126179 | |||
| 1363 | Ga0500600_0001718 | |||
| 1364 | Ga0500603_036123 | |||
| 1365 | Ga0500616_0106578 | |||
| 1366 | Ga0500624_006191 | |||
| 1367 | Ga0500633_0025426 | |||
| 1368 | Ga0500634_0001300 | |||
| 1369 | Ga0500656_001260 | |||
| 1370 | Ga0501084_0004385 | |||
| 1371 | Ga0501084_0029398 | |||
| 1372 | Ga0501084_0081060 | |||
| 1373 | Ga0501084_0660664 | |||
| 1374 | Ga0501082_0070632 | |||
| 1375 | Ga0501082_0105889 | |||
| 1376 | Ga0501082_0136813 | |||
| 1377 | Ga0501082_0172521 | |||
| 1378 | Ga0501082_0589463 | |||
| 1379 | Ga0466962_0001045 | |||
| 1380 | Ga0466962_0004738 | |||
| 1381 | Ga0466962_0070878 | |||
| 1382 | Ga0466962_0118825 | |||
| 1383 | Ga0530510_0005561 | |||
| 1384 | Ga0530510_0009858 | |||
| 1385 | Ga0530510_0020967 | |||
| 1386 | Ga0530510_0035126 | |||
| 1387 | Ga0530510_0184960 | |||
| 1388 | 2793975290 | |||
| 1389 | 2809590728 | |||
| 1390 | 2867347304 | |||
| 1391 | 2899368960 | |||
| 1392 | 8047719701 | |||
| 1393 | 8047900553 | |||
| 1394 | 8048358349 | |||
| 1395 | 8048377493 | |||
| 1396 | 8048386591 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.9807 | 5 | 123 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.979 | 7 | 124 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9787 | 5 | 123 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9786 | 7 | 124 |
| 5hm6-assembly1.cif.gz_A | n-terminal domain of bfmr from acinetobacter baumannii | 0.9776 | 5 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9987 | 6 | 85 | 3.40.50.2300 |
| af_O07776_147_246_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.989 | 131 | 228 | 1.10.10.10 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9818 | 6 | 85 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9806 | 5 | 85 | 3.40.50.2300 |
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9787 | 3 | 122 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T3N0B4-F1-model_v4 | Response regulatory domain-containing protein | 0.9868 | 6 | 123 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7C4IG96-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9827 | 7 | 120 |
GO:0000155
GO:0005886 GO:0009927 |
| AF-A0A6I5QSI8-F1-model_v4 | Response regulator | 0.9822 | 5 | 122 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A5C6EQA2-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9811 | 7 | 122 |
GO:0000155
GO:0005886 |
| AF-A0A3C0Z4C2-F1-model_v4 | DNA-binding response regulator | 0.979 | 6 | 122 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |