F475987

General Info

Members Datasets Scaffolds Average Seq Length
698 349 1396 224

Family's Representative Sequence

Representative Sequence 3300049588|Ga0501072_0023500|Ga0501072_0023500_2579_3355
Length 258
Sequence VNATVGQGRVDLRNRLTAPNPAFHFSFILRRSLWCEDEVKMASLIRRGLRREGIAADVAIKGEDALWMAEATEYDAIVLDLMLPGIDGLEVCRRLRAEGVWSPILMLTARDAVRDRVAGLDGGADDYVTKPFSYAELLARLRALVRRGPAERPTQLEVGDLRLDPATRRVWRDDTEIELSAKEFAILEIFMRRAGEVLSRFQLLEHAWDYDYENRSNVVDSYVRFLRRKIDKPFGVESIETVRGAGYRLRDDGGGRES

Samples

Sample ID Description Type Environment
1 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
168 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
173 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
174 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
182 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
285 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
310 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
311 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
314 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
315 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
316 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
317 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
318 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
319 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
320 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
321 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
322 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
323 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
324 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
325 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
326 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
327 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
328 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
329 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
330 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
331 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
334 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
335 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
336 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
340 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
341 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
342 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
343 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
344 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
345 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
346 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
347 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
348 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
349 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.57
Metatranscriptomes 0.14
Isolates 1.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 0
Rhizoplane 5.3
Rhizosphere 82.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501072_0023500 3300049588 Bacteria 4789
2 JGI25406J46586_10016300 3300003203 Bacteria 3101
3 Ga0065712_10134679 3300005290 Bacteria 1487
4 Ga0070658_10167205 3300005327 Bacteria 1847
5 Ga0070683_100001023 3300005329 Bacteria 20987
6 Ga0070683_100426284 3300005329 Bacteria 1266
7 Ga0070690_100220633 3300005330 Bacteria 1328
8 Ga0068869_100055969 3300005334 Bacteria 2875
9 Ga0070680_100167508 3300005336 Bacteria 1848
10 Ga0070682_100124198 3300005337 Bacteria 1737
11 Ga0068868_100030488 3300005338 Bacteria 4136
12 Ga0070668_100326753 3300005347 Bacteria 1292
13 Ga0070669_100120823 3300005353 Bacteria 1998
14 Ga0070669_100475705 3300005353 Bacteria 1033
15 Ga0070674_100280002 3300005356 Bacteria 1321
16 Ga0070673_100579406 3300005364 Bacteria 1022
17 Ga0070659_100145991 3300005366 Bacteria 1927
18 Ga0070667_100000223 3300005367 Bacteria 65543
19 Ga0070709_10263492 3300005434 Bacteria 1246
20 Ga0070714_100177698 3300005435 Bacteria 1935
21 Ga0070713_100873452 3300005436 Bacteria 864
22 Ga0070701_10072885 3300005438 Bacteria 1840
23 Ga0070705_100096968 3300005440 Bacteria 1852
24 Ga0070700_100168651 3300005441 Bacteria 1514
25 Ga0070694_100018986 3300005444 Bacteria 4369
26 Ga0070708_100364018 3300005445 Bacteria 1363
27 Ga0070663_100406052 3300005455 Bacteria 1115
28 Ga0070663_100497112 3300005455 Bacteria 1012
29 Ga0070678_100088450 3300005456 Bacteria 2368
30 Ga0070678_100174377 3300005456 Bacteria 1754
31 Ga0070662_100279092 3300005457 Bacteria 1352
32 Ga0070681_10039140 3300005458 Bacteria 4753
33 Ga0068867_100158097 3300005459 Bacteria 1785
34 Ga0070698_100000518 3300005471 Bacteria 41042
35 Ga0070698_100011475 3300005471 Bacteria 9402
36 Ga0070698_100128964 3300005471 Bacteria 2485
37 Ga0070699_100003005 3300005518 Bacteria 14987
38 Ga0070699_100756683 3300005518 Bacteria 889
39 Ga0070679_100150861 3300005530 Bacteria 2301
40 Ga0070684_100150171 3300005535 Bacteria 2110
41 Ga0070684_100452029 3300005535 Bacteria 1187
42 Ga0070684_100631378 3300005535 Bacteria 997
43 Ga0070697_100110630 3300005536 Bacteria 2289
44 Ga0070697_100274165 3300005536 Bacteria 1446
45 Ga0070686_100002743 3300005544 Bacteria 9696
46 Ga0070686_100070463 3300005544 Bacteria 2286
47 Ga0070696_100081602 3300005546 Bacteria 2291
48 Ga0070665_100005604 3300005548 Bacteria 12910
49 Ga0070665_100309521 3300005548 Bacteria 1583
50 Ga0070704_100077141 3300005549 Bacteria 2440
51 Ga0070704_100110388 3300005549 Bacteria 2092
52 Ga0070664_100475507 3300005564 Bacteria 1149
53 Ga0068856_100197319 3300005614 Bacteria 2027
54 Ga0068856_100913195 3300005614 Bacteria 897
55 Ga0070702_100308501 3300005615 Bacteria 1098
56 Ga0068852_100068387 3300005616 Bacteria 3108
57 Ga0068852_100920085 3300005616 Bacteria 892
58 Ga0068859_100000174 3300005617 Bacteria 62740
59 Ga0068859_100254743 3300005617 Bacteria 1846
60 Ga0068859_100308206 3300005617 Bacteria 1677
61 Ga0068859_100568932 3300005617 Bacteria 1227
62 Ga0068864_100333323 3300005618 Bacteria 1428
63 Ga0068861_100458385 3300005719 Bacteria 1144
64 Ga0068870_10069329 3300005840 Bacteria 1918
65 Ga0068863_100032761 3300005841 Bacteria 4951
66 Ga0068863_100848734 3300005841 Bacteria 912
67 Ga0068858_100003020 3300005842 Bacteria 16880
68 Ga0068858_100765347 3300005842 Bacteria 941
69 Ga0068860_100000044 3300005843 Bacteria 225595
70 Ga0068862_100000003 3300005844 Bacteria 369793
71 Ga0068862_100188980 3300005844 Bacteria 1852
72 Ga0081455_10048160 3300005937 Bacteria 3685
73 Ga0081455_10052144 3300005937 Bacteria 3504
74 Ga0081455_10085651 3300005937 Bacteria 2569
75 Ga0081455_10087914 3300005937 Bacteria 2527
76 Ga0081455_10217123 3300005937 Bacteria 1420
77 Ga0081538_10000058 3300005981 Bacteria 102121
78 Ga0081538_10000068 3300005981 Bacteria 97659
79 Ga0081538_10009031 3300005981 Bacteria 8371
80 Ga0081538_10045943 3300005981 Bacteria 2701
81 Ga0081538_10058172 3300005981 Bacteria 2245
82 Ga0081538_10089618 3300005981 Bacteria 1596
83 Ga0081540_1008210 3300005983 Bacteria 7311
84 Ga0081540_1123603 3300005983 Bacteria 1069
85 Ga0081539_10000062 3300005985 Bacteria 249871
86 Ga0081539_10003738 3300005985 Bacteria 18103
87 Ga0081539_10076839 3300005985 Bacteria 1768
88 Ga0075365_10001599 3300006038 Bacteria 10423
89 Ga0075365_10004931 3300006038 Bacteria 7139
90 Ga0075364_10025626 3300006051 Bacteria 3754
91 Ga0075432_10001916 3300006058 Bacteria 6895
92 Ga0070715_10050541 3300006163 Bacteria 1785
93 Ga0070716_100019767 3300006173 Bacteria 3525
94 Ga0070716_100026506 3300006173 Bacteria 3105
95 Ga0070712_100004298 3300006175 Bacteria 8773
96 Ga0070712_100144546 3300006175 Bacteria 1819
97 Ga0070712_100252379 3300006175 Bacteria 1410
98 Ga0075427_10010851 3300006194 Bacteria 1368
99 Ga0097621_100254557 3300006237 Bacteria 1539
100 Ga0075428_100166500 3300006844 Bacteria 2391
101 Ga0075428_100203234 3300006844 Bacteria 2141
102 Ga0075430_100017770 3300006846 Bacteria 6054
103 Ga0075431_100035185 3300006847 Bacteria 5157
104 Ga0075431_100091392 3300006847 Bacteria 3142
105 Ga0075431_100137307 3300006847 Bacteria 2521
106 Ga0075431_100245311 3300006847 Bacteria 1821
107 Ga0075433_10000057 3300006852 Bacteria 48581
108 Ga0075433_10000692 3300006852 Bacteria 22971
109 Ga0075433_10000817 3300006852 Bacteria 21667
110 Ga0075433_10060813 3300006852 Bacteria 3308
111 Ga0075433_10073546 3300006852 Bacteria 3006
112 Ga0075433_10677539 3300006852 Bacteria 904
113 Ga0075434_100000070 3300006871 Bacteria 53323
114 Ga0075434_100001271 3300006871 Bacteria 21016
115 Ga0075434_100016441 3300006871 Bacteria 7112
116 Ga0075434_100041745 3300006871 Bacteria 4545
117 Ga0075434_100227155 3300006871 Bacteria 1886
118 Ga0075434_100313659 3300006871 Bacteria 1588
119 Ga0075429_100000551 3300006880 Bacteria 28615
120 Ga0075429_100269171 3300006880 Bacteria 1492
121 Ga0075436_100009326 3300006914 Bacteria 6712
122 Ga0075436_100274265 3300006914 Bacteria 1205
123 Ga0097620_100000174 3300006931 Bacteria 62740
124 Ga0097620_100254750 3300006931 Bacteria 1846
125 Ga0097620_100308234 3300006931 Bacteria 1677
126 Ga0097620_100568864 3300006931 Bacteria 1227
127 Ga0075435_100003936 3300007076 Bacteria 10154
128 Ga0075435_100128729 3300007076 Bacteria 2117
129 Ga0075435_100147833 3300007076 Bacteria 1974
130 Ga0075435_100161829 3300007076 Bacteria 1885
131 Ga0105240_10003784 3300009093 Bacteria 23373
132 Ga0111539_10006167 3300009094 Bacteria 15472
133 Ga0111539_10043947 3300009094 Bacteria 5354
134 Ga0111539_10194210 3300009094 Bacteria 2368
135 Ga0111539_10960808 3300009094 Bacteria 993
136 Ga0111539_11308523 3300009094 Bacteria 841
137 Ga0105245_10256364 3300009098 Bacteria 1701
138 Ga0105245_10473949 3300009098 Bacteria 1264
139 Ga0105247_10000006 3300009101 Bacteria 416061
140 Ga0105247_10564892 3300009101 Bacteria 838
141 Ga0105247_10705981 3300009101 Bacteria 760
142 Ga0114129_10003427 3300009147 Bacteria 22298
143 Ga0114129_10020642 3300009147 Bacteria 9366
144 Ga0114129_10039391 3300009147 Bacteria 6662
145 Ga0114129_10056028 3300009147 Bacteria 5524
146 Ga0114129_10162497 3300009147 Bacteria 3049
147 Ga0114129_10177752 3300009147 Bacteria 2898
148 Ga0114129_10191292 3300009147 Bacteria 2778
149 Ga0114129_10463333 3300009147 Bacteria 1661
150 Ga0114129_10621532 3300009147 Bacteria 1397
151 Ga0105248_10000042 3300009177 Bacteria 167583
152 Ga0105237_10003213 3300009545 Bacteria 19575
153 Ga0105238_10139425 3300009551 Bacteria 2402
154 Ga0105249_10000008 3300009553 Bacteria 341271
155 Ga0105249_10042148 3300009553 Bacteria 4150
156 Ga0105239_10002098 3300010375 Bacteria 25810
157 Ga0105239_10264408 3300010375 Bacteria 1934
158 Ga0105239_10686263 3300010375 Bacteria 1171
159 Ga0105246_10698399 3300011119 Bacteria 889
160 Ga0105246_10926369 3300011119 Bacteria 783
161 Ga0157373_10589954 3300013100 Bacteria 808
162 Ga0157369_10652771 3300013105 Bacteria 1085
163 Ga0157374_10911282 3300013296 Bacteria 897
164 Ga0157378_10115802 3300013297 Bacteria 2464
165 Ga0163162_10075007 3300013306 Bacteria 3442
166 Ga0163162_10748547 3300013306 Bacteria 1097
167 Ga0157372_10102699 3300013307 Bacteria 3266
168 Ga0157372_10493931 3300013307 Bacteria 1427
169 Ga0157375_10085668 3300013308 Bacteria 3201
170 Ga0157375_10607816 3300013308 Bacteria 1252
171 Ga0163163_10026112 3300014325 Bacteria 5578
172 Ga0163163_10539231 3300014325 Bacteria 1229
173 Ga0157377_10281418 3300014745 Bacteria 1090
174 Ga0157379_10064509 3300014968 Bacteria 3273
175 Ga0157379_10091350 3300014968 Bacteria 2731
176 Ga0157379_10098519 3300014968 Bacteria 2624
177 Ga0157376_10807614 3300014969 Bacteria 951
178 Ga0213874_10149487 3300021377 Bacteria 814
179 Ga0213876_10002484 3300021384 Bacteria 10824
180 Ga0213876_10008534 3300021384 Bacteria 5547
181 Ga0213875_10010077 3300021388 Bacteria 4749
182 Ga0224712_10151098 3300022467 Bacteria 1029
183 Ga0207710_10000025 3300025900 Bacteria 314658
184 Ga0207688_10026271 3300025901 Bacteria 3201
185 Ga0207688_10032083 3300025901 Bacteria 2902
186 Ga0207685_10017601 3300025905 Bacteria 2315
187 Ga0207699_10068340 3300025906 Bacteria 2163
188 Ga0207705_10148417 3300025909 Bacteria 1755
189 Ga0207707_10080111 3300025912 Bacteria 2851
190 Ga0207695_10021148 3300025913 Bacteria 7432
191 Ga0207671_10254159 3300025914 Bacteria 1382
192 Ga0207693_10003509 3300025915 Bacteria 13395
193 Ga0207663_10020210 3300025916 Bacteria 3768
194 Ga0207660_10089411 3300025917 Bacteria 2280
195 Ga0207662_10395429 3300025918 Bacteria 936
196 Ga0207657_10471073 3300025919 Bacteria 985
197 Ga0207649_10189872 3300025920 Bacteria 1444
198 Ga0207652_10063291 3300025921 Bacteria 3199
199 Ga0207646_10029718 3300025922 Bacteria 4963
200 Ga0207681_10003522 3300025923 Bacteria 9749
201 Ga0207681_10039925 3300025923 Bacteria 3120
202 Ga0207694_10038810 3300025924 Bacteria 3662
203 Ga0207700_10536007 3300025928 Bacteria 1038
204 Ga0207690_10140429 3300025932 Bacteria 1779
205 Ga0207706_10755230 3300025933 Bacteria 828
206 Ga0207709_10337115 3300025935 Bacteria 1134
207 Ga0207670_10785840 3300025936 Bacteria 792
208 Ga0207665_10002519 3300025939 Bacteria 12318
209 Ga0207691_10121496 3300025940 Bacteria 2314
210 Ga0207711_10000697 3300025941 Bacteria 33164
211 Ga0207689_10211621 3300025942 Bacteria 1602
212 Ga0207661_10000165 3300025944 Bacteria 43066
213 Ga0207661_10318622 3300025944 Bacteria 1397
214 Ga0207712_10000011 3300025961 Bacteria 412321
215 Ga0207658_10000307 3300025986 Bacteria 50415
216 Ga0207677_10349080 3300026023 Bacteria 1239
217 Ga0207703_10006939 3300026035 Bacteria 9013
218 Ga0207703_10784658 3300026035 Bacteria 909
219 Ga0207702_10086087 3300026078 Bacteria 2740
220 Ga0207641_10005680 3300026088 Bacteria 10618
221 Ga0207641_10174683 3300026088 Bacteria 1964
222 Ga0207641_10489469 3300026088 Bacteria 1193
223 Ga0207674_10342550 3300026116 Bacteria 1445
224 Ga0207675_100337725 3300026118 Bacteria 1474
225 Ga0207675_100474986 3300026118 Bacteria 1242
226 Ga0207683_10094478 3300026121 Bacteria 2665
227 Ga0207683_10135838 3300026121 Bacteria 2214
228 Ga0207683_10456413 3300026121 Bacteria 1178
229 Ga0207698_11124577 3300026142 Bacteria 798
230 Ga0207428_10004233 3300027907 Bacteria 13743
231 Ga0207428_10064722 3300027907 Bacteria 2886
232 Ga0207428_10222926 3300027907 Bacteria 1412
233 Ga0268266_11116063 3300028379 Bacteria 763
234 Ga0268265_10000010 3300028380 Bacteria 370129
235 Ga0268265_10171061 3300028380 Bacteria 1857
236 Ga0268264_10000007 3300028381 Bacteria 815790
237 Ga0268264_10248645 3300028381 Bacteria 1651
238 Ga0307517_10012865 3300028786 Bacteria 11430
239 Ga0307517_10032621 3300028786 Bacteria 6012
240 Ga0307515_10000163 3300028794 Bacteria 163159
241 Ga0307515_10164805 3300028794 Bacteria 2240
242 Ga0307515_10234109 3300028794 Bacteria 1622
243 Ga0307511_10000494 3300030521 Bacteria 42578
244 Ga0307511_10000801 3300030521 Bacteria 33509
245 Ga0307511_10120475 3300030521 Bacteria 1625
246 Ga0307512_10001435 3300030522 Bacteria 33817
247 Ga0307512_10058755 3300030522 Bacteria 2992
248 Ga0307513_10034717 3300031456 Bacteria 5654
249 Ga0307513_10050056 3300031456 Bacteria 4520
250 Ga0307513_10123893 3300031456 Bacteria 2545
251 Ga0307513_10161848 3300031456 Bacteria 2129
252 Ga0307509_10020007 3300031507 Bacteria 7610
253 Ga0307509_10039639 3300031507 Bacteria 5130
254 Ga0307408_100082670 3300031548 Bacteria 2404
255 Ga0307508_10014309 3300031616 Bacteria 7236
256 Ga0307508_10052288 3300031616 Bacteria 3629
257 Ga0307508_10099898 3300031616 Bacteria 2496
258 Ga0307514_10023148 3300031649 Bacteria 5044
259 Ga0316576_10056436 3300031727 Bacteria 2868
260 Ga0307516_10015329 3300031730 Bacteria 8066
261 Ga0307405_10589755 3300031731 Bacteria 905
262 Ga0307413_10405346 3300031824 Bacteria 1070
263 Ga0307406_10105694 3300031901 Bacteria 1927
264 Ga0307409_101036879 3300031995 Bacteria 839
265 Ga0307415_100669090 3300032126 Bacteria 933
266 Ga0307507_10005111 3300033179 Bacteria 22037
267 Ga0307507_10025071 3300033179 Bacteria 6476
268 Ga0307510_10017005 3300033180 Bacteria 8581
269 Ga0373945_0055237 3300035116 Bacteria 1470
270 Ga0373955_0062090 3300035172 Bacteria 2066
271 Ga0316584_0131404 3300036712 Bacteria 1870
272 Ga0395899_0040078 3300037312 Bacteria 3504
273 Ga0395899_0323239 3300037312 Bacteria 1039
274 Ga0395899_0370446 3300037312 Bacteria 954
275 Ga0395900_0006221 3300037418 Bacteria 12464
276 Ga0395900_0056291 3300037418 Bacteria 4048
277 Ga0395900_0102383 3300037418 Bacteria 2942
278 Ga0395900_0224038 3300037418 Bacteria 1894
279 Ga0395900_0235542 3300037418 Bacteria 1839
280 Ga0395900_0253799 3300037418 Bacteria 1759
281 Ga0395900_0773571 3300037418 Bacteria 889
282 Ga0395898_0002063 3300037466 Bacteria 25012
283 Ga0395898_0015070 3300037466 Bacteria 7936
284 Ga0395898_0068716 3300037466 Bacteria 3428
285 Ga0395898_0106523 3300037466 Bacteria 2689
286 Ga0395898_0306852 3300037466 Bacteria 1514
287 Ga0395898_0755317 3300037466 Bacteria 914
288 Ga0395905_0008033 3300037471 Bacteria 10426
289 Ga0395905_0075385 3300037471 Bacteria 3162
290 Ga0395905_0128247 3300037471 Bacteria 2386
291 Ga0395905_0214925 3300037471 Bacteria 1801
292 Ga0436364_0034902 3300037853 Bacteria 12619
293 Ga0395901_0008507 3300038443 Bacteria 10370
294 Ga0395901_0009883 3300038443 Bacteria 9672
295 Ga0395901_0011587 3300038443 Bacteria 8934
296 Ga0395901_0021241 3300038443 Bacteria 6649
297 Ga0395901_0137204 3300038443 Bacteria 2570
298 Ga0395901_0190780 3300038443 Bacteria 2149
299 Ga0395901_0439690 3300038443 Bacteria 1335
300 Ga0395901_0510093 3300038443 Bacteria 1223
301 Ga0242420_026583 3300038996 Bacteria 1057
302 Ga0400483_143088 3300039062 Bacteria 1250
303 Ga0436365_0418544 3300039437 Bacteria 5953
304 Ga0436365_1447684 3300039437 Bacteria 34467
305 Ga0436363_0708183 3300039450 Bacteria 1614
306 Ga0436363_0743096 3300039450 Bacteria 1030
307 Ga0436363_0936359 3300039450 Bacteria 1228
308 Ga0436363_1563078 3300039450 Bacteria 742
309 Ga0436362_0942942 3300039453 Bacteria 2294
310 Ga0451837_0199012 3300041494 Bacteria 3502
311 Ga0451837_1576622 3300041494 Bacteria 1113
312 Ga0450892_008350 3300042130 Bacteria 883
313 Ga0450916_004973 3300042530 Bacteria 1520
314 Ga0451577_0039770 3300042876 Bacteria 4225
315 Ga0451577_0607297 3300042876 Bacteria 993
316 Ga0466965_0005651 3300044683 Bacteria 5642
317 Ga0466965_0153501 3300044683 Bacteria 1204
318 Ga0466966_0010361 3300044684 Bacteria 6188
319 Ga0466966_0303688 3300044684 Bacteria 959
320 Ga0466961_0040499 3300044693 Bacteria 2987
321 Ga0466961_0084742 3300044693 Bacteria 2004
322 Ga0466963_0011503 3300044694 Bacteria 5390
323 Ga0466963_0023198 3300044694 Bacteria 3936
324 Ga0466963_0032705 3300044694 Bacteria 3370
325 Ga0466963_0035507 3300044694 Bacteria 3248
326 Ga0466963_0039164 3300044694 Bacteria 3103
327 Ga0466963_0069974 3300044694 Bacteria 2360
328 Ga0466963_0135672 3300044694 Bacteria 1702
329 Ga0466963_0222415 3300044694 Bacteria 1322
330 Ga0466963_0605066 3300044694 Bacteria 774
331 Ga0466964_0015320 3300044706 Bacteria 2917
332 Ga0466971_0003662 3300044719 Bacteria 6572
333 Ga0466971_0036214 3300044719 Bacteria 2213
334 Ga0466971_0056136 3300044719 Bacteria 1776
335 Ga0466968_0029833 3300044735 Bacteria 2257
336 Ga0466968_0032795 3300044735 Bacteria 2162
337 Ga0466968_0147930 3300044735 Bacteria 1078
338 Ga0466970_0168959 3300044765 Bacteria 1211
339 Ga0466970_0259865 3300044765 Bacteria 974
340 Ga0466957_0003743 3300044842 Bacteria 8406
341 Ga0466957_0286027 3300044842 Bacteria 1104
342 Ga0466960_0025585 3300044901 Bacteria 2672
343 Ga0466960_0131085 3300044901 Bacteria 1323
344 Ga0466960_0163557 3300044901 Bacteria 1196
345 Ga0466959_0278242 3300045049 Bacteria 1149
346 Ga0466959_0319021 3300045049 Bacteria 1062
347 Ga0466959_0364863 3300045049 Bacteria 984
348 Ga0466958_0003197 3300045836 Bacteria 8449
349 Ga0466958_0059539 3300045836 Bacteria 2323
350 Ga0466958_0175435 3300045836 Bacteria 1359
351 Ga0466967_0011207 3300045976 Bacteria 6776
352 Ga0466967_0031038 3300045976 Bacteria 4493
353 Ga0466967_0050443 3300045976 Bacteria 3644
354 Ga0466967_0195130 3300045976 Bacteria 1915
355 Ga0466967_0307203 3300045976 Bacteria 1527
356 Ga0466967_0695030 3300045976 Bacteria 1007
357 Ga0466967_0723810 3300045976 Bacteria 986
358 Ga0495592_0001429 3300046454 Bacteria 16573
359 Ga0495592_0011840 3300046454 Bacteria 6607
360 Ga0495603_0099638 3300046455 Bacteria 1697
361 Ga0495629_0100871 3300046459 Bacteria 2014
362 Ga0495629_0153332 3300046459 Bacteria 1601
363 Ga0495629_0178483 3300046459 Bacteria 1472
364 Ga0495638_0016925 3300046460 Bacteria 4874
365 Ga0495638_0458505 3300046460 Bacteria 649
366 Ga0495641_0036246 3300046461 Bacteria 2319
367 Ga0495641_0050692 3300046461 Bacteria 1897
368 Ga0495641_0161695 3300046461 Bacteria 1001
369 Ga0495651_0003189 3300046462 Bacteria 12609
370 Ga0495651_0020082 3300046462 Bacteria 5185
371 Ga0495651_0047909 3300046462 Bacteria 3301
372 Ga0495653_0010780 3300046463 Bacteria 7484
373 Ga0495653_0265686 3300046463 Bacteria 1132
374 Ga0495582_0054187 3300046473 Bacteria 2212
375 Ga0495662_0006967 3300046476 Bacteria 5617
376 Ga0495662_0024405 3300046476 Bacteria 2917
377 Ga0495664_0000570 3300046477 Bacteria 18511
378 Ga0495664_0003276 3300046477 Bacteria 8801
379 Ga0495584_0199194 3300046491 Bacteria 1018
380 Ga0495608_0033506 3300046511 Bacteria 3470
381 Ga0495608_0035457 3300046511 Bacteria 3365
382 Ga0495618_0144431 3300046514 Bacteria 1521
383 Ga0495628_0013118 3300046516 Bacteria 6977
384 Ga0495628_0030865 3300046516 Bacteria 4337
385 Ga0495628_0082218 3300046516 Bacteria 2501
386 Ga0495630_0001009 3300046517 Bacteria 19504
387 Ga0495630_0173220 3300046517 Bacteria 1644
388 Ga0495630_0176522 3300046517 Bacteria 1628
389 Ga0495632_0078164 3300046519 Bacteria 1581
390 Ga0495643_0002747 3300046522 Bacteria 13517
391 Ga0495666_0001180 3300046526 Bacteria 12574
392 Ga0495652_0174380 3300046529 Bacteria 1656
393 Ga0495652_0363247 3300046529 Bacteria 1034
394 Ga0495665_0124723 3300046531 Bacteria 1348
395 Ga0495640_0010017 3300046533 Bacteria 7349
396 Ga0495640_0010089 3300046533 Bacteria 7321
397 Ga0495640_0025254 3300046533 Bacteria 4312
398 Ga0495586_0085245 3300046535 Bacteria 1740
399 Ga0495587_0020918 3300046536 Bacteria 4036
400 Ga0495587_0022547 3300046536 Bacteria 3876
401 Ga0495645_0009902 3300046543 Bacteria 6670
402 Ga0495645_0032965 3300046543 Bacteria 3778
403 Ga0495622_0086664 3300046557 Bacteria 1440
404 Ga0495667_0011057 3300046559 Bacteria 6103
405 Ga0495667_0115710 3300046559 Bacteria 1732
406 Ga0495656_0053442 3300046615 Bacteria 1736
407 Ga0495634_0002883 3300046642 Bacteria 14108
408 Ga0495634_0015084 3300046642 Bacteria 5554
409 Ga0495634_0029640 3300046642 Bacteria 3787
410 Ga0495635_0004228 3300046663 Bacteria 9957
411 Ga0495635_0038686 3300046663 Bacteria 3301
412 Ga0495588_0038469 3300046674 Bacteria 2433
413 Ga0495588_0069978 3300046674 Bacteria 1824
414 Ga0495657_0011045 3300046675 Bacteria 6771
415 Ga0495657_0033976 3300046675 Bacteria 3545
416 Ga0495657_0175477 3300046675 Bacteria 1318
417 Ga0495657_0265421 3300046675 Bacteria 1030
418 Ga0495599_0079066 3300046678 Bacteria 2053
419 Ga0495599_0170704 3300046678 Bacteria 1342
420 Ga0495599_0461554 3300046678 Bacteria 751
421 Ga0495623_0024618 3300046679 Bacteria 3876
422 Ga0495646_0002533 3300046680 Bacteria 11230
423 Ga0495646_0004122 3300046680 Bacteria 9123
424 Ga0495646_0193009 3300046680 Bacteria 1112
425 Ga0495658_0069007 3300046683 Bacteria 2048
426 Ga0495658_0461387 3300046683 Bacteria 812
427 Ga0495613_0001149 3300046689 Bacteria 20199
428 Ga0495613_0001262 3300046689 Bacteria 19287
429 Ga0495613_0115036 3300046689 Bacteria 1936
430 Ga0495624_0090309 3300046690 Bacteria 1890
431 Ga0495670_0022785 3300046691 Bacteria 3093
432 Ga0495671_0006048 3300046692 Bacteria 7034
433 Ga0495600_0025515 3300046809 Bacteria 3809
434 Ga0495600_0046346 3300046809 Bacteria 2836
435 Ga0495600_0203305 3300046809 Bacteria 1271
436 Ga0495660_0061919 3300046810 Bacteria 2007
437 Ga0495581_0029246 3300047315 Bacteria 3194
438 Ga0495604_0001320 3300047317 Bacteria 20245
439 Ga0495604_0003274 3300047317 Bacteria 12943
440 Ga0495604_0070049 3300047317 Bacteria 2657
441 Ga0495636_0008797 3300047318 Bacteria 3979
442 Ga0495674_0000568 3300047319 Bacteria 34477
443 Ga0495674_0017715 3300047319 Bacteria 6631
444 Ga0495676_0011223 3300047321 Bacteria 8099
445 Ga0495676_0117228 3300047321 Bacteria 1943
446 Ga0495680_0000393 3300047322 Bacteria 48867
447 Ga0495683_0230133 3300047323 Bacteria 822
448 Ga0495687_003574 3300047443 Bacteria 11151
449 Ga0495687_019625 3300047443 Bacteria 3311
450 Ga0495685_002401 3300047447 Bacteria 5871
451 Ga0495681_0003284 3300047470 Bacteria 11278
452 Ga0495684_0014945 3300047471 Bacteria 5979
453 Ga0495684_0018965 3300047471 Bacteria 5296
454 Ga0495684_0022203 3300047471 Bacteria 4886
455 Ga0495686_0117098 3300047472 Bacteria 1592
456 Ga0495686_0287729 3300047472 Bacteria 911
457 Ga0495593_0008831 3300047673 Bacteria 5850
458 Ga0495593_0031569 3300047673 Bacteria 2893
459 Ga0495602_0049695 3300048088 Bacteria 3754
460 Ga0495614_0017478 3300048089 Bacteria 3115
461 Ga0496100_0000004 3300048903 Bacteria 321778
462 Ga0496100_0010810 3300048903 Bacteria 5179
463 Ga0496100_0098453 3300048903 Bacteria 2010
464 Ga0496101_0000007 3300048904 Bacteria 321778
465 Ga0496101_0020411 3300048904 Bacteria 4535
466 Ga0496101_0080653 3300048904 Bacteria 2404
467 Ga0496102_0000060 3300048905 Bacteria 167774
468 Ga0496102_0015718 3300048905 Bacteria 6594
469 Ga0496102_0139345 3300048905 Bacteria 2274
470 Ga0496103_0000500 3300048906 Bacteria 32364
471 Ga0496103_0003635 3300048906 Bacteria 9395
472 Ga0496104_0537280 3300048907 Bacteria 1080
473 Ga0496105_0011383 3300048908 Bacteria 7027
474 Ga0496105_0529556 3300048908 Bacteria 922
475 Ga0496106_0000004 3300048909 Bacteria 279896
476 Ga0496106_0008284 3300048909 Bacteria 7692
477 Ga0496106_0355496 3300048909 Bacteria 1177
478 Ga0496107_0000001 3300048910 Bacteria 321778
479 Ga0496107_0083153 3300048910 Bacteria 2334
480 Ga0496107_0283088 3300048910 Bacteria 1234
481 Ga0496108_0032225 3300048911 Bacteria 4352
482 Ga0496108_0330652 3300048911 Bacteria 1329
483 Ga0496110_0174763 3300048913 Bacteria 1949
484 Ga0496110_0844618 3300048913 Bacteria 821
485 Ga0496111_0020922 3300048914 Bacteria 4561
486 Ga0496111_0064521 3300048914 Bacteria 2657
487 Ga0496111_0298048 3300048914 Bacteria 1195
488 Ga0496111_0688734 3300048914 Bacteria 744
489 Ga0496112_0037377 3300048915 Bacteria 4739
490 Ga0496112_1017341 3300048915 Bacteria 748
491 Ga0496113_0006265 3300048916 Bacteria 7518
492 Ga0496113_0089085 3300048916 Bacteria 2375
493 Ga0496114_0002542 3300048917 Bacteria 13922
494 Ga0496114_0241857 3300048917 Bacteria 1587
495 Ga0496115_0000815 3300048918 Bacteria 22850
496 Ga0496115_0270508 3300048918 Bacteria 1396
497 Ga0496116_0046069 3300048919 Bacteria 2946
498 Ga0496117_0002026 3300048920 Bacteria 26844
499 Ga0496118_0001179 3300048921 Bacteria 40343
500 Ga0496119_0016754 3300048922 Bacteria 5554
501 Ga0496120_0004413 3300048923 Bacteria 11807
502 Ga0496121_0085248 3300048924 Bacteria 2487
503 Ga0496121_0181465 3300048924 Bacteria 1519
504 Ga0496124_0088633 3300048927 Bacteria 2528
505 Ga0496125_0003753 3300048928 Bacteria 18091
506 Ga0496125_0012912 3300048928 Bacteria 8246
507 Ga0496126_0008248 3300048929 Bacteria 11251
508 Ga0501031_0073698 3300049568 Bacteria 2223
509 Ga0501031_0389206 3300049568 Bacteria 902
510 Ga0501032_0031810 3300049569 Bacteria 3617
511 Ga0501033_0102558 3300049570 Bacteria 2087
512 Ga0501033_0210416 3300049570 Bacteria 1387
513 Ga0501034_0326431 3300049571 Bacteria 1467
514 Ga0501036_0001457 3300049572 Bacteria 18189
515 Ga0501036_0017262 3300049572 Bacteria 6032
516 Ga0501036_0045229 3300049572 Bacteria 3730
517 Ga0501036_0064238 3300049572 Bacteria 3107
518 Ga0501036_0298324 3300049572 Bacteria 1348
519 Ga0501036_0352087 3300049572 Bacteria 1230
520 Ga0501037_0049852 3300049573 Bacteria 3065
521 Ga0501038_0055443 3300049574 Bacteria 3404
522 Ga0501039_0003396 3300049575 Bacteria 11900
523 Ga0501039_0003643 3300049575 Bacteria 11549
524 Ga0501039_0101275 3300049575 Bacteria 2248
525 Ga0501040_0000515 3300049576 Bacteria 23152
526 Ga0501040_0006488 3300049576 Bacteria 7598
527 Ga0501040_0048027 3300049576 Bacteria 2916
528 Ga0501040_0056481 3300049576 Bacteria 2694
529 Ga0501040_0130371 3300049576 Bacteria 1768
530 Ga0501041_0017542 3300049577 Bacteria 4259
531 Ga0501041_0023411 3300049577 Bacteria 3704
532 Ga0501041_0025760 3300049577 Bacteria 3535
533 Ga0501041_0154381 3300049577 Bacteria 1434
534 Ga0501042_0019543 3300049578 Bacteria 4706
535 Ga0501042_0039878 3300049578 Bacteria 3338
536 Ga0501042_0096001 3300049578 Bacteria 2130
537 Ga0501042_0112336 3300049578 Bacteria 1962
538 Ga0501043_0170030 3300049579 Bacteria 1700
539 Ga0501046_0019768 3300049580 Bacteria 5580
540 Ga0501046_0103554 3300049580 Bacteria 2181
541 Ga0501046_0137248 3300049580 Bacteria 1852
542 Ga0501046_0501763 3300049580 Bacteria 869
543 Ga0501048_0009811 3300049582 Bacteria 7178
544 Ga0501048_0109180 3300049582 Bacteria 1953
545 Ga0501048_0144990 3300049582 Bacteria 1679
546 Ga0501067_0001773 3300049583 Bacteria 11851
547 Ga0501068_0275327 3300049584 Bacteria 1075
548 Ga0501068_0312935 3300049584 Bacteria 1006
549 Ga0501069_0025346 3300049585 Bacteria 3240
550 Ga0501069_0189605 3300049585 Bacteria 1189
551 Ga0501070_0014832 3300049586 Bacteria 6556
552 Ga0501071_0001164 3300049587 Bacteria 14751
553 Ga0501071_0045033 3300049587 Bacteria 3166
554 Ga0501071_0066901 3300049587 Bacteria 2612
555 Ga0501071_0127405 3300049587 Bacteria 1890
556 Ga0501072_0000894 3300049588 Bacteria 21861
557 Ga0501072_0003415 3300049588 Bacteria 11964
558 Ga0501072_0025305 3300049588 Bacteria 4623
559 Ga0501072_0055650 3300049588 Bacteria 3117
560 Ga0501073_0002737 3300049589 Bacteria 13216
561 Ga0501073_0348937 3300049589 Bacteria 1022
562 Ga0501074_0009393 3300049590 Bacteria 7108
563 Ga0501074_0030239 3300049590 Bacteria 3925
564 Ga0501074_0112760 3300049590 Bacteria 1946
565 Ga0501074_0121445 3300049590 Bacteria 1868
566 Ga0501075_0003952 3300049591 Bacteria 9988
567 Ga0501075_0004349 3300049591 Bacteria 9582
568 Ga0501075_0130354 3300049591 Bacteria 1916
569 Ga0501075_0138435 3300049591 Bacteria 1854
570 Ga0501075_0372971 3300049591 Bacteria 1088
571 Ga0501076_0003103 3300049592 Bacteria 11568
572 Ga0501076_0007818 3300049592 Bacteria 7792
573 Ga0501076_0029116 3300049592 Bacteria 4293
574 Ga0501076_0082896 3300049592 Bacteria 2574
575 Ga0501076_0085597 3300049592 Bacteria 2533
576 Ga0501076_0086792 3300049592 Bacteria 2515
577 Ga0501076_0472224 3300049592 Bacteria 1033
578 Ga0501077_0027075 3300049593 Bacteria 3640
579 Ga0501077_0030118 3300049593 Bacteria 3452
580 Ga0501077_0078121 3300049593 Bacteria 2097
581 Ga0501077_0309307 3300049593 Bacteria 1007
582 Ga0501079_0002701 3300049741 Bacteria 12919
583 Ga0501079_0153559 3300049741 Bacteria 1794
584 Ga0501079_0276149 3300049741 Bacteria 1314
585 Ga0501079_0387385 3300049741 Bacteria 1096
586 Ga0501079_0406984 3300049741 Bacteria 1067
587 Ga0501080_0174268 3300049742 Bacteria 1982
588 Ga0501080_0322871 3300049742 Bacteria 1397
589 Ga0501081_0016708 3300049743 Bacteria 4852
590 Ga0501081_0032249 3300049743 Bacteria 3553
591 Ga0501081_0313777 3300049743 Bacteria 1151
592 Ga0501083_0015377 3300049744 Bacteria 5360
593 Ga0501035_0020722 3300049822 Bacteria 6042
594 Ga0501035_0055381 3300049822 Bacteria 3541
595 Ga0501035_0056570 3300049822 Bacteria 3499
596 Ga0501035_0309722 3300049822 Bacteria 1329
597 Ga0501044_0332749 3300049823 Bacteria 1441
598 Ga0501045_0004075 3300049824 Bacteria 10084
599 Ga0501045_0116512 3300049824 Bacteria 1982
600 Ga0501045_0139177 3300049824 Bacteria 1805
601 nmdc:mga0yw44_140119_c1 3300050492 Bacteria 1571
602 nmdc:mga0yw44_51785_c1 3300050492 Bacteria 2487
603 nmdc:mga0yw44_88951_c1 3300050492 Bacteria 1948
604 nmdc:mga05p37_10310_c1 3300050507 Bacteria 11097
605 nmdc:mga05p37_1215725_c1 3300050507 Bacteria 777
606 nmdc:mga05p37_130523_c1 3300050507 Bacteria 3083
607 nmdc:mga05p37_142939_c1 3300050507 Bacteria 2931
608 nmdc:mga05p37_147460_c1 3300050507 Bacteria 2880
609 nmdc:mga05p37_21214_c1 3300050507 Bacteria 7864
610 nmdc:mga05p37_21516_c1 3300050507 Bacteria 7812
611 nmdc:mga05p37_482142_c1 3300050507 Bacteria 1428
612 nmdc:mga05p37_48686_c1 3300050507 Bacteria 5212
613 nmdc:mga09592_169501_c1 3300050508 Bacteria 1888
614 nmdc:mga0qj67_91666_c1 3300050509 Bacteria 2443
615 nmdc:mga06r32_13499_c1 3300050510 Bacteria 7403
616 nmdc:mga06r32_330200_c1 3300050510 Bacteria 1510
617 nmdc:mga06r32_438984_c1 3300050510 Bacteria 1286
618 nmdc:mga06r32_79753_c1 3300050510 Bacteria 3184
619 nmdc:mga08y16_45205_c1 3300050511 Bacteria 4614
620 nmdc:mga08y16_80546_c1 3300050511 Bacteria 3395
621 nmdc:mga08y16_953155_c1 3300050511 Bacteria 841
622 nmdc:mga0n895_320921_c1 3300050512 Bacteria 1570
623 nmdc:mga0n895_56427_c1 3300050512 Bacteria 3869
624 nmdc:mga0n895_57126_c1 3300050512 Bacteria 3846
625 nmdc:mga0n895_63695_c1 3300050512 Bacteria 3646
626 nmdc:mga0n895_743_c1 3300050512 Bacteria 23050
627 nmdc:mga0n895_9556_c1 3300050512 Bacteria 8493
628 nmdc:mga0rr50_135216_c1 3300050513 Bacteria 1978
629 nmdc:mga0rr50_135655_c1 3300050513 Bacteria 1975
630 nmdc:mga0rr50_333702_c1 3300050513 Bacteria 1273
631 nmdc:mga0rr50_3537_c1 3300050513 Bacteria 9016
632 nmdc:mga0rr50_43998_c1 3300050513 Bacteria 3272
633 nmdc:mga08x19_3507_c1 3300050514 Bacteria 9335
634 nmdc:mga08x19_636081_c1 3300050514 Bacteria 756
635 nmdc:mga0a205_102371_c1 3300050515 Bacteria 2762
636 nmdc:mga0a205_115185_c1 3300050515 Bacteria 2587
637 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
638 nmdc:mga0a205_20197_c1 3300050515 Bacteria 6284
639 nmdc:mga0a205_22022_c1 3300050515 Bacteria 2198
640 nmdc:mga0a205_32312_c1 3300050515 Bacteria 5019
641 nmdc:mga0a205_33485_c1 3300050515 Bacteria 4926
642 nmdc:mga0a205_68679_c1 3300050515 Bacteria 3422
643 Ga0495601_0087095 3300053077 Bacteria 2008
644 Ga0495655_0113043 3300053083 Bacteria 818
645 Ga0495619_0040632 3300053085 Bacteria 3040
646 Ga0495619_0180766 3300053085 Bacteria 1459
647 Ga0500578_0012444 3300053086 Bacteria 5489
648 Ga0500640_023966 3300053095 Bacteria 2647
649 Ga0500654_058339 3300053099 Bacteria 2002
650 Ga0500660_039633 3300053100 Bacteria 2405
651 Ga0500553_136757 3300053101 Bacteria 975
652 Ga0500560_000468 3300053107 Bacteria 5622
653 Ga0500569_001500 3300053109 Bacteria 4422
654 Ga0500572_088713 3300053111 Bacteria 977
655 Ga0500614_004794 3300053123 Bacteria 2845
656 Ga0500614_018592 3300053123 Bacteria 1583
657 Ga0500628_005693 3300053129 Bacteria 2089
658 Ga0500652_007135 3300053131 Bacteria 3639
659 Ga0500658_0033416 3300053134 Bacteria 2022
660 Ga0500559_0165501 3300053136 Bacteria 1040
661 Ga0500561_0000775 3300053137 Bacteria 5069
662 Ga0500573_0114554 3300053140 Bacteria 1506
663 Ga0500577_0068266 3300053142 Bacteria 1388
664 Ga0500588_0126179 3300053146 Bacteria 907
665 Ga0500600_0001718 3300053149 Bacteria 11846
666 Ga0500603_036123 3300053150 Bacteria 1299
667 Ga0500616_0106578 3300053153 Bacteria 1361
668 Ga0500624_006191 3300053157 Bacteria 1613
669 Ga0500633_0025426 3300053160 Bacteria 1851
670 Ga0500634_0001300 3300053161 Bacteria 9512
671 Ga0500656_001260 3300053732 Bacteria 2149
672 Ga0501084_0004385 3300054114 Bacteria 11502
673 Ga0501084_0029398 3300054114 Bacteria 4597
674 Ga0501084_0081060 3300054114 Bacteria 2721
675 Ga0501084_0660664 3300054114 Bacteria 882
676 Ga0501082_0070632 3300060353 Bacteria 3006
677 Ga0501082_0105889 3300060353 Bacteria 2433
678 Ga0501082_0136813 3300060353 Bacteria 2125
679 Ga0501082_0172521 3300060353 Bacteria 1880
680 Ga0501082_0589463 3300060353 Bacteria 973
681 Ga0466962_0001045 3300061719 Bacteria 12703
682 Ga0466962_0004738 3300061719 Bacteria 6537
683 Ga0466962_0070878 3300061719 Bacteria 1665
684 Ga0466962_0118825 3300061719 Bacteria 1275
685 Ga0530510_0005561 3300061734 Bacteria 8734
686 Ga0530510_0009858 3300061734 Bacteria 6701
687 Ga0530510_0020967 3300061734 Bacteria 4647
688 Ga0530510_0035126 3300061734 Bacteria 3612
689 Ga0530510_0184960 3300061734 Bacteria 1546
690 2793975290 2791355406 Bacteria 11364898
691 2809590728 2808606522 Bacteria 9488490
692 2867347304 2867346516 Bacteria 7608576
693 2899368960 2899359706 Bacteria 10940472
694 8047719701 8047710418 Bacteria 11023148
695 8047900553 8047893842 Bacteria 11723082
696 8048358349 8048356638 Bacteria 11044339
697 8048377493 8048369669 Bacteria 11666822
698 8048386591 8048379754 Bacteria 11877923
699 Ga0501072_0023500
700 JGI25406J46586_10016300
701 Ga0065712_10134679
702 Ga0070658_10167205
703 Ga0070683_100001023
704 Ga0070683_100426284
705 Ga0070690_100220633
706 Ga0068869_100055969
707 Ga0070680_100167508
708 Ga0070682_100124198
709 Ga0068868_100030488
710 Ga0070668_100326753
711 Ga0070669_100120823
712 Ga0070669_100475705
713 Ga0070674_100280002
714 Ga0070673_100579406
715 Ga0070659_100145991
716 Ga0070667_100000223
717 Ga0070709_10263492
718 Ga0070714_100177698
719 Ga0070713_100873452
720 Ga0070701_10072885
721 Ga0070705_100096968
722 Ga0070700_100168651
723 Ga0070694_100018986
724 Ga0070708_100364018
725 Ga0070663_100406052
726 Ga0070663_100497112
727 Ga0070678_100088450
728 Ga0070678_100174377
729 Ga0070662_100279092
730 Ga0070681_10039140
731 Ga0068867_100158097
732 Ga0070698_100000518
733 Ga0070698_100011475
734 Ga0070698_100128964
735 Ga0070699_100003005
736 Ga0070699_100756683
737 Ga0070679_100150861
738 Ga0070684_100150171
739 Ga0070684_100452029
740 Ga0070684_100631378
741 Ga0070697_100110630
742 Ga0070697_100274165
743 Ga0070686_100002743
744 Ga0070686_100070463
745 Ga0070696_100081602
746 Ga0070665_100005604
747 Ga0070665_100309521
748 Ga0070704_100077141
749 Ga0070704_100110388
750 Ga0070664_100475507
751 Ga0068856_100197319
752 Ga0068856_100913195
753 Ga0070702_100308501
754 Ga0068852_100068387
755 Ga0068852_100920085
756 Ga0068859_100000174
757 Ga0068859_100254743
758 Ga0068859_100308206
759 Ga0068859_100568932
760 Ga0068864_100333323
761 Ga0068861_100458385
762 Ga0068870_10069329
763 Ga0068863_100032761
764 Ga0068863_100848734
765 Ga0068858_100003020
766 Ga0068858_100765347
767 Ga0068860_100000044
768 Ga0068862_100000003
769 Ga0068862_100188980
770 Ga0081455_10048160
771 Ga0081455_10052144
772 Ga0081455_10085651
773 Ga0081455_10087914
774 Ga0081455_10217123
775 Ga0081538_10000058
776 Ga0081538_10000068
777 Ga0081538_10009031
778 Ga0081538_10045943
779 Ga0081538_10058172
780 Ga0081538_10089618
781 Ga0081540_1008210
782 Ga0081540_1123603
783 Ga0081539_10000062
784 Ga0081539_10003738
785 Ga0081539_10076839
786 Ga0075365_10001599
787 Ga0075365_10004931
788 Ga0075364_10025626
789 Ga0075432_10001916
790 Ga0070715_10050541
791 Ga0070716_100019767
792 Ga0070716_100026506
793 Ga0070712_100004298
794 Ga0070712_100144546
795 Ga0070712_100252379
796 Ga0075427_10010851
797 Ga0097621_100254557
798 Ga0075428_100166500
799 Ga0075428_100203234
800 Ga0075430_100017770
801 Ga0075431_100035185
802 Ga0075431_100091392
803 Ga0075431_100137307
804 Ga0075431_100245311
805 Ga0075433_10000057
806 Ga0075433_10000692
807 Ga0075433_10000817
808 Ga0075433_10060813
809 Ga0075433_10073546
810 Ga0075433_10677539
811 Ga0075434_100000070
812 Ga0075434_100001271
813 Ga0075434_100016441
814 Ga0075434_100041745
815 Ga0075434_100227155
816 Ga0075434_100313659
817 Ga0075429_100000551
818 Ga0075429_100269171
819 Ga0075436_100009326
820 Ga0075436_100274265
821 Ga0097620_100000174
822 Ga0097620_100254750
823 Ga0097620_100308234
824 Ga0097620_100568864
825 Ga0075435_100003936
826 Ga0075435_100128729
827 Ga0075435_100147833
828 Ga0075435_100161829
829 Ga0105240_10003784
830 Ga0111539_10006167
831 Ga0111539_10043947
832 Ga0111539_10194210
833 Ga0111539_10960808
834 Ga0111539_11308523
835 Ga0105245_10256364
836 Ga0105245_10473949
837 Ga0105247_10000006
838 Ga0105247_10564892
839 Ga0105247_10705981
840 Ga0114129_10003427
841 Ga0114129_10020642
842 Ga0114129_10039391
843 Ga0114129_10056028
844 Ga0114129_10162497
845 Ga0114129_10177752
846 Ga0114129_10191292
847 Ga0114129_10463333
848 Ga0114129_10621532
849 Ga0105248_10000042
850 Ga0105237_10003213
851 Ga0105238_10139425
852 Ga0105249_10000008
853 Ga0105249_10042148
854 Ga0105239_10002098
855 Ga0105239_10264408
856 Ga0105239_10686263
857 Ga0105246_10698399
858 Ga0105246_10926369
859 Ga0157373_10589954
860 Ga0157369_10652771
861 Ga0157374_10911282
862 Ga0157378_10115802
863 Ga0163162_10075007
864 Ga0163162_10748547
865 Ga0157372_10102699
866 Ga0157372_10493931
867 Ga0157375_10085668
868 Ga0157375_10607816
869 Ga0163163_10026112
870 Ga0163163_10539231
871 Ga0157377_10281418
872 Ga0157379_10064509
873 Ga0157379_10091350
874 Ga0157379_10098519
875 Ga0157376_10807614
876 Ga0213874_10149487
877 Ga0213876_10002484
878 Ga0213876_10008534
879 Ga0213875_10010077
880 Ga0224712_10151098
881 Ga0207710_10000025
882 Ga0207688_10026271
883 Ga0207688_10032083
884 Ga0207685_10017601
885 Ga0207699_10068340
886 Ga0207705_10148417
887 Ga0207707_10080111
888 Ga0207695_10021148
889 Ga0207671_10254159
890 Ga0207693_10003509
891 Ga0207663_10020210
892 Ga0207660_10089411
893 Ga0207662_10395429
894 Ga0207657_10471073
895 Ga0207649_10189872
896 Ga0207652_10063291
897 Ga0207646_10029718
898 Ga0207681_10003522
899 Ga0207681_10039925
900 Ga0207694_10038810
901 Ga0207700_10536007
902 Ga0207690_10140429
903 Ga0207706_10755230
904 Ga0207709_10337115
905 Ga0207670_10785840
906 Ga0207665_10002519
907 Ga0207691_10121496
908 Ga0207711_10000697
909 Ga0207689_10211621
910 Ga0207661_10000165
911 Ga0207661_10318622
912 Ga0207712_10000011
913 Ga0207658_10000307
914 Ga0207677_10349080
915 Ga0207703_10006939
916 Ga0207703_10784658
917 Ga0207702_10086087
918 Ga0207641_10005680
919 Ga0207641_10174683
920 Ga0207641_10489469
921 Ga0207674_10342550
922 Ga0207675_100337725
923 Ga0207675_100474986
924 Ga0207683_10094478
925 Ga0207683_10135838
926 Ga0207683_10456413
927 Ga0207698_11124577
928 Ga0207428_10004233
929 Ga0207428_10064722
930 Ga0207428_10222926
931 Ga0268266_11116063
932 Ga0268265_10000010
933 Ga0268265_10171061
934 Ga0268264_10000007
935 Ga0268264_10248645
936 Ga0307517_10012865
937 Ga0307517_10032621
938 Ga0307515_10000163
939 Ga0307515_10164805
940 Ga0307515_10234109
941 Ga0307511_10000494
942 Ga0307511_10000801
943 Ga0307511_10120475
944 Ga0307512_10001435
945 Ga0307512_10058755
946 Ga0307513_10034717
947 Ga0307513_10050056
948 Ga0307513_10123893
949 Ga0307513_10161848
950 Ga0307509_10020007
951 Ga0307509_10039639
952 Ga0307408_100082670
953 Ga0307508_10014309
954 Ga0307508_10052288
955 Ga0307508_10099898
956 Ga0307514_10023148
957 Ga0316576_10056436
958 Ga0307516_10015329
959 Ga0307405_10589755
960 Ga0307413_10405346
961 Ga0307406_10105694
962 Ga0307409_101036879
963 Ga0307415_100669090
964 Ga0307507_10005111
965 Ga0307507_10025071
966 Ga0307510_10017005
967 Ga0373945_0055237
968 Ga0373955_0062090
969 Ga0316584_0131404
970 Ga0395899_0040078
971 Ga0395899_0323239
972 Ga0395899_0370446
973 Ga0395900_0006221
974 Ga0395900_0056291
975 Ga0395900_0102383
976 Ga0395900_0224038
977 Ga0395900_0235542
978 Ga0395900_0253799
979 Ga0395900_0773571
980 Ga0395898_0002063
981 Ga0395898_0015070
982 Ga0395898_0068716
983 Ga0395898_0106523
984 Ga0395898_0306852
985 Ga0395898_0755317
986 Ga0395905_0008033
987 Ga0395905_0075385
988 Ga0395905_0128247
989 Ga0395905_0214925
990 Ga0436364_0034902
991 Ga0395901_0008507
992 Ga0395901_0009883
993 Ga0395901_0011587
994 Ga0395901_0021241
995 Ga0395901_0137204
996 Ga0395901_0190780
997 Ga0395901_0439690
998 Ga0395901_0510093
999 Ga0242420_026583
1000 Ga0400483_143088
1001 Ga0436365_0418544
1002 Ga0436365_1447684
1003 Ga0436363_0708183
1004 Ga0436363_0743096
1005 Ga0436363_0936359
1006 Ga0436363_1563078
1007 Ga0436362_0942942
1008 Ga0451837_0199012
1009 Ga0451837_1576622
1010 Ga0450892_008350
1011 Ga0450916_004973
1012 Ga0451577_0039770
1013 Ga0451577_0607297
1014 Ga0466965_0005651
1015 Ga0466965_0153501
1016 Ga0466966_0010361
1017 Ga0466966_0303688
1018 Ga0466961_0040499
1019 Ga0466961_0084742
1020 Ga0466963_0011503
1021 Ga0466963_0023198
1022 Ga0466963_0032705
1023 Ga0466963_0035507
1024 Ga0466963_0039164
1025 Ga0466963_0069974
1026 Ga0466963_0135672
1027 Ga0466963_0222415
1028 Ga0466963_0605066
1029 Ga0466964_0015320
1030 Ga0466971_0003662
1031 Ga0466971_0036214
1032 Ga0466971_0056136
1033 Ga0466968_0029833
1034 Ga0466968_0032795
1035 Ga0466968_0147930
1036 Ga0466970_0168959
1037 Ga0466970_0259865
1038 Ga0466957_0003743
1039 Ga0466957_0286027
1040 Ga0466960_0025585
1041 Ga0466960_0131085
1042 Ga0466960_0163557
1043 Ga0466959_0278242
1044 Ga0466959_0319021
1045 Ga0466959_0364863
1046 Ga0466958_0003197
1047 Ga0466958_0059539
1048 Ga0466958_0175435
1049 Ga0466967_0011207
1050 Ga0466967_0031038
1051 Ga0466967_0050443
1052 Ga0466967_0195130
1053 Ga0466967_0307203
1054 Ga0466967_0695030
1055 Ga0466967_0723810
1056 Ga0495592_0001429
1057 Ga0495592_0011840
1058 Ga0495603_0099638
1059 Ga0495629_0100871
1060 Ga0495629_0153332
1061 Ga0495629_0178483
1062 Ga0495638_0016925
1063 Ga0495638_0458505
1064 Ga0495641_0036246
1065 Ga0495641_0050692
1066 Ga0495641_0161695
1067 Ga0495651_0003189
1068 Ga0495651_0020082
1069 Ga0495651_0047909
1070 Ga0495653_0010780
1071 Ga0495653_0265686
1072 Ga0495582_0054187
1073 Ga0495662_0006967
1074 Ga0495662_0024405
1075 Ga0495664_0000570
1076 Ga0495664_0003276
1077 Ga0495584_0199194
1078 Ga0495608_0033506
1079 Ga0495608_0035457
1080 Ga0495618_0144431
1081 Ga0495628_0013118
1082 Ga0495628_0030865
1083 Ga0495628_0082218
1084 Ga0495630_0001009
1085 Ga0495630_0173220
1086 Ga0495630_0176522
1087 Ga0495632_0078164
1088 Ga0495643_0002747
1089 Ga0495666_0001180
1090 Ga0495652_0174380
1091 Ga0495652_0363247
1092 Ga0495665_0124723
1093 Ga0495640_0010017
1094 Ga0495640_0010089
1095 Ga0495640_0025254
1096 Ga0495586_0085245
1097 Ga0495587_0020918
1098 Ga0495587_0022547
1099 Ga0495645_0009902
1100 Ga0495645_0032965
1101 Ga0495622_0086664
1102 Ga0495667_0011057
1103 Ga0495667_0115710
1104 Ga0495656_0053442
1105 Ga0495634_0002883
1106 Ga0495634_0015084
1107 Ga0495634_0029640
1108 Ga0495635_0004228
1109 Ga0495635_0038686
1110 Ga0495588_0038469
1111 Ga0495588_0069978
1112 Ga0495657_0011045
1113 Ga0495657_0033976
1114 Ga0495657_0175477
1115 Ga0495657_0265421
1116 Ga0495599_0079066
1117 Ga0495599_0170704
1118 Ga0495599_0461554
1119 Ga0495623_0024618
1120 Ga0495646_0002533
1121 Ga0495646_0004122
1122 Ga0495646_0193009
1123 Ga0495658_0069007
1124 Ga0495658_0461387
1125 Ga0495613_0001149
1126 Ga0495613_0001262
1127 Ga0495613_0115036
1128 Ga0495624_0090309
1129 Ga0495670_0022785
1130 Ga0495671_0006048
1131 Ga0495600_0025515
1132 Ga0495600_0046346
1133 Ga0495600_0203305
1134 Ga0495660_0061919
1135 Ga0495581_0029246
1136 Ga0495604_0001320
1137 Ga0495604_0003274
1138 Ga0495604_0070049
1139 Ga0495636_0008797
1140 Ga0495674_0000568
1141 Ga0495674_0017715
1142 Ga0495676_0011223
1143 Ga0495676_0117228
1144 Ga0495680_0000393
1145 Ga0495683_0230133
1146 Ga0495687_003574
1147 Ga0495687_019625
1148 Ga0495685_002401
1149 Ga0495681_0003284
1150 Ga0495684_0014945
1151 Ga0495684_0018965
1152 Ga0495684_0022203
1153 Ga0495686_0117098
1154 Ga0495686_0287729
1155 Ga0495593_0008831
1156 Ga0495593_0031569
1157 Ga0495602_0049695
1158 Ga0495614_0017478
1159 Ga0496100_0000004
1160 Ga0496100_0010810
1161 Ga0496100_0098453
1162 Ga0496101_0000007
1163 Ga0496101_0020411
1164 Ga0496101_0080653
1165 Ga0496102_0000060
1166 Ga0496102_0015718
1167 Ga0496102_0139345
1168 Ga0496103_0000500
1169 Ga0496103_0003635
1170 Ga0496104_0537280
1171 Ga0496105_0011383
1172 Ga0496105_0529556
1173 Ga0496106_0000004
1174 Ga0496106_0008284
1175 Ga0496106_0355496
1176 Ga0496107_0000001
1177 Ga0496107_0083153
1178 Ga0496107_0283088
1179 Ga0496108_0032225
1180 Ga0496108_0330652
1181 Ga0496110_0174763
1182 Ga0496110_0844618
1183 Ga0496111_0020922
1184 Ga0496111_0064521
1185 Ga0496111_0298048
1186 Ga0496111_0688734
1187 Ga0496112_0037377
1188 Ga0496112_1017341
1189 Ga0496113_0006265
1190 Ga0496113_0089085
1191 Ga0496114_0002542
1192 Ga0496114_0241857
1193 Ga0496115_0000815
1194 Ga0496115_0270508
1195 Ga0496116_0046069
1196 Ga0496117_0002026
1197 Ga0496118_0001179
1198 Ga0496119_0016754
1199 Ga0496120_0004413
1200 Ga0496121_0085248
1201 Ga0496121_0181465
1202 Ga0496124_0088633
1203 Ga0496125_0003753
1204 Ga0496125_0012912
1205 Ga0496126_0008248
1206 Ga0501031_0073698
1207 Ga0501031_0389206
1208 Ga0501032_0031810
1209 Ga0501033_0102558
1210 Ga0501033_0210416
1211 Ga0501034_0326431
1212 Ga0501036_0001457
1213 Ga0501036_0017262
1214 Ga0501036_0045229
1215 Ga0501036_0064238
1216 Ga0501036_0298324
1217 Ga0501036_0352087
1218 Ga0501037_0049852
1219 Ga0501038_0055443
1220 Ga0501039_0003396
1221 Ga0501039_0003643
1222 Ga0501039_0101275
1223 Ga0501040_0000515
1224 Ga0501040_0006488
1225 Ga0501040_0048027
1226 Ga0501040_0056481
1227 Ga0501040_0130371
1228 Ga0501041_0017542
1229 Ga0501041_0023411
1230 Ga0501041_0025760
1231 Ga0501041_0154381
1232 Ga0501042_0019543
1233 Ga0501042_0039878
1234 Ga0501042_0096001
1235 Ga0501042_0112336
1236 Ga0501043_0170030
1237 Ga0501046_0019768
1238 Ga0501046_0103554
1239 Ga0501046_0137248
1240 Ga0501046_0501763
1241 Ga0501048_0009811
1242 Ga0501048_0109180
1243 Ga0501048_0144990
1244 Ga0501067_0001773
1245 Ga0501068_0275327
1246 Ga0501068_0312935
1247 Ga0501069_0025346
1248 Ga0501069_0189605
1249 Ga0501070_0014832
1250 Ga0501071_0001164
1251 Ga0501071_0045033
1252 Ga0501071_0066901
1253 Ga0501071_0127405
1254 Ga0501072_0000894
1255 Ga0501072_0003415
1256 Ga0501072_0025305
1257 Ga0501072_0055650
1258 Ga0501073_0002737
1259 Ga0501073_0348937
1260 Ga0501074_0009393
1261 Ga0501074_0030239
1262 Ga0501074_0112760
1263 Ga0501074_0121445
1264 Ga0501075_0003952
1265 Ga0501075_0004349
1266 Ga0501075_0130354
1267 Ga0501075_0138435
1268 Ga0501075_0372971
1269 Ga0501076_0003103
1270 Ga0501076_0007818
1271 Ga0501076_0029116
1272 Ga0501076_0082896
1273 Ga0501076_0085597
1274 Ga0501076_0086792
1275 Ga0501076_0472224
1276 Ga0501077_0027075
1277 Ga0501077_0030118
1278 Ga0501077_0078121
1279 Ga0501077_0309307
1280 Ga0501079_0002701
1281 Ga0501079_0153559
1282 Ga0501079_0276149
1283 Ga0501079_0387385
1284 Ga0501079_0406984
1285 Ga0501080_0174268
1286 Ga0501080_0322871
1287 Ga0501081_0016708
1288 Ga0501081_0032249
1289 Ga0501081_0313777
1290 Ga0501083_0015377
1291 Ga0501035_0020722
1292 Ga0501035_0055381
1293 Ga0501035_0056570
1294 Ga0501035_0309722
1295 Ga0501044_0332749
1296 Ga0501045_0004075
1297 Ga0501045_0116512
1298 Ga0501045_0139177
1299 nmdc:mga0yw44_140119_c1
1300 nmdc:mga0yw44_51785_c1
1301 nmdc:mga0yw44_88951_c1
1302 nmdc:mga05p37_10310_c1
1303 nmdc:mga05p37_1215725_c1
1304 nmdc:mga05p37_130523_c1
1305 nmdc:mga05p37_142939_c1
1306 nmdc:mga05p37_147460_c1
1307 nmdc:mga05p37_21214_c1
1308 nmdc:mga05p37_21516_c1
1309 nmdc:mga05p37_482142_c1
1310 nmdc:mga05p37_48686_c1
1311 nmdc:mga09592_169501_c1
1312 nmdc:mga0qj67_91666_c1
1313 nmdc:mga06r32_13499_c1
1314 nmdc:mga06r32_330200_c1
1315 nmdc:mga06r32_438984_c1
1316 nmdc:mga06r32_79753_c1
1317 nmdc:mga08y16_45205_c1
1318 nmdc:mga08y16_80546_c1
1319 nmdc:mga08y16_953155_c1
1320 nmdc:mga0n895_320921_c1
1321 nmdc:mga0n895_56427_c1
1322 nmdc:mga0n895_57126_c1
1323 nmdc:mga0n895_63695_c1
1324 nmdc:mga0n895_743_c1
1325 nmdc:mga0n895_9556_c1
1326 nmdc:mga0rr50_135216_c1
1327 nmdc:mga0rr50_135655_c1
1328 nmdc:mga0rr50_333702_c1
1329 nmdc:mga0rr50_3537_c1
1330 nmdc:mga0rr50_43998_c1
1331 nmdc:mga08x19_3507_c1
1332 nmdc:mga08x19_636081_c1
1333 nmdc:mga0a205_102371_c1
1334 nmdc:mga0a205_115185_c1
1335 nmdc:mga0a205_1_c2
1336 nmdc:mga0a205_20197_c1
1337 nmdc:mga0a205_22022_c1
1338 nmdc:mga0a205_32312_c1
1339 nmdc:mga0a205_33485_c1
1340 nmdc:mga0a205_68679_c1
1341 Ga0495601_0087095
1342 Ga0495655_0113043
1343 Ga0495619_0040632
1344 Ga0495619_0180766
1345 Ga0500578_0012444
1346 Ga0500640_023966
1347 Ga0500654_058339
1348 Ga0500660_039633
1349 Ga0500553_136757
1350 Ga0500560_000468
1351 Ga0500569_001500
1352 Ga0500572_088713
1353 Ga0500614_004794
1354 Ga0500614_018592
1355 Ga0500628_005693
1356 Ga0500652_007135
1357 Ga0500658_0033416
1358 Ga0500559_0165501
1359 Ga0500561_0000775
1360 Ga0500573_0114554
1361 Ga0500577_0068266
1362 Ga0500588_0126179
1363 Ga0500600_0001718
1364 Ga0500603_036123
1365 Ga0500616_0106578
1366 Ga0500624_006191
1367 Ga0500633_0025426
1368 Ga0500634_0001300
1369 Ga0500656_001260
1370 Ga0501084_0004385
1371 Ga0501084_0029398
1372 Ga0501084_0081060
1373 Ga0501084_0660664
1374 Ga0501082_0070632
1375 Ga0501082_0105889
1376 Ga0501082_0136813
1377 Ga0501082_0172521
1378 Ga0501082_0589463
1379 Ga0466962_0001045
1380 Ga0466962_0004738
1381 Ga0466962_0070878
1382 Ga0466962_0118825
1383 Ga0530510_0005561
1384 Ga0530510_0009858
1385 Ga0530510_0020967
1386 Ga0530510_0035126
1387 Ga0530510_0184960
1388 2793975290
1389 2809590728
1390 2867347304
1391 2899368960
1392 8047719701
1393 8047900553
1394 8048358349
1395 8048377493
1396 8048386591

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

33

142

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

174

249

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9807 5 123
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.979 7 124
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9787 5 123
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9786 7 124
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9776 5 123
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9987 6 85 3.40.50.2300
af_O07776_147_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.989 131 228 1.10.10.10
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9818 6 85 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9806 5 85 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9787 3 122 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2T3N0B4-F1-model_v4 Response regulatory domain-containing protein 0.9868 6 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7C4IG96-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9827 7 120 GO:0000155
GO:0005886
GO:0009927
AF-A0A6I5QSI8-F1-model_v4 Response regulator 0.9822 5 122 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A5C6EQA2-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9811 7 122 GO:0000155
GO:0005886
AF-A0A3C0Z4C2-F1-model_v4 DNA-binding response regulator 0.979 6 122 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map