F475954

General Info

Members Datasets Scaffolds Average Seq Length
698 349 675 230

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10068803|Ga0105241_100688033
Length 262
Sequence VATVLVAAATANKFPPWQSFTHFCISMEQKIIITIDGWSSCGKSTLAKQLARELGYIYIDSGAMYRAITLYFLRNHVDWTNHEAVENALKHITLTSSSNHKTGQSEMHLNHENVEYVIRDLVVAEKVSEVAAIKEVRDFAVKQQQEMGKNKGIVMDGRDIGTVVFPHAELKIFMTADKDIRVKRRFQELYEKNPNVTMEEVKANLEMRDYIDSHREVSPLRKASDALELDNSHLTIKEQLDMALNWVNERCVKPTISSGNRP

Samples

Sample ID Description Type Environment
1 2738541297 Duganella sp. GV083 Isolate Unclassified
2 2738541357 Duganella sp. GV053 Isolate Unclassified
3 2738543003 Duganella sp. GV066 Isolate Unclassified
4 2738543026 Duganella sp. GV089 Isolate Unclassified
5 2738543029 Duganella sp. GV039 Isolate Unclassified
6 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
7 2821131069 Duganella sp. 1224 Isolate Unclassified
8 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
9 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
10 2857553236 Duganella sp. R-74557 Isolate Unclassified
11 2857564685 Duganella sp. R-74599 Isolate Unclassified
12 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
13 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
14 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
15 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
16 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
17 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
18 2914759650 Rhizosphaericola mali Isolate Rhizosphere
19 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
20 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
21 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
22 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
23 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
27 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
28 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
29 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
30 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
63 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
67 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
137 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
204 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
213 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
218 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
219 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
220 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
224 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
227 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
228 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
235 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
255 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
279 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
299 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
300 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
301 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
302 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
303 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
304 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
305 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
306 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
307 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
308 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
309 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
310 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
311 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
312 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
315 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
316 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
327 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
328 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
329 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
330 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
331 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
332 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
333 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
334 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
335 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
338 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
339 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
340 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
341 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
342 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
343 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
344 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
347 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
348 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
349 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 0
Isolates 3.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.16
Nodule 0
Rhizoplane 0.57
Rhizosphere 83.81
Stem 0
Stem Tuber 0
Unclassified 8.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10013889 3300001979 Bacteria 2988
2 JGI24751J29686_10000878 3300002459 Bacteria 6868
3 JGI25154J39366_1000004 3300002738 Bacteria 346460
4 JGI25154J39366_1000495 3300002738 Bacteria 20221
5 JGI25158J39367_1009660 3300002739 Bacteria 1318
6 JGI25157J39369_1003031 3300002741 Bacteria 3659
7 rootH1_10061546 3300003316 Bacteria 1191
8 rootH2_10030436 3300003320 Bacteria 1942
9 rootH2_10035373 3300003320 Bacteria 2959
10 rootH2_10044418 3300003320 Bacteria 1870
11 rootH2_10265654 3300003320 Bacteria 1041
12 rootL2_10002240 3300003322 Bacteria 2267
13 rootL2_10099562 3300003322 Bacteria 10969
14 rootL2_10213538 3300003322 Bacteria 4983
15 rootL2_10275685 3300003322 Bacteria 2159
16 rootH1_10081552 3300003323 Bacteria 5558
17 rootH1_10159857 3300003323 Bacteria 1292
18 JGI25160J50197_1009532 3300003354 Bacteria 3590
19 Ga0055535_1005189 3300003761 Bacteria 2932
20 Ga0055542_1003200 3300003762 Bacteria 4600
21 Ga0055529_1000100 3300003763 Bacteria 131049
22 Ga0065165_1009569 3300005262 Bacteria 4325
23 Ga0065165_1011900 3300005262 Bacteria 3582
24 Ga0065714_10118317 3300005288 Bacteria 1380
25 Ga0065704_10157563 3300005289 Bacteria 1379
26 Ga0065712_10134766 3300005290 Bacteria 1500
27 Ga0065715_10032656 3300005293 Bacteria 1680
28 Ga0065707_10115278 3300005295 Unclassified 2272
29 Ga0065707_10239343 3300005295 Bacteria 1161
30 Ga0070658_10635485 3300005327 Bacteria 926
31 Ga0070676_10002015 3300005328 Bacteria 10324
32 Ga0070676_10026397 3300005328 Bacteria 3288
33 Ga0070676_10078119 3300005328 Bacteria 2002
34 Ga0070683_100006190 3300005329 Bacteria 10039
35 Ga0070683_100144781 3300005329 Bacteria 2251
36 Ga0070683_100313284 3300005329 Bacteria 1493
37 Ga0070683_100427908 3300005329 Bacteria 1263
38 Ga0070683_100432397 3300005329 Bacteria 1256
39 Ga0070683_100938709 3300005329 Unclassified 830
40 Ga0070690_100075264 3300005330 Bacteria 2201
41 Ga0070690_100080739 3300005330 Unclassified 2127
42 Ga0070670_100010352 3300005331 Bacteria 7960
43 Ga0070670_100109869 3300005331 Bacteria 2376
44 Ga0070670_100155603 3300005331 Bacteria 1979
45 Ga0070670_100353460 3300005331 Bacteria 1291
46 Ga0070670_100655742 3300005331 Bacteria 942
47 Ga0070670_100669057 3300005331 Bacteria 932
48 Ga0070670_100789649 3300005331 Bacteria 857
49 Ga0070670_100794598 3300005331 Bacteria 854
50 Ga0068869_100027165 3300005334 Bacteria 3989
51 Ga0068869_100746194 3300005334 Bacteria 838
52 Ga0070666_10003629 3300005335 Bacteria 9362
53 Ga0070666_10255039 3300005335 Bacteria 1242
54 Ga0070682_100000436 3300005337 Bacteria 26964
55 Ga0070682_100620238 3300005337 Bacteria 857
56 Ga0068868_100016918 3300005338 Bacteria 5425
57 Ga0068868_100087536 3300005338 Bacteria 2505
58 Ga0070660_100137935 3300005339 Bacteria 1955
59 Ga0070660_100225733 3300005339 Bacteria 1523
60 Ga0070689_100148146 3300005340 Bacteria 1891
61 Ga0070691_10000902 3300005341 Bacteria 12056
62 Ga0070661_100262999 3300005344 Bacteria 1334
63 Ga0070668_100000401 3300005347 Bacteria 28754
64 Ga0070668_100265854 3300005347 Unclassified 1428
65 Ga0070668_100635383 3300005347 Bacteria 937
66 Ga0070669_100417189 3300005353 Bacteria 1101
67 Ga0070675_100131429 3300005354 Bacteria 2134
68 Ga0070675_100324930 3300005354 Bacteria 1359
69 Ga0070675_100381000 3300005354 Bacteria 1255
70 Ga0070671_100287385 3300005355 Bacteria 1399
71 Ga0070674_100079478 3300005356 Bacteria 2340
72 Ga0070673_100050165 3300005364 Bacteria 3262
73 Ga0070688_100049115 3300005365 Bacteria 2624
74 Ga0070688_100053780 3300005365 Bacteria 2520
75 Ga0070659_100088862 3300005366 Bacteria 2475
76 Ga0070659_100251877 3300005366 Bacteria 1464
77 Ga0070667_100000533 3300005367 Bacteria 38045
78 Ga0070667_100034803 3300005367 Bacteria 4217
79 Ga0070667_100135381 3300005367 Bacteria 2154
80 Ga0070678_100572284 3300005456 Bacteria 1005
81 Ga0070662_100264293 3300005457 Bacteria 1387
82 Ga0070662_100387975 3300005457 Bacteria 1150
83 Ga0070681_10283823 3300005458 Bacteria 1566
84 Ga0070681_10548516 3300005458 Bacteria 1070
85 Ga0068867_100150829 3300005459 Bacteria 1826
86 Ga0070685_10171506 3300005466 Bacteria 1391
87 Ga0070698_100000791 3300005471 Bacteria 34361
88 Ga0070698_100004354 3300005471 Bacteria 15565
89 Ga0070679_100006566 3300005530 Bacteria 10838
90 Ga0070684_100582146 3300005535 Unclassified 1040
91 Ga0068853_100000862 3300005539 Bacteria 21166
92 Ga0068853_100012555 3300005539 Bacteria 6892
93 Ga0068853_100042031 3300005539 Bacteria 3907
94 Ga0068853_100130045 3300005539 Bacteria 2253
95 Ga0068853_100316906 3300005539 Bacteria 1445
96 Ga0068853_100348311 3300005539 Unclassified 1377
97 Ga0068853_100674548 3300005539 Bacteria 985
98 Ga0070672_100001693 3300005543 Bacteria 13762
99 Ga0070672_100151119 3300005543 Bacteria 1921
100 Ga0070672_100821786 3300005543 Bacteria 818
101 Ga0070686_100179147 3300005544 Bacteria 1504
102 Ga0070686_100504154 3300005544 Bacteria 939
103 Ga0070686_100673244 3300005544 Bacteria 823
104 Ga0070693_100045301 3300005547 Bacteria 2492
105 Ga0070665_100002361 3300005548 Bacteria 20861
106 Ga0070665_100277083 3300005548 Bacteria 1679
107 Ga0070704_100444270 3300005549 Unclassified 1115
108 Ga0068855_100001333 3300005563 Bacteria 30579
109 Ga0068855_100059968 3300005563 Bacteria 4451
110 Ga0068855_100403016 3300005563 Bacteria 1499
111 Ga0070664_100013343 3300005564 Bacteria 6691
112 Ga0070664_100031478 3300005564 Bacteria 4433
113 Ga0070664_100228262 3300005564 Bacteria 1668
114 Ga0070664_100420607 3300005564 Bacteria 1224
115 Ga0068857_100004225 3300005577 Bacteria 12105
116 Ga0068857_100165906 3300005577 Bacteria 2005
117 Ga0068857_100215589 3300005577 Bacteria 1752
118 Ga0068854_100016394 3300005578 Bacteria 4939
119 Ga0068854_100214933 3300005578 Bacteria 1519
120 Ga0068856_100041808 3300005614 Bacteria 4506
121 Ga0068856_100049890 3300005614 Bacteria 4126
122 Ga0068852_100027026 3300005616 Bacteria 4671
123 Ga0068852_100027478 3300005616 Bacteria 4638
124 Ga0068852_100259873 3300005616 Bacteria 1667
125 Ga0068852_100556611 3300005616 Unclassified 1148
126 Ga0068859_100001757 3300005617 Bacteria 22069
127 Ga0068859_100140602 3300005617 Bacteria 2487
128 Ga0068859_100196183 3300005617 Bacteria 2103
129 Ga0068859_100287176 3300005617 Bacteria 1738
130 Ga0068859_100383246 3300005617 Bacteria 1501
131 Ga0068864_100000697 3300005618 Bacteria 28171
132 Ga0068864_100036995 3300005618 Unclassified 4162
133 Ga0068864_100112896 3300005618 Bacteria 2422
134 Ga0068864_100283670 3300005618 Unclassified 1546
135 Ga0068866_10024684 3300005718 Bacteria 2816
136 Ga0068866_10469036 3300005718 Viruses 827
137 Ga0068861_100028014 3300005719 Bacteria 4109
138 Ga0068861_100051919 3300005719 Bacteria 3115
139 Ga0068861_100324608 3300005719 Unclassified 1342
140 Ga0068851_10048655 3300005834 Bacteria 2149
141 Ga0068863_100017171 3300005841 Bacteria 6941
142 Ga0068863_100086885 3300005841 Unclassified 2963
143 Ga0068863_100134090 3300005841 Unclassified 2365
144 Ga0068863_100220732 3300005841 Bacteria 1826
145 Ga0068863_100691596 3300005841 Unclassified 1013
146 Ga0068858_100002045 3300005842 Bacteria 20564
147 Ga0068860_100000097 3300005843 Bacteria 146573
148 Ga0068860_100002600 3300005843 Bacteria 18890
149 Ga0068860_100006918 3300005843 Bacteria 11367
150 Ga0068860_100036355 3300005843 Bacteria 4720
151 Ga0068860_100168483 3300005843 Bacteria 2115
152 Ga0068860_100283406 3300005843 Bacteria 1620
153 Ga0068862_100328193 3300005844 Bacteria 1414
154 Ga0068862_100578801 3300005844 Unclassified 1075
155 Ga0081540_1005881 3300005983 Bacteria 9066
156 Ga0081539_10026070 3300005985 Bacteria 3744
157 Ga0075362_10013837 3300006177 Bacteria 3240
158 Ga0097621_100002514 3300006237 Bacteria 12556
159 Ga0097621_100053932 3300006237 Bacteria 3277
160 Ga0097621_100077716 3300006237 Bacteria 2756
161 Ga0075370_10507114 3300006353 Bacteria 728
162 Ga0068871_100023999 3300006358 Unclassified 4725
163 Ga0068871_100024610 3300006358 Bacteria 4671
164 Ga0068871_100060922 3300006358 Unclassified 3080
165 Ga0068871_100139315 3300006358 Bacteria 2062
166 Ga0075428_100027076 3300006844 Bacteria 6347
167 Ga0075428_100057845 3300006844 Bacteria 4244
168 Ga0075428_100243033 3300006844 Bacteria 1942
169 Ga0075428_100316736 3300006844 Bacteria 1676
170 Ga0075428_100820862 3300006844 Unclassified 988
171 Ga0075431_100019063 3300006847 Bacteria 6990
172 Ga0075429_100012284 3300006880 Bacteria 7427
173 Ga0075429_100558675 3300006880 Bacteria 1003
174 Ga0068865_100017180 3300006881 Bacteria 4648
175 Ga0068865_100599920 3300006881 Bacteria 930
176 Ga0097620_100001757 3300006931 Bacteria 22069
177 Ga0097620_100140601 3300006931 Bacteria 2487
178 Ga0097620_100196186 3300006931 Bacteria 2103
179 Ga0097620_100287146 3300006931 Bacteria 1738
180 Ga0097620_100383216 3300006931 Bacteria 1501
181 Ga0105251_10132350 3300009011 Bacteria 1130
182 Ga0105240_10001904 3300009093 Bacteria 34640
183 Ga0105240_10003186 3300009093 Bacteria 25770
184 Ga0105240_10005151 3300009093 Bacteria 19554
185 Ga0105240_10018088 3300009093 Bacteria 9476
186 Ga0105240_10055447 3300009093 Bacteria 4962
187 Ga0105240_10100537 3300009093 Bacteria 3518
188 Ga0105240_10116414 3300009093 Bacteria 3225
189 Ga0105240_10124078 3300009093 Bacteria 3106
190 Ga0105240_10274119 3300009093 Bacteria 1941
191 Ga0111539_10038533 3300009094 Bacteria 5765
192 Ga0111539_10445108 3300009094 Bacteria 1509
193 Ga0105245_10580144 3300009098 Bacteria 1146
194 Ga0105247_10000982 3300009101 Bacteria 21489
195 Ga0105247_10372700 3300009101 Bacteria 1010
196 Ga0114129_10043343 3300009147 Bacteria 6330
197 Ga0114129_10055854 3300009147 Bacteria 5533
198 Ga0114129_11172992 3300009147 Bacteria 958
199 Ga0105243_10163300 3300009148 Bacteria 1922
200 Ga0105241_10000224 3300009174 Bacteria 42685
201 Ga0105241_10000614 3300009174 Bacteria 26776
202 Ga0105241_10068803 3300009174 Bacteria 2744
203 Ga0105241_10267194 3300009174 Unclassified 1456
204 Ga0105242_10031974 3300009176 Bacteria 4207
205 Ga0105242_10090660 3300009176 Unclassified 2572
206 Ga0105248_10011550 3300009177 Bacteria 9730
207 Ga0105237_10001017 3300009545 Bacteria 37740
208 Ga0105237_10011860 3300009545 Bacteria 9216
209 Ga0105237_10021908 3300009545 Bacteria 6563
210 Ga0105237_10042813 3300009545 Bacteria 4563
211 Ga0105237_10058858 3300009545 Bacteria 3845
212 Ga0105237_10221775 3300009545 Bacteria 1891
213 Ga0105237_10357436 3300009545 Bacteria 1465
214 Ga0105238_10069232 3300009551 Bacteria 3529
215 Ga0105238_10153848 3300009551 Bacteria 2275
216 Ga0105238_10768409 3300009551 Bacteria 978
217 Ga0105238_10943333 3300009551 Bacteria 882
218 Ga0105238_11238130 3300009551 Unclassified 771
219 Ga0105249_10001004 3300009553 Bacteria 25009
220 Ga0105249_10020949 3300009553 Bacteria 5849
221 Ga0105249_10307793 3300009553 Bacteria 1591
222 Ga0105249_10384291 3300009553 Bacteria 1431
223 Ga0105249_10418161 3300009553 Unclassified 1374
224 Ga0105239_10000436 3300010375 Bacteria 61031
225 Ga0105239_10000950 3300010375 Bacteria 40845
226 Ga0105239_10018021 3300010375 Bacteria 7811
227 Ga0105239_10044571 3300010375 Bacteria 4862
228 Ga0105239_10052181 3300010375 Bacteria 4484
229 Ga0105239_10220863 3300010375 Bacteria 2125
230 Ga0105239_10311490 3300010375 Bacteria 1774
231 Ga0157373_10004590 3300013100 Bacteria 10395
232 Ga0157371_10016646 3300013102 Bacteria 5481
233 Ga0157371_10024778 3300013102 Bacteria 4378
234 Ga0157371_10045471 3300013102 Bacteria 3124
235 Ga0157371_10108651 3300013102 Bacteria 1968
236 Ga0157371_10190462 3300013102 Bacteria 1468
237 Ga0157371_10206562 3300013102 Bacteria 1409
238 Ga0157371_10343877 3300013102 Bacteria 1085
239 Ga0157370_10004443 3300013104 Bacteria 16068
240 Ga0157370_10016530 3300013104 Bacteria 7465
241 Ga0157370_10039463 3300013104 Bacteria 4563
242 Ga0157370_10056510 3300013104 Bacteria 3735
243 Ga0157369_10010809 3300013105 Bacteria 10394
244 Ga0157369_10052831 3300013105 Bacteria 4394
245 Ga0157369_10098008 3300013105 Bacteria 3127
246 Ga0157369_10141867 3300013105 Bacteria 2542
247 Ga0157374_10000001 3300013296 Bacteria 1077351
248 Ga0157374_10043425 3300013296 Bacteria 4153
249 Ga0157374_10067871 3300013296 Bacteria 3354
250 Ga0157374_10144131 3300013296 Bacteria 2313
251 Ga0157374_10458457 3300013296 Bacteria 1277
252 Ga0157378_10007269 3300013297 Bacteria 9671
253 Ga0157378_10105414 3300013297 Bacteria 2578
254 Ga0157378_10415797 3300013297 Bacteria 1328
255 Ga0157378_10840759 3300013297 Bacteria 946
256 Ga0157378_10899656 3300013297 Bacteria 916
257 Ga0163162_10002183 3300013306 Bacteria 18347
258 Ga0163162_10056597 3300013306 Bacteria 3949
259 Ga0163162_10073563 3300013306 Unclassified 3474
260 Ga0163162_10099428 3300013306 Unclassified 3000
261 Ga0163162_10275806 3300013306 Bacteria 1813
262 Ga0163162_10393774 3300013306 Bacteria 1518
263 Ga0163162_11116772 3300013306 Unclassified 893
264 Ga0157372_10000595 3300013307 Bacteria 39419
265 Ga0157372_10002860 3300013307 Bacteria 18657
266 Ga0157372_10024140 3300013307 Bacteria 6600
267 Ga0157372_10050299 3300013307 Bacteria 4636
268 Ga0157372_10123578 3300013307 Bacteria 2975
269 Ga0157372_10181700 3300013307 Bacteria 2435
270 Ga0157372_10182766 3300013307 Bacteria 2428
271 Ga0157372_10193476 3300013307 Bacteria 2356
272 Ga0157372_10441827 3300013307 Bacteria 1516
273 Ga0157372_10475534 3300013307 Bacteria 1457
274 Ga0157372_10500768 3300013307 Bacteria 1417
275 Ga0157372_11362987 3300013307 Bacteria 818
276 Ga0157375_10156395 3300013308 Bacteria 2419
277 Ga0157375_10157860 3300013308 Unclassified 2408
278 Ga0157375_10229430 3300013308 Bacteria 2016
279 Ga0157375_10366991 3300013308 Bacteria 1606
280 Ga0163163_10000254 3300014325 Bacteria 54049
281 Ga0163163_10306165 3300014325 Bacteria 1641
282 Ga0163163_10562626 3300014325 Unclassified 1203
283 Ga0157380_10031820 3300014326 Bacteria 4052
284 Ga0157380_10059590 3300014326 Bacteria 3047
285 Ga0157380_10108857 3300014326 Bacteria 2324
286 Ga0157380_10583785 3300014326 Unclassified 1103
287 Ga0157380_10900803 3300014326 Bacteria 910
288 Ga0157377_10053165 3300014745 Bacteria 2289
289 Ga0157377_10072135 3300014745 Bacteria 1998
290 Ga0157377_10268223 3300014745 Unclassified 1114
291 Ga0157379_10000834 3300014968 Bacteria 24929
292 Ga0157379_10298920 3300014968 Bacteria 1467
293 Ga0157376_10004691 3300014969 Bacteria 9526
294 Ga0157376_10023949 3300014969 Bacteria 4788
295 Ga0157376_10051047 3300014969 Bacteria 3434
296 Ga0157376_10082968 3300014969 Bacteria 2756
297 Ga0157376_10114509 3300014969 Unclassified 2379
298 Ga0182005_1000023 3300015265 Bacteria 246328
299 Ga0163161_10032911 3300017792 Unclassified 3703
300 Ga0163161_10330948 3300017792 Bacteria 1206
301 Ga0163161_10589028 3300017792 Bacteria 916
302 Ga0209436_101974 3300025208 Bacteria 6562
303 Ga0209436_103713 3300025208 Bacteria 3967
304 Ga0209258_100068 3300025242 Bacteria 286288
305 Ga0209646_1000025 3300025246 Bacteria 406493
306 Ga0209026_1000097 3300025250 Bacteria 163212
307 Ga0209148_1000259 3300025254 Bacteria 82912
308 Ga0209129_1011201 3300025258 Bacteria 2162
309 Ga0209130_1009964 3300025284 Bacteria 2657
310 Ga0209758_1001656 3300025297 Bacteria 25247
311 Ga0209050_1000136 3300025298 Bacteria 179113
312 Ga0207426_1000164 3300025302 Bacteria 171465
313 Ga0207426_1000220 3300025302 Bacteria 134979
314 Ga0207426_1000543 3300025302 Bacteria 53486
315 Ga0209257_1002016 3300025304 Bacteria 21697
316 Ga0207656_10058306 3300025321 Bacteria 1686
317 Ga0207656_10154167 3300025321 Bacteria 1090
318 Ga0207642_10058208 3300025899 Bacteria 1782
319 Ga0207642_10132087 3300025899 Bacteria 1304
320 Ga0207710_10055048 3300025900 Bacteria 1793
321 Ga0207688_10036895 3300025901 Bacteria 2710
322 Ga0207680_10000847 3300025903 Bacteria 14466
323 Ga0207647_10001653 3300025904 Bacteria 17156
324 Ga0207647_10004651 3300025904 Bacteria 10169
325 Ga0207645_10001168 3300025907 Bacteria 21656
326 Ga0207645_10012253 3300025907 Bacteria 5824
327 Ga0207643_10045475 3300025908 Bacteria 2480
328 Ga0207654_10009301 3300025911 Bacteria 4988
329 Ga0207707_10000574 3300025912 Bacteria 37317
330 Ga0207695_10000076 3300025913 Bacteria 307969
331 Ga0207695_10000084 3300025913 Bacteria 282392
332 Ga0207695_10000090 3300025913 Bacteria 272143
333 Ga0207695_10028249 3300025913 Bacteria 6226
334 Ga0207695_10045209 3300025913 Bacteria 4676
335 Ga0207695_10185214 3300025913 Bacteria 2001
336 Ga0207671_10001353 3300025914 Bacteria 28612
337 Ga0207671_10019690 3300025914 Bacteria 5154
338 Ga0207671_10030012 3300025914 Bacteria 4056
339 Ga0207671_10257547 3300025914 Bacteria 1372
340 Ga0207660_10015118 3300025917 Bacteria 5089
341 Ga0207662_10045653 3300025918 Unclassified 2590
342 Ga0207662_10364559 3300025918 Unclassified 973
343 Ga0207657_10096121 3300025919 Bacteria 2464
344 Ga0207649_10104806 3300025920 Bacteria 1878
345 Ga0207649_10109016 3300025920 Bacteria 1846
346 Ga0207649_10643792 3300025920 Unclassified 818
347 Ga0207652_10040033 3300025921 Bacteria 3979
348 Ga0207681_10028240 3300025923 Bacteria 3633
349 Ga0207681_10087502 3300025923 Bacteria 2217
350 Ga0207681_10269037 3300025923 Bacteria 1337
351 Ga0207694_10048175 3300025924 Bacteria 3297
352 Ga0207694_10064195 3300025924 Bacteria 2862
353 Ga0207694_10332733 3300025924 Bacteria 1255
354 Ga0207650_10012336 3300025925 Bacteria 5899
355 Ga0207650_10047872 3300025925 Bacteria 3152
356 Ga0207650_10100195 3300025925 Bacteria 2228
357 Ga0207650_10140969 3300025925 Bacteria 1895
358 Ga0207650_10390509 3300025925 Bacteria 1150
359 Ga0207650_10409483 3300025925 Bacteria 1124
360 Ga0207650_10586318 3300025925 Bacteria 937
361 Ga0207659_10133973 3300025926 Bacteria 1916
362 Ga0207659_10353755 3300025926 Bacteria 1219
363 Ga0207644_10148048 3300025931 Bacteria 1815
364 Ga0207690_10279726 3300025932 Bacteria 1299
365 Ga0207706_10057757 3300025933 Bacteria 3418
366 Ga0207706_10367470 3300025933 Bacteria 1249
367 Ga0207706_10507906 3300025933 Bacteria 1040
368 Ga0207686_10020673 3300025934 Bacteria 3764
369 Ga0207686_10051166 3300025934 Unclassified 2572
370 Ga0207709_10226143 3300025935 Unclassified 1352
371 Ga0207670_10067709 3300025936 Bacteria 2457
372 Ga0207704_10005751 3300025938 Bacteria 5734
373 Ga0207691_10000835 3300025940 Bacteria 30734
374 Ga0207691_10011149 3300025940 Bacteria 8627
375 Ga0207691_10149323 3300025940 Bacteria 2055
376 Ga0207691_10253973 3300025940 Bacteria 1517
377 Ga0207689_10003622 3300025942 Bacteria 14120
378 Ga0207689_10027179 3300025942 Bacteria 4791
379 Ga0207689_10067862 3300025942 Bacteria 2930
380 Ga0207689_10725778 3300025942 Unclassified 838
381 Ga0207661_10007166 3300025944 Bacteria 7922
382 Ga0207661_10017068 3300025944 Bacteria 5364
383 Ga0207661_10112482 3300025944 Bacteria 2305
384 Ga0207661_10528799 3300025944 Bacteria 1079
385 Ga0207661_10869637 3300025944 Unclassified 830
386 Ga0207679_10008161 3300025945 Bacteria 6664
387 Ga0207679_10019154 3300025945 Bacteria 4595
388 Ga0207667_10000911 3300025949 Bacteria 37650
389 Ga0207667_10001676 3300025949 Bacteria 27897
390 Ga0207667_10015139 3300025949 Bacteria 8771
391 Ga0207667_10051804 3300025949 Bacteria 4325
392 Ga0207667_10100740 3300025949 Bacteria 2980
393 Ga0207667_10332416 3300025949 Bacteria 1551
394 Ga0207667_10987775 3300025949 Bacteria 830
395 Ga0207651_10001175 3300025960 Bacteria 11739
396 Ga0207651_10463322 3300025960 Bacteria 1089
397 Ga0207712_10002266 3300025961 Bacteria 12484
398 Ga0207712_10005926 3300025961 Bacteria 7704
399 Ga0207712_10016043 3300025961 Bacteria 4842
400 Ga0207712_10057660 3300025961 Bacteria 2741
401 Ga0207712_10193269 3300025961 Bacteria 1608
402 Ga0207712_10221912 3300025961 Bacteria 1512
403 Ga0207712_10548180 3300025961 Unclassified 994
404 Ga0207712_10611057 3300025961 Bacteria 944
405 Ga0207668_10000881 3300025972 Bacteria 18105
406 Ga0207668_10060441 3300025972 Bacteria 2660
407 Ga0207658_10001477 3300025986 Bacteria 18258
408 Ga0207677_10024807 3300026023 Bacteria 3731
409 Ga0207677_10049561 3300026023 Bacteria 2835
410 Ga0207677_10263284 3300026023 Bacteria 1406
411 Ga0207703_10011298 3300026035 Bacteria 6944
412 Ga0207639_10019483 3300026041 Bacteria 4840
413 Ga0207639_10023273 3300026041 Bacteria 4473
414 Ga0207639_10040686 3300026041 Bacteria 3471
415 Ga0207639_10102348 3300026041 Bacteria 2318
416 Ga0207639_10111886 3300026041 Bacteria 2227
417 Ga0207639_10132276 3300026041 Bacteria 2067
418 Ga0207639_10158858 3300026041 Bacteria 1903
419 Ga0207639_10252731 3300026041 Bacteria 1538
420 Ga0207639_10313968 3300026041 Bacteria 1389
421 Ga0207678_10035118 3300026067 Bacteria 4366
422 Ga0207708_10246608 3300026075 Bacteria 1438
423 Ga0207708_10333639 3300026075 Bacteria 1240
424 Ga0207702_10368187 3300026078 Bacteria 1379
425 Ga0207641_10006594 3300026088 Bacteria 9751
426 Ga0207641_10023686 3300026088 Bacteria 5058
427 Ga0207641_10102556 3300026088 Bacteria 2523
428 Ga0207641_10256143 3300026088 Unclassified 1636
429 Ga0207648_10001518 3300026089 Bacteria 25557
430 Ga0207648_10100431 3300026089 Bacteria 2535
431 Ga0207648_10183046 3300026089 Bacteria 1855
432 Ga0207676_10003724 3300026095 Bacteria 10780
433 Ga0207676_10013789 3300026095 Bacteria 5803
434 Ga0207676_10383994 3300026095 Unclassified 1308
435 Ga0207674_10001819 3300026116 Bacteria 27221
436 Ga0207674_10049407 3300026116 Bacteria 4302
437 Ga0207674_10191428 3300026116 Bacteria 1995
438 Ga0207674_10191432 3300026116 Bacteria 1995
439 Ga0207675_100129414 3300026118 Bacteria 2393
440 Ga0207675_100318837 3300026118 Bacteria 1517
441 Ga0207675_100633625 3300026118 Bacteria 1074
442 Ga0207675_100961924 3300026118 Bacteria 871
443 Ga0207698_10014385 3300026142 Bacteria 5258
444 Ga0207698_10087259 3300026142 Bacteria 2541
445 Ga0207698_10112823 3300026142 Bacteria 2282
446 Ga0207698_10218981 3300026142 Bacteria 1719
447 Ga0268266_10000038 3300028379 Bacteria 325729
448 Ga0268266_10007473 3300028379 Bacteria 9854
449 Ga0268266_10364279 3300028379 Unclassified 1361
450 Ga0268265_10697715 3300028380 Bacteria 980
451 Ga0268264_10000525 3300028381 Bacteria 48553
452 Ga0268264_10006805 3300028381 Bacteria 9603
453 Ga0268264_10018300 3300028381 Bacteria 5730
454 Ga0268264_10159157 3300028381 Bacteria 2032
455 Ga0307515_10000002 3300028794 Bacteria 1231751
456 Ga0307515_10310094 3300028794 Bacteria 1254
457 Ga0316177_1221645 3300030731 Unclassified 964
458 Ga0265327_10000729 3300031251 Bacteria 51312
459 Ga0265327_10056116 3300031251 Bacteria 2031
460 Ga0307513_10148404 3300031456 Bacteria 2259
461 Ga0307513_10202249 3300031456 Bacteria 1826
462 Ga0307513_10517973 3300031456 Bacteria 908
463 Ga0307509_10057770 3300031507 Bacteria 4112
464 Ga0307509_10111693 3300031507 Bacteria 2735
465 Ga0265313_10019801 3300031595 Bacteria 3733
466 Ga0307508_10002190 3300031616 Bacteria 20884
467 Ga0307508_10067009 3300031616 Bacteria 3159
468 Ga0316576_10281721 3300031727 Bacteria 1245
469 Ga0307516_10003848 3300031730 Bacteria 18983
470 Ga0307516_10280655 3300031730 Bacteria 1348
471 Ga0307413_10139242 3300031824 Bacteria 1674
472 Ga0307414_10066550 3300032004 Bacteria 2576
473 Ga0307414_10104360 3300032004 Bacteria 2141
474 Ga0307414_10572589 3300032004 Bacteria 1009
475 Ga0307510_10008223 3300033180 Bacteria 12424
476 Ga0316574_0150691 3300035398 Bacteria 1499
477 Ga0316574_0196822 3300035398 Bacteria 1295
478 Ga0316574_0270919 3300035398 Bacteria 1083
479 Ga0373935_0128425 3300035692 Bacteria 1701
480 Ga0373937_0410381 3300036401 Bacteria 1285
481 Ga0316582_0591881 3300036647 Bacteria 764
482 Ga0316584_0016898 3300036712 Bacteria 5236
483 Ga0316584_0061774 3300036712 Bacteria 2806
484 Ga0395899_0000159 3300037312 Bacteria 102831
485 Ga0395900_0427680 3300037418 Bacteria 1284
486 Ga0395905_0014932 3300037471 Bacteria 7408
487 Ga0395905_0049455 3300037471 Bacteria 3940
488 Ga0395905_0076975 3300037471 Bacteria 3126
489 Ga0439436_0054285 3300041404 Bacteria 1127
490 Ga0439439_0048161 3300041406 Bacteria 1114
491 Ga0451804_0285986 3300041463 Bacteria 958
492 Ga0451855_0590891 3300041511 Bacteria 1149
493 Ga0451855_1209573 3300041511 Bacteria 2142
494 Ga0451855_1969024 3300041511 Bacteria 1308
495 Ga0451855_2010349 3300041511 Bacteria 2764
496 Ga0451853_2224368 3300041512 Bacteria 1878
497 Ga0439431_0022991 3300041997 Bacteria 1506
498 Ga0439442_002870 3300042002 Bacteria 3395
499 Ga0439445_0002485 3300042004 Bacteria 4103
500 Ga0439449_0002035 3300042007 Bacteria 7960
501 Ga0439449_0006096 3300042007 Bacteria 4607
502 Ga0439457_012705 3300042014 Bacteria 1896
503 Ga0439457_019823 3300042014 Bacteria 1494
504 Ga0450896_007498 3300042133 Bacteria 1505
505 Ga0450898_046384 3300042134 Bacteria 831
506 Ga0439434_0019877 3300042435 Bacteria 2015
507 Ga0466969_0002777 3300044656 Bacteria 9362
508 Ga0466972_0000102 3300044658 Bacteria 75316
509 Ga0466972_0000639 3300044658 Bacteria 16960
510 Ga0466972_0006790 3300044658 Bacteria 5745
511 Ga0466972_0086378 3300044658 Bacteria 1491
512 Ga0453683_0095431 3300044673 Bacteria 1866
513 Ga0453683_0247990 3300044673 Bacteria 1135
514 Ga0466965_0074204 3300044683 Bacteria 1714
515 Ga0466961_0018217 3300044693 Bacteria 4515
516 Ga0466961_0314608 3300044693 Bacteria 955
517 Ga0453684_0170870 3300044712 Bacteria 2562
518 Ga0466971_0164791 3300044719 Bacteria 1038
519 Ga0466968_0096002 3300044735 Bacteria 1319
520 Ga0466957_0008397 3300044842 Bacteria 5872
521 Ga0466959_0000017 3300045049 Bacteria 143170
522 Ga0466959_0011513 3300045049 Bacteria 6359
523 Ga0451576_0201519 3300045051 Bacteria 2078
524 Ga0466958_0417503 3300045836 Unclassified 867
525 Ga0495617_000005 3300046452 Bacteria 404687
526 Ga0495627_000038 3300046453 Bacteria 198316
527 Ga0495629_0284519 3300046459 Bacteria 1134
528 Ga0495653_0000031 3300046463 Bacteria 137159
529 Ga0495650_0000480 3300046471 Bacteria 61049
530 Ga0495650_0005526 3300046471 Bacteria 8170
531 Ga0495650_0106035 3300046471 Bacteria 1049
532 Ga0495580_0027404 3300046472 Bacteria 4146
533 Ga0495605_0000082 3300046474 Bacteria 125136
534 Ga0495639_0293726 3300046475 Bacteria 809
535 Ga0495662_0173312 3300046476 Bacteria 1063
536 Ga0495585_0005600 3300046492 Bacteria 7892
537 Ga0495606_0004940 3300046507 Bacteria 13040
538 Ga0495606_0010571 3300046507 Bacteria 7640
539 Ga0495606_0010684 3300046507 Bacteria 7583
540 Ga0495610_0000038 3300046512 Bacteria 181669
541 Ga0495630_0051522 3300046517 Bacteria 3081
542 Ga0495637_0002015 3300046520 Bacteria 11466
543 Ga0495643_0075385 3300046522 Bacteria 1765
544 Ga0495643_0234791 3300046522 Bacteria 863
545 Ga0495644_0020433 3300046523 Bacteria 2527
546 Ga0495648_0016117 3300046524 Bacteria 5393
547 Ga0495648_0074059 3300046524 Bacteria 1963
548 Ga0495648_0139714 3300046524 Bacteria 1276
549 Ga0495642_0035308 3300046528 Bacteria 2017
550 Ga0495652_0587005 3300046529 Bacteria 762
551 Ga0495654_0000047 3300046530 Bacteria 147597
552 Ga0495654_0032241 3300046530 Bacteria 2656
553 Ga0495609_0003278 3300046538 Bacteria 9342
554 Ga0495622_0202344 3300046557 Bacteria 885
555 Ga0495668_0005172 3300046616 Bacteria 8957
556 Ga0495668_0013302 3300046616 Bacteria 4859
557 Ga0495611_0001301 3300046648 Bacteria 12718
558 Ga0495625_0013765 3300046660 Bacteria 6485
559 Ga0495625_0101006 3300046660 Bacteria 1981
560 Ga0495625_0323885 3300046660 Bacteria 981
561 Ga0495661_0076192 3300046665 Bacteria 1947
562 Ga0495647_0015452 3300046681 Bacteria 2676
563 Ga0495658_0029956 3300046683 Bacteria 2951
564 Ga0495613_0088924 3300046689 Bacteria 2238
565 Ga0495671_0007850 3300046692 Bacteria 6036
566 Ga0495671_0081346 3300046692 Bacteria 1587
567 Ga0495600_0251453 3300046809 Bacteria 1124
568 Ga0495660_0002170 3300046810 Bacteria 12640
569 Ga0495660_0005705 3300046810 Bacteria 7436
570 Ga0495660_0128716 3300046810 Bacteria 1272
571 Ga0495674_0060425 3300047319 Bacteria 3307
572 Ga0495674_0122819 3300047319 Bacteria 2193
573 Ga0495672_0019406 3300047320 Bacteria 4484
574 Ga0495672_0071109 3300047320 Bacteria 1970
575 Ga0495683_0007635 3300047323 Bacteria 5824
576 Ga0495687_000001 3300047443 Bacteria 1215582
577 Ga0495673_0000057 3300047469 Bacteria 239715
578 Ga0495673_0000060 3300047469 Bacteria 231642
579 Ga0495673_0001499 3300047469 Bacteria 18453
580 Ga0495681_0005784 3300047470 Bacteria 8219
581 Ga0495686_0000004 3300047472 Bacteria 869019
582 Ga0496110_0139725 3300048913 Bacteria 2190
583 Ga0496114_0118480 3300048917 Bacteria 2275
584 Ga0496114_0350935 3300048917 Bacteria 1305
585 Ga0496116_0174029 3300048919 Bacteria 1162
586 Ga0496118_0107338 3300048921 Bacteria 1865
587 Ga0496120_0013718 3300048923 Bacteria 5440
588 Ga0496121_0063939 3300048924 Bacteria 3003
589 Ga0496122_0064999 3300048925 Bacteria 2649
590 Ga0496122_0121491 3300048925 Bacteria 1683
591 Ga0496123_0005878 3300048926 Bacteria 12142
592 Ga0496124_0030281 3300048927 Bacteria 4806
593 Ga0496124_0161710 3300048927 Bacteria 1744
594 Ga0495678_000001 3300049459 Bacteria 1060340
595 Ga0501033_0162028 3300049570 Bacteria 1610
596 Ga0501033_0267137 3300049570 Bacteria 1210
597 Ga0501034_0000002 3300049571 Bacteria 565510
598 Ga0501034_0105806 3300049571 Bacteria 2806
599 Ga0501034_0419454 3300049571 Bacteria 1260
600 Ga0501037_0070596 3300049573 Bacteria 2541
601 Ga0501038_0042362 3300049574 Bacteria 3965
602 Ga0501039_0284788 3300049575 Bacteria 1299
603 Ga0501043_0427145 3300049579 Bacteria 998
604 Ga0501047_0008255 3300049581 Bacteria 9830
605 Ga0501047_0026878 3300049581 Bacteria 5541
606 Ga0501047_0521984 3300049581 Bacteria 1013
607 Ga0501198_006925 3300049649 Bacteria 1623
608 Ga0501202_032700 3300049652 Bacteria 1092
609 Ga0501207_002857 3300049654 Bacteria 2256
610 Ga0501222_004118 3300049662 Bacteria 1974
611 Ga0501223_001541 3300049663 Bacteria 5309
612 Ga0501224_032780 3300049664 Bacteria 779
613 Ga0501235_016806 3300049669 Bacteria 1617
614 Ga0501243_015685 3300049675 Bacteria 1219
615 Ga0501253_036539 3300049683 Bacteria 968
616 Ga0501253_083495 3300049683 Bacteria 724
617 Ga0501259_002180 3300049688 Bacteria 3209
618 Ga0501261_006510 3300049690 Bacteria 1485
619 Ga0501219_000057 3300049703 Bacteria 18218
620 Ga0501221_002141 3300049704 Bacteria 3281
621 Ga0501225_0002651 3300049705 Bacteria 5495
622 Ga0501225_0007024 3300049705 Bacteria 3276
623 Ga0501225_0125371 3300049705 Bacteria 766
624 Ga0501234_007721 3300049707 Bacteria 1681
625 Ga0501080_0368783 3300049742 Bacteria 1295
626 Ga0501232_006687 3300049757 Bacteria 1194
627 Ga0501280_020643 3300049776 Unclassified 979
628 Ga0501282_009016 3300049778 Bacteria 1070
629 Ga0501035_0559296 3300049822 Unclassified 936
630 Ga0501044_0020052 3300049823 Bacteria 7139
631 Ga0501044_0150927 3300049823 Bacteria 2306
632 Ga0501044_0350670 3300049823 Bacteria 1395
633 Ga0501284_00010 3300050005 Bacteria 136120
634 nmdc:mga0k408_198576_c1 3300050493 Unclassified 1197
635 nmdc:mga0k408_269877_c1 3300050493 Bacteria 1016
636 nmdc:mga05p37_1005544_c1 3300050507 Bacteria 885
637 nmdc:mga05p37_157653_c1 3300050507 Bacteria 2773
638 nmdc:mga05p37_16597_c1 3300050507 Bacteria 5356
639 nmdc:mga09592_165054_c1 3300050508 Bacteria 1914
640 nmdc:mga09592_212040_c1 3300050508 Bacteria 1678
641 nmdc:mga09592_245322_c1 3300050508 Bacteria 1552
642 nmdc:mga09592_41195_c1 3300050508 Bacteria 3883
643 nmdc:mga09592_735425_c1 3300050508 Bacteria 838
644 nmdc:mga0qj67_166438_c1 3300050509 Bacteria 1790
645 nmdc:mga06r32_191576_c1 3300050510 Unclassified 2032
646 nmdc:mga08y16_470308_c1 3300050511 Bacteria 1280
647 nmdc:mga08y16_558049_c1 3300050511 Bacteria 1158
648 Ga0500578_0000136 3300053086 Bacteria 88612
649 Ga0500578_0013503 3300053086 Bacteria 5261
650 Ga0500644_0000268 3300053088 Bacteria 29387
651 Ga0500646_0032395 3300053090 Bacteria 1442
652 Ga0500583_0030990 3300053092 Bacteria 2346
653 Ga0500641_0000161 3300053096 Bacteria 24937
654 Ga0500641_0004448 3300053096 Bacteria 4954
655 Ga0500569_000810 3300053109 Bacteria 5506
656 Ga0500572_050590 3300053111 Bacteria 1237
657 Ga0500618_002053 3300053125 Bacteria 8117
658 Ga0500652_014804 3300053131 Unclassified 2799
659 Ga0500658_0103091 3300053134 Bacteria 1247
660 Ga0500559_0002564 3300053136 Bacteria 9321
661 Ga0500568_0000416 3300053139 Bacteria 32392
662 Ga0500568_0006996 3300053139 Bacteria 5584
663 Ga0500568_0013389 3300053139 Bacteria 3741
664 Ga0500577_0005210 3300053142 Bacteria 3488
665 Ga0500586_046454 3300053145 Bacteria 1488
666 Ga0500588_0006086 3300053146 Unclassified 2712
667 Ga0500603_058476 3300053150 Bacteria 1073
668 Ga0500616_0004904 3300053153 Bacteria 9306
669 Ga0500616_0023189 3300053153 Bacteria 3459
670 Ga0500622_0010853 3300053156 Bacteria 4977
671 Ga0500633_0001348 3300053160 Bacteria 4569
672 Ga0500636_0049515 3300053177 Bacteria 2472
673 Ga0500611_000074 3300053727 Bacteria 39951
674 Ga0500587_007408 3300053739 Bacteria 1429
675 Ga0466962_0105864 3300061719 Bacteria 1352

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041511 Ga0451855_0590891 Ga0451855_0590891_490_1122 191
2 3300044673 Ga0453683_0095431 Ga0453683_0095431_1197_1841 209
3 3300013105 Ga0157369_10098008 Ga0157369_100980083 210
4 3300037418 Ga0395900_0427680 Ga0395900_0427680_627_1262 210
5 3300013296 Ga0157374_10067871 Ga0157374_100678713 212
6 3300049705 Ga0501225_0125371 Ga0501225_0125371_71_751 212
7 3300033180 Ga0307510_10008223 Ga0307510_100082236 214
8 3300031456 Ga0307513_10202249 Ga0307513_102022492 216
9 3300046507 Ga0495606_0004940 Ga0495606_0004940_9827_10528 217
10 iso_pu_bacteria 2738541297 2738827229 218
11 iso_pu_bacteria 2738541357 2739151026 218
12 iso_pu_bacteria 2738543003 2739192945 218
13 iso_pu_bacteria 2738543026 2739319422 218
14 iso_pu_bacteria 2738543029 2739337663 218
15 iso_pu_bacteria 2821131069 2821134586 218
16 iso_pu_bacteria 2857553236 2857557096 218
17 iso_pu_bacteria 2857564685 2857570019 218
18 3300002738 JGI25154J39366_1000495 JGI25154J39366_10004955 219
19 3300003763 Ga0055529_1000100 Ga0055529_10001009 219
20 3300046452 Ga0495617_000005 Ga0495617_000005_174422_175090 219
21 3300046453 Ga0495627_000038 Ga0495627_000038_18897_19565 219
22 3300046463 Ga0495653_0000031 Ga0495653_0000031_21331_21999 219
23 3300046471 Ga0495650_0000480 Ga0495650_0000480_24255_24923 219
24 3300046471 Ga0495650_0005526 Ga0495650_0005526_169_837 219
25 3300046471 Ga0495650_0106035 Ga0495650_0106035_137_805 219
26 3300046474 Ga0495605_0000082 Ga0495605_0000082_850_1518 219
27 3300046492 Ga0495585_0005600 Ga0495585_0005600_766_1434 219
28 3300046507 Ga0495606_0010571 Ga0495606_0010571_6544_7212 219
29 3300046507 Ga0495606_0010684 Ga0495606_0010684_6376_7044 219
30 3300046512 Ga0495610_0000038 Ga0495610_0000038_175448_176116 219
31 3300046520 Ga0495637_0002015 Ga0495637_0002015_10145_10813 219
32 3300046522 Ga0495643_0234791 Ga0495643_0234791_145_813 219
33 3300046523 Ga0495644_0020433 Ga0495644_0020433_269_937 219
34 3300046524 Ga0495648_0016117 Ga0495648_0016117_976_1644 219
35 3300046524 Ga0495648_0139714 Ga0495648_0139714_477_1145 219
36 3300046530 Ga0495654_0000047 Ga0495654_0000047_142249_142917 219
37 3300046530 Ga0495654_0032241 Ga0495654_0032241_1679_2347 219
38 3300046538 Ga0495609_0003278 Ga0495609_0003278_1501_2169 219
39 3300046616 Ga0495668_0005172 Ga0495668_0005172_7771_8439 219
40 3300046660 Ga0495625_0013765 Ga0495625_0013765_5655_6323 219
41 3300046660 Ga0495625_0101006 Ga0495625_0101006_951_1619 219
42 3300046665 Ga0495661_0076192 Ga0495661_0076192_750_1418 219
43 3300046692 Ga0495671_0007850 Ga0495671_0007850_658_1326 219
44 3300046692 Ga0495671_0081346 Ga0495671_0081346_161_829 219
45 3300046810 Ga0495660_0002170 Ga0495660_0002170_2357_3025 219
46 3300046810 Ga0495660_0005705 Ga0495660_0005705_6153_6821 219
47 3300046810 Ga0495660_0128716 Ga0495660_0128716_502_1170 219
48 3300047323 Ga0495683_0007635 Ga0495683_0007635_4612_5280 219
49 3300047469 Ga0495673_0000057 Ga0495673_0000057_238651_239319 219
50 3300047469 Ga0495673_0000060 Ga0495673_0000060_161097_161765 219
51 3300047469 Ga0495673_0001499 Ga0495673_0001499_17390_18058 219
52 3300047470 Ga0495681_0005784 Ga0495681_0005784_6868_7536 219
53 3300048919 Ga0496116_0174029 Ga0496116_0174029_342_1010 219
54 3300048921 Ga0496118_0107338 Ga0496118_0107338_576_1244 219
55 3300048923 Ga0496120_0013718 Ga0496120_0013718_475_1143 219
56 3300048924 Ga0496121_0063939 Ga0496121_0063939_61_729 219
57 3300048925 Ga0496122_0064999 Ga0496122_0064999_500_1168 219
58 3300048925 Ga0496122_0121491 Ga0496122_0121491_343_1011 219
59 3300048926 Ga0496123_0005878 Ga0496123_0005878_908_1576 219
60 3300048927 Ga0496124_0030281 Ga0496124_0030281_741_1409 219
61 3300048927 Ga0496124_0161710 Ga0496124_0161710_407_1075 219
62 3300049459 Ga0495678_000001 Ga0495678_000001_172785_173453 219
63 3300053125 Ga0500618_002053 Ga0500618_002053_6441_7109 219
64 3300053145 Ga0500586_046454 Ga0500586_046454_710_1378 219
65 3300005456 Ga0070678_100572284 Ga0070678_1005722842 220
66 3300013306 Ga0163162_11116772 Ga0163162_111167721 220
67 3300025913 Ga0207695_10185214 Ga0207695_101852142 220
68 3300005337 Ga0070682_100620238 Ga0070682_1006202381 221
69 3300006177 Ga0075362_10013837 Ga0075362_100138372 221
70 3300006353 Ga0075370_10507114 Ga0075370_105071141 221
71 3300026089 Ga0207648_10100431 Ga0207648_101004312 221
72 3300046529 Ga0495652_0587005 Ga0495652_0587005_13_678 221
73 iso_pu_bacteria 2914759650 2914760435 221
74 3300003320 rootH2_10030436 rootH2_100304362 222
75 3300003320 rootH2_10044418 rootH2_100444182 222
76 3300028794 Ga0307515_10000002 Ga0307515_10000002214 222
77 3300044693 Ga0466961_0314608 Ga0466961_0314608_57_752 222
78 3300003320 rootH2_10035373 rootH2_100353732 223
79 3300005539 Ga0068853_100000862 Ga0068853_10000086219 223
80 3300005983 Ga0081540_1005881 Ga0081540_10058817 223
81 3300006358 Ga0068871_100139315 Ga0068871_1001393152 223
82 3300009093 Ga0105240_10018088 Ga0105240_100180882 223
83 3300009093 Ga0105240_10055447 Ga0105240_100554474 223
84 3300009093 Ga0105240_10274119 Ga0105240_102741192 223
85 3300009545 Ga0105237_10001017 Ga0105237_1000101719 223
86 3300009551 Ga0105238_10943333 Ga0105238_109433331 223
87 3300010375 Ga0105239_10000436 Ga0105239_1000043659 223
88 3300010375 Ga0105239_10052181 Ga0105239_100521812 223
89 3300010375 Ga0105239_10220863 Ga0105239_102208632 223
90 3300013296 Ga0157374_10000001 Ga0157374_10000001417 223
91 3300013307 Ga0157372_10000595 Ga0157372_1000059527 223
92 3300014969 Ga0157376_10023949 Ga0157376_100239493 223
93 3300025913 Ga0207695_10000084 Ga0207695_100000849 223
94 3300025914 Ga0207671_10001353 Ga0207671_1000135318 223
95 3300025924 Ga0207694_10332733 Ga0207694_103327331 223
96 3300025949 Ga0207667_10100740 Ga0207667_101007402 223
97 3300026041 Ga0207639_10019483 Ga0207639_100194832 223
98 3300031251 Ga0265327_10000729 Ga0265327_1000072911 223
99 3300044683 Ga0466965_0074204 Ga0466965_0074204_808_1494 223
100 3300044693 Ga0466961_0018217 Ga0466961_0018217_2339_3016 223
101 3300044719 Ga0466971_0164791 Ga0466971_0164791_53_730 223
102 3300045049 Ga0466959_0011513 Ga0466959_0011513_132_809 223
103 3300045836 Ga0466958_0417503 Ga0466958_0417503_166_843 223
104 3300046528 Ga0495642_0035308 Ga0495642_0035308_686_1369 223
105 3300046660 Ga0495625_0323885 Ga0495625_0323885_255_935 223
106 3300049703 Ga0501219_000057 Ga0501219_000057_3893_4570 223
107 3300050005 Ga0501284_00010 Ga0501284_00010_42797_43474 223
108 3300050493 nmdc:mga0k408_198576_c1 nmdc:mga0k408_198576_c1_398_1075 223
109 3300061719 Ga0466962_0105864 Ga0466962_0105864_639_1316 223
110 3300002459 JGI24751J29686_10000878 JGI24751J29686_100008786 224
111 3300003322 rootL2_10002240 rootL2_100022402 224
112 3300005329 Ga0070683_100427908 Ga0070683_1004279081 224
113 3300005330 Ga0070690_100075264 Ga0070690_1000752642 224
114 3300005331 Ga0070670_100010352 Ga0070670_1000103526 224
115 3300005331 Ga0070670_100353460 Ga0070670_1003534602 224
116 3300005331 Ga0070670_100789649 Ga0070670_1007896491 224
117 3300005335 Ga0070666_10255039 Ga0070666_102550392 224
118 3300005338 Ga0068868_100087536 Ga0068868_1000875362 224
119 3300005355 Ga0070671_100287385 Ga0070671_1002873852 224
120 3300005366 Ga0070659_100088862 Ga0070659_1000888622 224
121 3300005458 Ga0070681_10548516 Ga0070681_105485161 224
122 3300005539 Ga0068853_100012555 Ga0068853_1000125554 224
123 3300005539 Ga0068853_100316906 Ga0068853_1003169062 224
124 3300005577 Ga0068857_100004225 Ga0068857_1000042256 224
125 3300005577 Ga0068857_100215589 Ga0068857_1002155892 224
126 3300005578 Ga0068854_100016394 Ga0068854_1000163943 224
127 3300005614 Ga0068856_100049890 Ga0068856_1000498902 224
128 3300005616 Ga0068852_100027478 Ga0068852_1000274782 224
129 3300005618 Ga0068864_100112896 Ga0068864_1001128961 224
130 3300005718 Ga0068866_10024684 Ga0068866_100246842 224
131 3300005843 Ga0068860_100036355 Ga0068860_1000363552 224
132 3300005843 Ga0068860_100168483 Ga0068860_1001684832 224
133 3300006844 Ga0075428_100057845 Ga0075428_1000578453 224
134 3300006847 Ga0075431_100019063 Ga0075431_1000190633 224
135 3300009093 Ga0105240_10116414 Ga0105240_101164142 224
136 3300009093 Ga0105240_10124078 Ga0105240_101240782 224
137 3300009147 Ga0114129_10043343 Ga0114129_100433431 224
138 3300009174 Ga0105241_10267194 Ga0105241_102671942 224
139 3300009545 Ga0105237_10042813 Ga0105237_100428132 224
140 3300009545 Ga0105237_10058858 Ga0105237_100588582 224
141 3300009553 Ga0105249_10001004 Ga0105249_1000100415 224
142 3300010375 Ga0105239_10018021 Ga0105239_100180212 224
143 3300013104 Ga0157370_10016530 Ga0157370_100165302 224
144 3300013105 Ga0157369_10010809 Ga0157369_100108093 224
145 3300013297 Ga0157378_10415797 Ga0157378_104157972 224
146 3300013297 Ga0157378_10899656 Ga0157378_108996561 224
147 3300013307 Ga0157372_10002860 Ga0157372_100028603 224
148 3300025899 Ga0207642_10058208 Ga0207642_100582082 224
149 3300025904 Ga0207647_10004651 Ga0207647_100046512 224
150 3300025913 Ga0207695_10045209 Ga0207695_100452093 224
151 3300025914 Ga0207671_10019690 Ga0207671_100196903 224
152 3300025914 Ga0207671_10030012 Ga0207671_100300122 224
153 3300025925 Ga0207650_10012336 Ga0207650_100123365 224
154 3300025925 Ga0207650_10390509 Ga0207650_103905092 224
155 3300025925 Ga0207650_10586318 Ga0207650_105863182 224
156 3300025944 Ga0207661_10528799 Ga0207661_105287991 224
157 3300025949 Ga0207667_10001676 Ga0207667_1000167619 224
158 3300025961 Ga0207712_10005926 Ga0207712_100059264 224
159 3300026023 Ga0207677_10049561 Ga0207677_100495612 224
160 3300026041 Ga0207639_10023273 Ga0207639_100232732 224
161 3300026041 Ga0207639_10040686 Ga0207639_100406863 224
162 3300026089 Ga0207648_10183046 Ga0207648_101830462 224
163 3300026095 Ga0207676_10013789 Ga0207676_100137893 224
164 3300026116 Ga0207674_10001819 Ga0207674_100018194 224
165 3300026116 Ga0207674_10049407 Ga0207674_100494071 224
166 3300026118 Ga0207675_100318837 Ga0207675_1003188372 224
167 3300026142 Ga0207698_10014385 Ga0207698_100143854 224
168 3300028381 Ga0268264_10006805 Ga0268264_100068052 224
169 3300032004 Ga0307414_10572589 Ga0307414_105725891 224
170 3300044842 Ga0466957_0008397 Ga0466957_0008397_761_1441 224
171 3300050508 nmdc:mga09592_41195_c1 nmdc:mga09592_41195_c1_2892_3569 224
172 3300050510 nmdc:mga06r32_191576_c1 nmdc:mga06r32_191576_c1_568_1245 224
173 3300053146 Ga0500588_0006086 Ga0500588_0006086_28_711 224
174 iso_pu_bacteria 2818991442 2819572394 224
175 iso_pu_bacteria 2821136567 2821140234 224
176 iso_pu_bacteria 2904467357 2904472357 224
177 3300003320 rootH2_10265654 rootH2_102656542 225
178 3300003322 rootL2_10213538 rootL2_102135382 225
179 3300003323 rootH1_10159857 rootH1_101598572 225
180 3300005337 Ga0070682_100000436 Ga0070682_10000043613 225
181 3300005341 Ga0070691_10000902 Ga0070691_1000090211 225
182 3300005347 Ga0070668_100265854 Ga0070668_1002658541 225
183 3300005457 Ga0070662_100264293 Ga0070662_1002642931 225
184 3300005458 Ga0070681_10283823 Ga0070681_102838231 225
185 3300005530 Ga0070679_100006566 Ga0070679_1000065662 225
186 3300005547 Ga0070693_100045301 Ga0070693_1000453012 225
187 3300005563 Ga0068855_100403016 Ga0068855_1004030162 225
188 3300005577 Ga0068857_100165906 Ga0068857_1001659061 225
189 3300005614 Ga0068856_100041808 Ga0068856_1000418082 225
190 3300005617 Ga0068859_100287176 Ga0068859_1002871762 225
191 3300005719 Ga0068861_100028014 Ga0068861_1000280142 225
192 3300005841 Ga0068863_100691596 Ga0068863_1006915962 225
193 3300005843 Ga0068860_100000097 Ga0068860_10000009724 225
194 3300006358 Ga0068871_100024610 Ga0068871_1000246102 225
195 3300006931 Ga0097620_100287146 Ga0097620_1002871462 225
196 3300009093 Ga0105240_10005151 Ga0105240_1000515113 225
197 3300009101 Ga0105247_10372700 Ga0105247_103727002 225
198 3300009174 Ga0105241_10000224 Ga0105241_100002242 225
199 3300009174 Ga0105241_10068803 Ga0105241_100688033 225
200 3300009545 Ga0105237_10011860 Ga0105237_100118606 225
201 3300009545 Ga0105237_10357436 Ga0105237_103574362 225
202 3300010375 Ga0105239_10000950 Ga0105239_1000095029 225
203 3300013102 Ga0157371_10045471 Ga0157371_100454712 225
204 3300013102 Ga0157371_10343877 Ga0157371_103438771 225
205 3300013104 Ga0157370_10004443 Ga0157370_100044432 225
206 3300013104 Ga0157370_10056510 Ga0157370_100565102 225
207 3300013296 Ga0157374_10144131 Ga0157374_101441312 225
208 3300013306 Ga0163162_10002183 Ga0163162_1000218315 225
209 3300013307 Ga0157372_10441827 Ga0157372_104418271 225
210 3300014969 Ga0157376_10004691 Ga0157376_100046917 225
211 3300025911 Ga0207654_10009301 Ga0207654_100093014 225
212 3300025912 Ga0207707_10000574 Ga0207707_1000057429 225
213 3300025913 Ga0207695_10028249 Ga0207695_100282492 225
214 3300025917 Ga0207660_10015118 Ga0207660_100151181 225
215 3300025918 Ga0207662_10364559 Ga0207662_103645591 225
216 3300025921 Ga0207652_10040033 Ga0207652_100400331 225
217 3300025933 Ga0207706_10367470 Ga0207706_103674702 225
218 3300025949 Ga0207667_10015139 Ga0207667_100151396 225
219 3300025949 Ga0207667_10332416 Ga0207667_103324162 225
220 3300026041 Ga0207639_10111886 Ga0207639_101118862 225
221 3300026041 Ga0207639_10158858 Ga0207639_101588582 225
222 3300026078 Ga0207702_10368187 Ga0207702_103681871 225
223 3300026088 Ga0207641_10102556 Ga0207641_101025562 225
224 3300026116 Ga0207674_10191428 Ga0207674_101914281 225
225 3300026142 Ga0207698_10218981 Ga0207698_102189811 225
226 3300028379 Ga0268266_10000038 Ga0268266_10000038188 225
227 3300028381 Ga0268264_10000525 Ga0268264_1000052524 225
228 3300028794 Ga0307515_10310094 Ga0307515_103100942 225
229 3300031251 Ga0265327_10056116 Ga0265327_100561162 225
230 3300031456 Ga0307513_10148404 Ga0307513_101484042 225
231 3300031456 Ga0307513_10517973 Ga0307513_105179731 225
232 3300031507 Ga0307509_10057770 Ga0307509_100577703 225
233 3300031507 Ga0307509_10111693 Ga0307509_101116932 225
234 3300031616 Ga0307508_10067009 Ga0307508_100670093 225
235 3300031730 Ga0307516_10003848 Ga0307516_100038481 225
236 3300031730 Ga0307516_10280655 Ga0307516_102806552 225
237 3300041404 Ga0439436_0054285 Ga0439436_0054285_27_713 225
238 3300041406 Ga0439439_0048161 Ga0439439_0048161_89_772 225
239 3300041511 Ga0451855_1969024 Ga0451855_1969024_434_1123 225
240 3300041512 Ga0451853_2224368 Ga0451853_2224368_655_1353 225
241 3300042007 Ga0439449_0006096 Ga0439449_0006096_3667_4359 225
242 3300044656 Ga0466969_0002777 Ga0466969_0002777_2773_3474 225
243 3300044658 Ga0466972_0000102 Ga0466972_0000102_6377_7069 225
244 3300044658 Ga0466972_0000639 Ga0466972_0000639_10275_10961 225
245 3300044658 Ga0466972_0006790 Ga0466972_0006790_2469_3161 225
246 3300044673 Ga0453683_0247990 Ga0453683_0247990_118_804 225
247 3300045049 Ga0466959_0000017 Ga0466959_0000017_9544_10245 225
248 3300046524 Ga0495648_0074059 Ga0495648_0074059_1039_1725 225
249 3300047443 Ga0495687_000001 Ga0495687_000001_668597_669283 225
250 3300049571 Ga0501034_0419454 Ga0501034_0419454_514_1206 225
251 3300049579 Ga0501043_0427145 Ga0501043_0427145_50_742 225
252 3300049581 Ga0501047_0026878 Ga0501047_0026878_1066_1758 225
253 3300049649 Ga0501198_006925 Ga0501198_006925_372_1055 225
254 3300049652 Ga0501202_032700 Ga0501202_032700_327_1010 225
255 3300049654 Ga0501207_002857 Ga0501207_002857_757_1440 225
256 3300049662 Ga0501222_004118 Ga0501222_004118_63_746 225
257 3300049663 Ga0501223_001541 Ga0501223_001541_431_1114 225
258 3300049664 Ga0501224_032780 Ga0501224_032780_77_760 225
259 3300049669 Ga0501235_016806 Ga0501235_016806_95_778 225
260 3300049675 Ga0501243_015685 Ga0501243_015685_51_734 225
261 3300049683 Ga0501253_036539 Ga0501253_036539_172_855 225
262 3300049688 Ga0501259_002180 Ga0501259_002180_1266_1949 225
263 3300049690 Ga0501261_006510 Ga0501261_006510_335_1018 225
264 3300049704 Ga0501221_002141 Ga0501221_002141_545_1228 225
265 3300049705 Ga0501225_0002651 Ga0501225_0002651_3138_3836 225
266 3300049705 Ga0501225_0007024 Ga0501225_0007024_2119_2802 225
267 3300049707 Ga0501234_007721 Ga0501234_007721_689_1372 225
268 3300049757 Ga0501232_006687 Ga0501232_006687_434_1117 225
269 3300049778 Ga0501282_009016 Ga0501282_009016_63_746 225
270 3300049823 Ga0501044_0020052 Ga0501044_0020052_2187_2879 225
271 3300050507 nmdc:mga05p37_16597_c1 nmdc:mga05p37_16597_c1_2535_3218 225
272 3300053086 Ga0500578_0000136 Ga0500578_0000136_63878_64570 225
273 3300053086 Ga0500578_0013503 Ga0500578_0013503_1437_2129 225
274 3300053111 Ga0500572_050590 Ga0500572_050590_176_874 225
275 3300053131 Ga0500652_014804 Ga0500652_014804_1981_2685 225
276 3300053139 Ga0500568_0006996 Ga0500568_0006996_1017_1703 225
277 3300053150 Ga0500603_058476 Ga0500603_058476_89_790 225
278 3300053153 Ga0500616_0023189 Ga0500616_0023189_1169_1867 225
279 3300053156 Ga0500622_0010853 Ga0500622_0010853_3868_4554 225
280 3300053739 Ga0500587_007408 Ga0500587_007408_550_1254 225
281 iso_pu_bacteria 2840677318 2840677799 225
282 iso_pu_bacteria 2883068021 2883071068 225
283 iso_pu_bacteria 2884791551 2884797953 225
284 iso_pu_bacteria 2896085136 2896085617 225
285 iso_pu_bacteria 2896109856 2896113825 225
286 iso_pu_bacteria 2929177148 2929182910 225
287 iso_pu_bacteria 2945977869 2945978868 225
288 iso_pu_bacteria 2946013367 2946015266 225
289 3300005288 Ga0065714_10118317 Ga0065714_101183172 226
290 3300005289 Ga0065704_10157563 Ga0065704_101575631 226
291 3300005290 Ga0065712_10134766 Ga0065712_101347662 226
292 3300005293 Ga0065715_10032656 Ga0065715_100326562 226
293 3300005295 Ga0065707_10115278 Ga0065707_101152781 226
294 3300005295 Ga0065707_10239343 Ga0065707_102393431 226
295 3300005327 Ga0070658_10635485 Ga0070658_106354851 226
296 3300005328 Ga0070676_10002015 Ga0070676_100020154 226
297 3300005328 Ga0070676_10026397 Ga0070676_100263972 226
298 3300005328 Ga0070676_10078119 Ga0070676_100781192 226
299 3300005329 Ga0070683_100006190 Ga0070683_1000061903 226
300 3300005329 Ga0070683_100144781 Ga0070683_1001447812 226
301 3300005329 Ga0070683_100432397 Ga0070683_1004323971 226
302 3300005329 Ga0070683_100938709 Ga0070683_1009387091 226
303 3300005330 Ga0070690_100080739 Ga0070690_1000807392 226
304 3300005331 Ga0070670_100109869 Ga0070670_1001098692 226
305 3300005331 Ga0070670_100155603 Ga0070670_1001556033 226
306 3300005331 Ga0070670_100655742 Ga0070670_1006557421 226
307 3300005331 Ga0070670_100669057 Ga0070670_1006690571 226
308 3300005334 Ga0068869_100746194 Ga0068869_1007461941 226
309 3300005335 Ga0070666_10003629 Ga0070666_100036294 226
310 3300005338 Ga0068868_100016918 Ga0068868_1000169182 226
311 3300005339 Ga0070660_100225733 Ga0070660_1002257332 226
312 3300005340 Ga0070689_100148146 Ga0070689_1001481461 226
313 3300005347 Ga0070668_100000401 Ga0070668_10000040117 226
314 3300005347 Ga0070668_100635383 Ga0070668_1006353831 226
315 3300005353 Ga0070669_100417189 Ga0070669_1004171891 226
316 3300005354 Ga0070675_100131429 Ga0070675_1001314292 226
317 3300005354 Ga0070675_100324930 Ga0070675_1003249301 226
318 3300005354 Ga0070675_100381000 Ga0070675_1003810001 226
319 3300005356 Ga0070674_100079478 Ga0070674_1000794782 226
320 3300005364 Ga0070673_100050165 Ga0070673_1000501652 226
321 3300005365 Ga0070688_100049115 Ga0070688_1000491152 226
322 3300005365 Ga0070688_100053780 Ga0070688_1000537802 226
323 3300005367 Ga0070667_100000533 Ga0070667_10000053310 226
324 3300005367 Ga0070667_100135381 Ga0070667_1001353812 226
325 3300005457 Ga0070662_100387975 Ga0070662_1003879752 226
326 3300005459 Ga0068867_100150829 Ga0068867_1001508292 226
327 3300005466 Ga0070685_10171506 Ga0070685_101715061 226
328 3300005471 Ga0070698_100000791 Ga0070698_10000079111 226
329 3300005471 Ga0070698_100004354 Ga0070698_1000043549 226
330 3300005535 Ga0070684_100582146 Ga0070684_1005821461 226
331 3300005539 Ga0068853_100130045 Ga0068853_1001300452 226
332 3300005539 Ga0068853_100348311 Ga0068853_1003483112 226
333 3300005539 Ga0068853_100674548 Ga0068853_1006745481 226
334 3300005543 Ga0070672_100001693 Ga0070672_1000016939 226
335 3300005543 Ga0070672_100151119 Ga0070672_1001511192 226
336 3300005543 Ga0070672_100821786 Ga0070672_1008217861 226
337 3300005544 Ga0070686_100179147 Ga0070686_1001791472 226
338 3300005544 Ga0070686_100504154 Ga0070686_1005041541 226
339 3300005544 Ga0070686_100673244 Ga0070686_1006732441 226
340 3300005548 Ga0070665_100002361 Ga0070665_10000236118 226
341 3300005548 Ga0070665_100277083 Ga0070665_1002770831 226
342 3300005563 Ga0068855_100001333 Ga0068855_1000013339 226
343 3300005563 Ga0068855_100059968 Ga0068855_1000599683 226
344 3300005564 Ga0070664_100013343 Ga0070664_1000133433 226
345 3300005564 Ga0070664_100228262 Ga0070664_1002282623 226
346 3300005564 Ga0070664_100420607 Ga0070664_1004206072 226
347 3300005578 Ga0068854_100214933 Ga0068854_1002149332 226
348 3300005616 Ga0068852_100027026 Ga0068852_1000270265 226
349 3300005616 Ga0068852_100259873 Ga0068852_1002598732 226
350 3300005616 Ga0068852_100556611 Ga0068852_1005566112 226
351 3300005617 Ga0068859_100140602 Ga0068859_1001406022 226
352 3300005617 Ga0068859_100196183 Ga0068859_1001961833 226
353 3300005617 Ga0068859_100383246 Ga0068859_1003832462 226
354 3300005618 Ga0068864_100000697 Ga0068864_1000006979 226
355 3300005618 Ga0068864_100036995 Ga0068864_1000369953 226
356 3300005618 Ga0068864_100283670 Ga0068864_1002836701 226
357 3300005718 Ga0068866_10469036 Ga0068866_104690361 226
358 3300005719 Ga0068861_100051919 Ga0068861_1000519192 226
359 3300005719 Ga0068861_100324608 Ga0068861_1003246081 226
360 3300005834 Ga0068851_10048655 Ga0068851_100486551 226
361 3300005841 Ga0068863_100017171 Ga0068863_1000171711 226
362 3300005841 Ga0068863_100086885 Ga0068863_1000868852 226
363 3300005841 Ga0068863_100134090 Ga0068863_1001340903 226
364 3300005842 Ga0068858_100002045 Ga0068858_1000020454 226
365 3300005843 Ga0068860_100002600 Ga0068860_1000026002 226
366 3300005844 Ga0068862_100328193 Ga0068862_1003281932 226
367 3300006237 Ga0097621_100002514 Ga0097621_1000025148 226
368 3300006237 Ga0097621_100053932 Ga0097621_1000539323 226
369 3300006358 Ga0068871_100023999 Ga0068871_1000239993 226
370 3300006358 Ga0068871_100060922 Ga0068871_1000609223 226
371 3300006844 Ga0075428_100820862 Ga0075428_1008208622 226
372 3300006881 Ga0068865_100017180 Ga0068865_1000171802 226
373 3300006881 Ga0068865_100599920 Ga0068865_1005999201 226
374 3300006931 Ga0097620_100140601 Ga0097620_1001406012 226
375 3300006931 Ga0097620_100196186 Ga0097620_1001961863 226
376 3300006931 Ga0097620_100383216 Ga0097620_1003832162 226
377 3300009011 Ga0105251_10132350 Ga0105251_101323502 226
378 3300009093 Ga0105240_10001904 Ga0105240_1000190426 226
379 3300009093 Ga0105240_10003186 Ga0105240_1000318622 226
380 3300009093 Ga0105240_10100537 Ga0105240_101005373 226
381 3300009098 Ga0105245_10580144 Ga0105245_105801442 226
382 3300009147 Ga0114129_11172992 Ga0114129_111729922 226
383 3300009174 Ga0105241_10000614 Ga0105241_1000061423 226
384 3300009176 Ga0105242_10031974 Ga0105242_100319741 226
385 3300009176 Ga0105242_10090660 Ga0105242_100906601 226
386 3300009177 Ga0105248_10011550 Ga0105248_100115505 226
387 3300009545 Ga0105237_10221775 Ga0105237_102217752 226
388 3300009551 Ga0105238_10069232 Ga0105238_100692321 226
389 3300009551 Ga0105238_10153848 Ga0105238_101538482 226
390 3300009551 Ga0105238_10768409 Ga0105238_107684091 226
391 3300009551 Ga0105238_11238130 Ga0105238_112381301 226
392 3300009553 Ga0105249_10020949 Ga0105249_100209495 226
393 3300009553 Ga0105249_10418161 Ga0105249_104181612 226
394 3300010375 Ga0105239_10311490 Ga0105239_103114902 226
395 3300013100 Ga0157373_10004590 Ga0157373_100045909 226
396 3300013102 Ga0157371_10016646 Ga0157371_100166462 226
397 3300013102 Ga0157371_10108651 Ga0157371_101086512 226
398 3300013104 Ga0157370_10039463 Ga0157370_100394633 226
399 3300013105 Ga0157369_10141867 Ga0157369_101418672 226
400 3300013296 Ga0157374_10043425 Ga0157374_100434253 226
401 3300013296 Ga0157374_10458457 Ga0157374_104584571 226
402 3300013297 Ga0157378_10007269 Ga0157378_100072695 226
403 3300013297 Ga0157378_10105414 Ga0157378_101054141 226
404 3300013306 Ga0163162_10056597 Ga0163162_100565971 226
405 3300013306 Ga0163162_10073563 Ga0163162_100735633 226
406 3300013306 Ga0163162_10099428 Ga0163162_100994281 226
407 3300013307 Ga0157372_10123578 Ga0157372_101235784 226
408 3300013307 Ga0157372_10193476 Ga0157372_101934762 226
409 3300013307 Ga0157372_10500768 Ga0157372_105007682 226
410 3300013307 Ga0157372_11362987 Ga0157372_113629871 226
411 3300013308 Ga0157375_10157860 Ga0157375_101578602 226
412 3300013308 Ga0157375_10229430 Ga0157375_102294304 226
413 3300013308 Ga0157375_10366991 Ga0157375_103669911 226
414 3300014325 Ga0163163_10000254 Ga0163163_100002542 226
415 3300014325 Ga0163163_10306165 Ga0163163_103061652 226
416 3300014325 Ga0163163_10562626 Ga0163163_105626261 226
417 3300014326 Ga0157380_10031820 Ga0157380_100318201 226
418 3300014326 Ga0157380_10583785 Ga0157380_105837852 226
419 3300014326 Ga0157380_10900803 Ga0157380_109008032 226
420 3300014745 Ga0157377_10072135 Ga0157377_100721352 226
421 3300014745 Ga0157377_10268223 Ga0157377_102682232 226
422 3300014968 Ga0157379_10000834 Ga0157379_1000083414 226
423 3300014969 Ga0157376_10082968 Ga0157376_100829681 226
424 3300014969 Ga0157376_10114509 Ga0157376_101145092 226
425 3300017792 Ga0163161_10032911 Ga0163161_100329113 226
426 3300017792 Ga0163161_10330948 Ga0163161_103309481 226
427 3300017792 Ga0163161_10589028 Ga0163161_105890281 226
428 3300025321 Ga0207656_10058306 Ga0207656_100583061 226
429 3300025321 Ga0207656_10154167 Ga0207656_101541672 226
430 3300025899 Ga0207642_10132087 Ga0207642_101320872 226
431 3300025903 Ga0207680_10000847 Ga0207680_100008476 226
432 3300025907 Ga0207645_10001168 Ga0207645_100011685 226
433 3300025907 Ga0207645_10012253 Ga0207645_100122534 226
434 3300025908 Ga0207643_10045475 Ga0207643_100454752 226
435 3300025913 Ga0207695_10000076 Ga0207695_100000769 226
436 3300025913 Ga0207695_10000090 Ga0207695_100000909 226
437 3300025918 Ga0207662_10045653 Ga0207662_100456532 226
438 3300025920 Ga0207649_10104806 Ga0207649_101048063 226
439 3300025920 Ga0207649_10109016 Ga0207649_101090161 226
440 3300025920 Ga0207649_10643792 Ga0207649_106437921 226
441 3300025923 Ga0207681_10087502 Ga0207681_100875022 226
442 3300025924 Ga0207694_10048175 Ga0207694_100481751 226
443 3300025924 Ga0207694_10064195 Ga0207694_100641952 226
444 3300025925 Ga0207650_10047872 Ga0207650_100478722 226
445 3300025925 Ga0207650_10100195 Ga0207650_101001952 226
446 3300025925 Ga0207650_10140969 Ga0207650_101409691 226
447 3300025925 Ga0207650_10409483 Ga0207650_104094831 226
448 3300025926 Ga0207659_10133973 Ga0207659_101339731 226
449 3300025926 Ga0207659_10353755 Ga0207659_103537552 226
450 3300025931 Ga0207644_10148048 Ga0207644_101480481 226
451 3300025933 Ga0207706_10057757 Ga0207706_100577572 226
452 3300025933 Ga0207706_10507906 Ga0207706_105079062 226
453 3300025934 Ga0207686_10020673 Ga0207686_100206731 226
454 3300025934 Ga0207686_10051166 Ga0207686_100511662 226
455 3300025935 Ga0207709_10226143 Ga0207709_102261431 226
456 3300025936 Ga0207670_10067709 Ga0207670_100677092 226
457 3300025938 Ga0207704_10005751 Ga0207704_100057515 226
458 3300025940 Ga0207691_10000835 Ga0207691_1000083515 226
459 3300025940 Ga0207691_10011149 Ga0207691_100111492 226
460 3300025940 Ga0207691_10149323 Ga0207691_101493232 226
461 3300025940 Ga0207691_10253973 Ga0207691_102539731 226
462 3300025942 Ga0207689_10027179 Ga0207689_100271794 226
463 3300025942 Ga0207689_10725778 Ga0207689_107257781 226
464 3300025944 Ga0207661_10007166 Ga0207661_100071665 226
465 3300025944 Ga0207661_10017068 Ga0207661_100170684 226
466 3300025944 Ga0207661_10112482 Ga0207661_101124822 226
467 3300025944 Ga0207661_10869637 Ga0207661_108696371 226
468 3300025945 Ga0207679_10008161 Ga0207679_100081614 226
469 3300025949 Ga0207667_10000911 Ga0207667_1000091114 226
470 3300025949 Ga0207667_10051804 Ga0207667_100518042 226
471 3300025949 Ga0207667_10987775 Ga0207667_109877752 226
472 3300025960 Ga0207651_10001175 Ga0207651_100011752 226
473 3300025960 Ga0207651_10463322 Ga0207651_104633221 226
474 3300025961 Ga0207712_10002266 Ga0207712_1000226611 226
475 3300025961 Ga0207712_10057660 Ga0207712_100576602 226
476 3300025961 Ga0207712_10193269 Ga0207712_101932691 226
477 3300025961 Ga0207712_10548180 Ga0207712_105481801 226
478 3300025972 Ga0207668_10000881 Ga0207668_1000088112 226
479 3300025972 Ga0207668_10060441 Ga0207668_100604412 226
480 3300025986 Ga0207658_10001477 Ga0207658_100014772 226
481 3300026023 Ga0207677_10263284 Ga0207677_102632842 226
482 3300026035 Ga0207703_10011298 Ga0207703_100112983 226
483 3300026041 Ga0207639_10102348 Ga0207639_101023482 226
484 3300026041 Ga0207639_10132276 Ga0207639_101322762 226
485 3300026041 Ga0207639_10252731 Ga0207639_102527311 226
486 3300026041 Ga0207639_10313968 Ga0207639_103139682 226
487 3300026067 Ga0207678_10035118 Ga0207678_100351182 226
488 3300026075 Ga0207708_10333639 Ga0207708_103336392 226
489 3300026088 Ga0207641_10006594 Ga0207641_100065942 226
490 3300026088 Ga0207641_10023686 Ga0207641_100236861 226
491 3300026088 Ga0207641_10256143 Ga0207641_102561432 226
492 3300026089 Ga0207648_10001518 Ga0207648_1000151811 226
493 3300026095 Ga0207676_10003724 Ga0207676_100037244 226
494 3300026095 Ga0207676_10383994 Ga0207676_103839942 226
495 3300026116 Ga0207674_10191432 Ga0207674_101914322 226
496 3300026118 Ga0207675_100129414 Ga0207675_1001294142 226
497 3300026118 Ga0207675_100961924 Ga0207675_1009619242 226
498 3300028379 Ga0268266_10007473 Ga0268266_100074733 226
499 3300028379 Ga0268266_10364279 Ga0268266_103642791 226
500 3300028380 Ga0268265_10697715 Ga0268265_106977151 226
501 3300028381 Ga0268264_10018300 Ga0268264_100183002 226
502 3300031824 Ga0307413_10139242 Ga0307413_101392422 226
503 3300032004 Ga0307414_10066550 Ga0307414_100665501 226
504 3300035398 Ga0316574_0270919 Ga0316574_0270919_145_843 226
505 3300035692 Ga0373935_0128425 Ga0373935_0128425_299_1021 226
506 3300036712 Ga0316584_0016898 Ga0316584_0016898_782_1480 226
507 3300037471 Ga0395905_0076975 Ga0395905_0076975_323_1003 226
508 3300041511 Ga0451855_1209573 Ga0451855_1209573_791_1480 226
509 3300041511 Ga0451855_2010349 Ga0451855_2010349_1917_2609 226
510 3300042007 Ga0439449_0002035 Ga0439449_0002035_212_901 226
511 3300042014 Ga0439457_012705 Ga0439457_012705_725_1414 226
512 3300044735 Ga0466968_0096002 Ga0466968_0096002_114_824 226
513 3300046648 Ga0495611_0001301 Ga0495611_0001301_9344_10063 226
514 3300046809 Ga0495600_0251453 Ga0495600_0251453_369_1091 226
515 3300047320 Ga0495672_0019406 Ga0495672_0019406_3741_4424 226
516 3300048913 Ga0496110_0139725 Ga0496110_0139725_1214_1906 226
517 3300048917 Ga0496114_0118480 Ga0496114_0118480_840_1532 226
518 3300050507 nmdc:mga05p37_1005544_c1 nmdc:mga05p37_1005544_c1_129_872 226
519 3300050511 nmdc:mga08y16_470308_c1 nmdc:mga08y16_470308_c1_546_1229 226
520 3300050511 nmdc:mga08y16_558049_c1 nmdc:mga08y16_558049_c1_277_981 226
521 3300053096 Ga0500641_0000161 Ga0500641_0000161_9110_9802 226
522 3300053139 Ga0500568_0000416 Ga0500568_0000416_15275_15958 226
523 3300053727 Ga0500611_000074 Ga0500611_000074_3055_3738 226
524 iso_pu_bacteria 2881955468 2881957188 226
525 iso_pu_bacteria 2929921140 2929927317 226
526 iso_pu_bacteria 8003151029 8003151202 226
527 3300003316 rootH1_10061546 rootH1_100615462 227
528 3300005329 Ga0070683_100313284 Ga0070683_1003132842 227
529 3300005334 Ga0068869_100027165 Ga0068869_1000271651 227
530 3300005367 Ga0070667_100034803 Ga0070667_1000348031 227
531 3300005549 Ga0070704_100444270 Ga0070704_1004442702 227
532 3300005841 Ga0068863_100220732 Ga0068863_1002207323 227
533 3300005843 Ga0068860_100283406 Ga0068860_1002834062 227
534 3300005844 Ga0068862_100578801 Ga0068862_1005788011 227
535 3300006844 Ga0075428_100243033 Ga0075428_1002430333 227
536 3300006844 Ga0075428_100316736 Ga0075428_1003167362 227
537 3300006880 Ga0075429_100558675 Ga0075429_1005586752 227
538 3300009094 Ga0111539_10038533 Ga0111539_100385332 227
539 3300009147 Ga0114129_10055854 Ga0114129_100558544 227
540 3300009148 Ga0105243_10163300 Ga0105243_101633002 227
541 3300009553 Ga0105249_10307793 Ga0105249_103077932 227
542 3300013297 Ga0157378_10840759 Ga0157378_108407592 227
543 3300014326 Ga0157380_10108857 Ga0157380_101088572 227
544 3300025942 Ga0207689_10003622 Ga0207689_1000362210 227
545 3300025961 Ga0207712_10611057 Ga0207712_106110572 227
546 3300030731 Ga0316177_1221645 Ga0316177_12216451 227
547 3300031727 Ga0316576_10281721 Ga0316576_102817212 227
548 3300035398 Ga0316574_0150691 Ga0316574_0150691_368_1066 227
549 3300035398 Ga0316574_0196822 Ga0316574_0196822_487_1182 227
550 3300036647 Ga0316582_0591881 Ga0316582_0591881_49_753 227
551 3300036712 Ga0316584_0061774 Ga0316584_0061774_263_967 227
552 3300037312 Ga0395899_0000159 Ga0395899_0000159_24532_25233 227
553 3300041463 Ga0451804_0285986 Ga0451804_0285986_114_797 227
554 3300042002 Ga0439442_002870 Ga0439442_002870_1468_2154 227
555 3300042004 Ga0439445_0002485 Ga0439445_0002485_613_1299 227
556 3300042014 Ga0439457_019823 Ga0439457_019823_284_970 227
557 3300042133 Ga0450896_007498 Ga0450896_007498_482_1168 227
558 3300042134 Ga0450898_046384 Ga0450898_046384_128_814 227
559 3300042435 Ga0439434_0019877 Ga0439434_0019877_29_715 227
560 3300045051 Ga0451576_0201519 Ga0451576_0201519_758_1462 227
561 3300046522 Ga0495643_0075385 Ga0495643_0075385_955_1701 227
562 3300047320 Ga0495672_0071109 Ga0495672_0071109_1135_1821 227
563 3300047472 Ga0495686_0000004 Ga0495686_0000004_217520_218272 227
564 3300049570 Ga0501033_0267137 Ga0501033_0267137_340_1026 227
565 3300049571 Ga0501034_0105806 Ga0501034_0105806_17_712 227
566 3300049573 Ga0501037_0070596 Ga0501037_0070596_61_756 227
567 3300049574 Ga0501038_0042362 Ga0501038_0042362_23_718 227
568 3300049575 Ga0501039_0284788 Ga0501039_0284788_560_1255 227
569 3300049581 Ga0501047_0521984 Ga0501047_0521984_95_790 227
570 3300049822 Ga0501035_0559296 Ga0501035_0559296_87_782 227
571 3300049823 Ga0501044_0150927 Ga0501044_0150927_161_925 227
572 3300049823 Ga0501044_0350670 Ga0501044_0350670_398_1093 227
573 3300050507 nmdc:mga05p37_157653_c1 nmdc:mga05p37_157653_c1_88_783 227
574 3300050508 nmdc:mga09592_212040_c1 nmdc:mga09592_212040_c1_810_1505 227
575 3300050508 nmdc:mga09592_245322_c1 nmdc:mga09592_245322_c1_687_1373 227
576 3300002739 JGI25158J39367_1009660 JGI25158J39367_10096601 228
577 3300003322 rootL2_10275685 rootL2_102756852 228
578 3300003761 Ga0055535_1005189 Ga0055535_10051894 228
579 3300003762 Ga0055542_1003200 Ga0055542_10032003 228
580 3300005262 Ga0065165_1009569 Ga0065165_10095692 228
581 3300005331 Ga0070670_100794598 Ga0070670_1007945981 228
582 3300005339 Ga0070660_100137935 Ga0070660_1001379353 228
583 3300005344 Ga0070661_100262999 Ga0070661_1002629991 228
584 3300005366 Ga0070659_100251877 Ga0070659_1002518772 228
585 3300005539 Ga0068853_100042031 Ga0068853_1000420312 228
586 3300005617 Ga0068859_100001757 Ga0068859_10000175716 228
587 3300005843 Ga0068860_100006918 Ga0068860_1000069186 228
588 3300005985 Ga0081539_10026070 Ga0081539_100260702 228
589 3300006844 Ga0075428_100027076 Ga0075428_1000270764 228
590 3300006880 Ga0075429_100012284 Ga0075429_1000122847 228
591 3300006931 Ga0097620_100001757 Ga0097620_10000175716 228
592 3300009101 Ga0105247_10000982 Ga0105247_1000098213 228
593 3300009545 Ga0105237_10021908 Ga0105237_100219083 228
594 3300009553 Ga0105249_10384291 Ga0105249_103842912 228
595 3300013102 Ga0157371_10024778 Ga0157371_100247782 228
596 3300013105 Ga0157369_10052831 Ga0157369_100528313 228
597 3300013306 Ga0163162_10275806 Ga0163162_102758062 228
598 3300013307 Ga0157372_10024140 Ga0157372_100241403 228
599 3300013307 Ga0157372_10050299 Ga0157372_100502992 228
600 3300013307 Ga0157372_10181700 Ga0157372_101817002 228
601 3300013307 Ga0157372_10475534 Ga0157372_104755342 228
602 3300014326 Ga0157380_10059590 Ga0157380_100595902 228
603 3300014968 Ga0157379_10298920 Ga0157379_102989201 228
604 3300015265 Ga0182005_1000023 Ga0182005_1000023178 228
605 3300025208 Ga0209436_103713 Ga0209436_1037132 228
606 3300025242 Ga0209258_100068 Ga0209258_10006857 228
607 3300025254 Ga0209148_1000259 Ga0209148_100025956 228
608 3300025900 Ga0207710_10055048 Ga0207710_100550482 228
609 3300025904 Ga0207647_10001653 Ga0207647_100016532 228
610 3300025914 Ga0207671_10257547 Ga0207671_102575471 228
611 3300025919 Ga0207657_10096121 Ga0207657_100961211 228
612 3300025923 Ga0207681_10028240 Ga0207681_100282402 228
613 3300025932 Ga0207690_10279726 Ga0207690_102797261 228
614 3300025961 Ga0207712_10016043 Ga0207712_100160435 228
615 3300025961 Ga0207712_10221912 Ga0207712_102219121 228
616 3300026142 Ga0207698_10112823 Ga0207698_101128231 228
617 3300028381 Ga0268264_10159157 Ga0268264_101591573 228
618 3300031595 Ga0265313_10019801 Ga0265313_100198012 228
619 3300031616 Ga0307508_10002190 Ga0307508_100021904 228
620 3300036401 Ga0373937_0410381 Ga0373937_0410381_440_1132 228
621 3300037471 Ga0395905_0014932 Ga0395905_0014932_300_992 228
622 3300037471 Ga0395905_0049455 Ga0395905_0049455_12_704 228
623 3300044712 Ga0453684_0170870 Ga0453684_0170870_1761_2474 228
624 3300046459 Ga0495629_0284519 Ga0495629_0284519_323_1015 228
625 3300046472 Ga0495580_0027404 Ga0495580_0027404_1896_2588 228
626 3300046475 Ga0495639_0293726 Ga0495639_0293726_80_772 228
627 3300046476 Ga0495662_0173312 Ga0495662_0173312_242_934 228
628 3300046517 Ga0495630_0051522 Ga0495630_0051522_2162_2854 228
629 3300046557 Ga0495622_0202344 Ga0495622_0202344_28_714 228
630 3300046616 Ga0495668_0013302 Ga0495668_0013302_391_1104 228
631 3300046681 Ga0495647_0015452 Ga0495647_0015452_1485_2177 228
632 3300046683 Ga0495658_0029956 Ga0495658_0029956_1794_2486 228
633 3300046689 Ga0495613_0088924 Ga0495613_0088924_82_774 228
634 3300047319 Ga0495674_0060425 Ga0495674_0060425_1692_2384 228
635 3300049683 Ga0501253_083495 Ga0501253_083495_17_706 228
636 3300049742 Ga0501080_0368783 Ga0501080_0368783_184_876 228
637 3300049776 Ga0501280_020643 Ga0501280_020643_158_856 228
638 3300050508 nmdc:mga09592_165054_c1 nmdc:mga09592_165054_c1_648_1352 228
639 3300050509 nmdc:mga0qj67_166438_c1 nmdc:mga0qj67_166438_c1_383_1087 228
640 3300053088 Ga0500644_0000268 Ga0500644_0000268_12768_13454 228
641 3300053090 Ga0500646_0032395 Ga0500646_0032395_252_938 228
642 3300053092 Ga0500583_0030990 Ga0500583_0030990_133_819 228
643 3300053096 Ga0500641_0004448 Ga0500641_0004448_213_905 228
644 3300053109 Ga0500569_000810 Ga0500569_000810_2477_3163 228
645 3300053134 Ga0500658_0103091 Ga0500658_0103091_304_990 228
646 3300053136 Ga0500559_0002564 Ga0500559_0002564_681_1367 228
647 3300053142 Ga0500577_0005210 Ga0500577_0005210_2260_2946 228
648 3300053153 Ga0500616_0004904 Ga0500616_0004904_7712_8398 228
649 3300053160 Ga0500633_0001348 Ga0500633_0001348_918_1604 228
650 3300053177 Ga0500636_0049515 Ga0500636_0049515_580_1266 228
651 3300003322 rootL2_10099562 rootL2_100995628 229
652 3300003323 rootH1_10081552 rootH1_100815523 229
653 3300005564 Ga0070664_100031478 Ga0070664_1000314783 229
654 3300006237 Ga0097621_100077716 Ga0097621_1000777162 229
655 3300009094 Ga0111539_10445108 Ga0111539_104451081 229
656 3300010375 Ga0105239_10044571 Ga0105239_100445713 229
657 3300013102 Ga0157371_10190462 Ga0157371_101904622 229
658 3300013102 Ga0157371_10206562 Ga0157371_102065621 229
659 3300013306 Ga0163162_10393774 Ga0163162_103937742 229
660 3300013307 Ga0157372_10182766 Ga0157372_101827662 229
661 3300013308 Ga0157375_10156395 Ga0157375_101563953 229
662 3300014745 Ga0157377_10053165 Ga0157377_100531653 229
663 3300014969 Ga0157376_10051047 Ga0157376_100510472 229
664 3300025208 Ga0209436_101974 Ga0209436_1019743 229
665 3300025284 Ga0209130_1009964 Ga0209130_10099642 229
666 3300025298 Ga0209050_1000136 Ga0209050_1000136116 229
667 3300025302 Ga0207426_1000164 Ga0207426_100016462 229
668 3300025302 Ga0207426_1000543 Ga0207426_100054334 229
669 3300025304 Ga0209257_1002016 Ga0209257_10020165 229
670 3300025901 Ga0207688_10036895 Ga0207688_100368953 229
671 3300025923 Ga0207681_10269037 Ga0207681_102690372 229
672 3300025942 Ga0207689_10067862 Ga0207689_100678623 229
673 3300025945 Ga0207679_10019154 Ga0207679_100191544 229
674 3300026023 Ga0207677_10024807 Ga0207677_100248073 229
675 3300026075 Ga0207708_10246608 Ga0207708_102466083 229
676 3300026118 Ga0207675_100633625 Ga0207675_1006336252 229
677 3300026142 Ga0207698_10087259 Ga0207698_100872593 229
678 3300032004 Ga0307414_10104360 Ga0307414_101043603 229
679 3300041997 Ga0439431_0022991 Ga0439431_0022991_328_1017 229
680 3300044658 Ga0466972_0086378 Ga0466972_0086378_74_850 229
681 3300047319 Ga0495674_0122819 Ga0495674_0122819_698_1396 229
682 3300048917 Ga0496114_0350935 Ga0496114_0350935_224_922 229
683 3300049570 Ga0501033_0162028 Ga0501033_0162028_210_899 229
684 3300049571 Ga0501034_0000002 Ga0501034_0000002_482070_482762 229
685 3300050493 nmdc:mga0k408_269877_c1 nmdc:mga0k408_269877_c1_19_708 229
686 3300050508 nmdc:mga09592_735425_c1 nmdc:mga09592_735425_c1_12_710 229
687 3300001979 JGI24740J21852_10013889 JGI24740J21852_100138892 230
688 3300002738 JGI25154J39366_1000004 JGI25154J39366_1000004266 230
689 3300002741 JGI25157J39369_1003031 JGI25157J39369_10030312 230
690 3300003354 JGI25160J50197_1009532 JGI25160J50197_10095323 230
691 3300005262 Ga0065165_1011900 Ga0065165_10119003 230
692 3300025246 Ga0209646_1000025 Ga0209646_100002569 230
693 3300025250 Ga0209026_1000097 Ga0209026_100009797 230
694 3300025258 Ga0209129_1011201 Ga0209129_10112012 230
695 3300025297 Ga0209758_1001656 Ga0209758_10016567 230
696 3300025302 Ga0207426_1000220 Ga0207426_100022060 230
697 3300049581 Ga0501047_0008255 Ga0501047_0008255_2931_3725 230
698 3300053139 Ga0500568_0013389 Ga0500568_0013389_2949_3659 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

33

249

0.97

PF13189

Cytidylate_kin2

Cytidylate kinase-like family

32

216

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h92-assembly3.cif.gz_C crystal structure of staphylococcus aureus cytidine monophosphate kinase in complex with cytidine-5'-monophosphate 0.9412 4 223
2feo-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp 0.9362 4 223
3r8c-assembly1.cif.gz_A crystal structure of cytidylate kinase (cmk) from mycobacterium abscessus 0.9304 4 223
3akc-assembly1.cif.gz_A crystal structure of cmp kinase in complex with cdp and adp from thermus thermophilus hb8 0.929 2 222
3akd-assembly1.cif.gz_A crystal structure of cmp kinase in complex with cdp from thermus thermophilus hb8 0.9288 2 222
ID Description Score Start End Superfamily
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9412 4 223 3.40.50.300
af_Q2FYF5_1_183_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9354 38 222 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9287 4 223 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9236 4 223 3.40.50.300
af_Q2FYF5_1_183_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9111 38 222 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4Q7MLT9-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9965 2 224 GO:0005524
GO:0005829
GO:0006220
GO:0015949
GO:0036430
GO:0036431
AF-A0A836SXV6-F1-model_v4 (d)CMP kinase (EC 2.7.4.25) 0.986 99 225 GO:0004127
GO:0005524
AF-A0A2E6LH79-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9816 1 224 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A6M1YJ98-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9805 4 224 GO:0003841
GO:0004127
GO:0005524
GO:0005737
GO:0006220
GO:0006654
AF-A0A2E0VWI0-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9794 1 229 GO:0005524
GO:0005829
GO:0006220
GO:0015949
GO:0036430
GO:0036431

Feature Viewer

pLDDT pTM Quality
91.3 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map