F475954
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 698 | 349 | 675 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10068803|Ga0105241_100688033 |
| Length | 262 |
| Sequence | VATVLVAAATANKFPPWQSFTHFCISMEQKIIITIDGWSSCGKSTLAKQLARELGYIYIDSGAMYRAITLYFLRNHVDWTNHEAVENALKHITLTSSSNHKTGQSEMHLNHENVEYVIRDLVVAEKVSEVAAIKEVRDFAVKQQQEMGKNKGIVMDGRDIGTVVFPHAELKIFMTADKDIRVKRRFQELYEKNPNVTMEEVKANLEMRDYIDSHREVSPLRKASDALELDNSHLTIKEQLDMALNWVNERCVKPTISSGNRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 2 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 3 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 4 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 5 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 6 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 7 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 8 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 9 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 10 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 11 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 12 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 13 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 14 | 2884791551 | Chitinophaga oryzae 1310 | Isolate | Unclassified |
| 15 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 16 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 17 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 18 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 19 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 20 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 21 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 22 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 23 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 26 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 27 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 28 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 29 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 30 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 31 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 32 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 33 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 73 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 86 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 87 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 88 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 198 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 199 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 204 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 205 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 213 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 217 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 218 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 219 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 220 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 221 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 222 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 223 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 224 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 225 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 226 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 227 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 228 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 229 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 230 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 235 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 284 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 285 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 286 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 287 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 288 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 299 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 300 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 301 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 302 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 304 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 305 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 306 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 307 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 309 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 310 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 311 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 315 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 316 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 317 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 320 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 327 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 329 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 330 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 331 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 332 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 335 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 338 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 340 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 341 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 342 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 344 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 345 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 347 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 348 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 349 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.7 |
| Metatranscriptomes | 0 |
| Isolates | 3.3 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.16 |
| Nodule | 0 |
| Rhizoplane | 0.57 |
| Rhizosphere | 83.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10013889 | 3300001979 | Bacteria | 2988 |
| 2 | JGI24751J29686_10000878 | 3300002459 | Bacteria | 6868 |
| 3 | JGI25154J39366_1000004 | 3300002738 | Bacteria | 346460 |
| 4 | JGI25154J39366_1000495 | 3300002738 | Bacteria | 20221 |
| 5 | JGI25158J39367_1009660 | 3300002739 | Bacteria | 1318 |
| 6 | JGI25157J39369_1003031 | 3300002741 | Bacteria | 3659 |
| 7 | rootH1_10061546 | 3300003316 | Bacteria | 1191 |
| 8 | rootH2_10030436 | 3300003320 | Bacteria | 1942 |
| 9 | rootH2_10035373 | 3300003320 | Bacteria | 2959 |
| 10 | rootH2_10044418 | 3300003320 | Bacteria | 1870 |
| 11 | rootH2_10265654 | 3300003320 | Bacteria | 1041 |
| 12 | rootL2_10002240 | 3300003322 | Bacteria | 2267 |
| 13 | rootL2_10099562 | 3300003322 | Bacteria | 10969 |
| 14 | rootL2_10213538 | 3300003322 | Bacteria | 4983 |
| 15 | rootL2_10275685 | 3300003322 | Bacteria | 2159 |
| 16 | rootH1_10081552 | 3300003323 | Bacteria | 5558 |
| 17 | rootH1_10159857 | 3300003323 | Bacteria | 1292 |
| 18 | JGI25160J50197_1009532 | 3300003354 | Bacteria | 3590 |
| 19 | Ga0055535_1005189 | 3300003761 | Bacteria | 2932 |
| 20 | Ga0055542_1003200 | 3300003762 | Bacteria | 4600 |
| 21 | Ga0055529_1000100 | 3300003763 | Bacteria | 131049 |
| 22 | Ga0065165_1009569 | 3300005262 | Bacteria | 4325 |
| 23 | Ga0065165_1011900 | 3300005262 | Bacteria | 3582 |
| 24 | Ga0065714_10118317 | 3300005288 | Bacteria | 1380 |
| 25 | Ga0065704_10157563 | 3300005289 | Bacteria | 1379 |
| 26 | Ga0065712_10134766 | 3300005290 | Bacteria | 1500 |
| 27 | Ga0065715_10032656 | 3300005293 | Bacteria | 1680 |
| 28 | Ga0065707_10115278 | 3300005295 | Unclassified | 2272 |
| 29 | Ga0065707_10239343 | 3300005295 | Bacteria | 1161 |
| 30 | Ga0070658_10635485 | 3300005327 | Bacteria | 926 |
| 31 | Ga0070676_10002015 | 3300005328 | Bacteria | 10324 |
| 32 | Ga0070676_10026397 | 3300005328 | Bacteria | 3288 |
| 33 | Ga0070676_10078119 | 3300005328 | Bacteria | 2002 |
| 34 | Ga0070683_100006190 | 3300005329 | Bacteria | 10039 |
| 35 | Ga0070683_100144781 | 3300005329 | Bacteria | 2251 |
| 36 | Ga0070683_100313284 | 3300005329 | Bacteria | 1493 |
| 37 | Ga0070683_100427908 | 3300005329 | Bacteria | 1263 |
| 38 | Ga0070683_100432397 | 3300005329 | Bacteria | 1256 |
| 39 | Ga0070683_100938709 | 3300005329 | Unclassified | 830 |
| 40 | Ga0070690_100075264 | 3300005330 | Bacteria | 2201 |
| 41 | Ga0070690_100080739 | 3300005330 | Unclassified | 2127 |
| 42 | Ga0070670_100010352 | 3300005331 | Bacteria | 7960 |
| 43 | Ga0070670_100109869 | 3300005331 | Bacteria | 2376 |
| 44 | Ga0070670_100155603 | 3300005331 | Bacteria | 1979 |
| 45 | Ga0070670_100353460 | 3300005331 | Bacteria | 1291 |
| 46 | Ga0070670_100655742 | 3300005331 | Bacteria | 942 |
| 47 | Ga0070670_100669057 | 3300005331 | Bacteria | 932 |
| 48 | Ga0070670_100789649 | 3300005331 | Bacteria | 857 |
| 49 | Ga0070670_100794598 | 3300005331 | Bacteria | 854 |
| 50 | Ga0068869_100027165 | 3300005334 | Bacteria | 3989 |
| 51 | Ga0068869_100746194 | 3300005334 | Bacteria | 838 |
| 52 | Ga0070666_10003629 | 3300005335 | Bacteria | 9362 |
| 53 | Ga0070666_10255039 | 3300005335 | Bacteria | 1242 |
| 54 | Ga0070682_100000436 | 3300005337 | Bacteria | 26964 |
| 55 | Ga0070682_100620238 | 3300005337 | Bacteria | 857 |
| 56 | Ga0068868_100016918 | 3300005338 | Bacteria | 5425 |
| 57 | Ga0068868_100087536 | 3300005338 | Bacteria | 2505 |
| 58 | Ga0070660_100137935 | 3300005339 | Bacteria | 1955 |
| 59 | Ga0070660_100225733 | 3300005339 | Bacteria | 1523 |
| 60 | Ga0070689_100148146 | 3300005340 | Bacteria | 1891 |
| 61 | Ga0070691_10000902 | 3300005341 | Bacteria | 12056 |
| 62 | Ga0070661_100262999 | 3300005344 | Bacteria | 1334 |
| 63 | Ga0070668_100000401 | 3300005347 | Bacteria | 28754 |
| 64 | Ga0070668_100265854 | 3300005347 | Unclassified | 1428 |
| 65 | Ga0070668_100635383 | 3300005347 | Bacteria | 937 |
| 66 | Ga0070669_100417189 | 3300005353 | Bacteria | 1101 |
| 67 | Ga0070675_100131429 | 3300005354 | Bacteria | 2134 |
| 68 | Ga0070675_100324930 | 3300005354 | Bacteria | 1359 |
| 69 | Ga0070675_100381000 | 3300005354 | Bacteria | 1255 |
| 70 | Ga0070671_100287385 | 3300005355 | Bacteria | 1399 |
| 71 | Ga0070674_100079478 | 3300005356 | Bacteria | 2340 |
| 72 | Ga0070673_100050165 | 3300005364 | Bacteria | 3262 |
| 73 | Ga0070688_100049115 | 3300005365 | Bacteria | 2624 |
| 74 | Ga0070688_100053780 | 3300005365 | Bacteria | 2520 |
| 75 | Ga0070659_100088862 | 3300005366 | Bacteria | 2475 |
| 76 | Ga0070659_100251877 | 3300005366 | Bacteria | 1464 |
| 77 | Ga0070667_100000533 | 3300005367 | Bacteria | 38045 |
| 78 | Ga0070667_100034803 | 3300005367 | Bacteria | 4217 |
| 79 | Ga0070667_100135381 | 3300005367 | Bacteria | 2154 |
| 80 | Ga0070678_100572284 | 3300005456 | Bacteria | 1005 |
| 81 | Ga0070662_100264293 | 3300005457 | Bacteria | 1387 |
| 82 | Ga0070662_100387975 | 3300005457 | Bacteria | 1150 |
| 83 | Ga0070681_10283823 | 3300005458 | Bacteria | 1566 |
| 84 | Ga0070681_10548516 | 3300005458 | Bacteria | 1070 |
| 85 | Ga0068867_100150829 | 3300005459 | Bacteria | 1826 |
| 86 | Ga0070685_10171506 | 3300005466 | Bacteria | 1391 |
| 87 | Ga0070698_100000791 | 3300005471 | Bacteria | 34361 |
| 88 | Ga0070698_100004354 | 3300005471 | Bacteria | 15565 |
| 89 | Ga0070679_100006566 | 3300005530 | Bacteria | 10838 |
| 90 | Ga0070684_100582146 | 3300005535 | Unclassified | 1040 |
| 91 | Ga0068853_100000862 | 3300005539 | Bacteria | 21166 |
| 92 | Ga0068853_100012555 | 3300005539 | Bacteria | 6892 |
| 93 | Ga0068853_100042031 | 3300005539 | Bacteria | 3907 |
| 94 | Ga0068853_100130045 | 3300005539 | Bacteria | 2253 |
| 95 | Ga0068853_100316906 | 3300005539 | Bacteria | 1445 |
| 96 | Ga0068853_100348311 | 3300005539 | Unclassified | 1377 |
| 97 | Ga0068853_100674548 | 3300005539 | Bacteria | 985 |
| 98 | Ga0070672_100001693 | 3300005543 | Bacteria | 13762 |
| 99 | Ga0070672_100151119 | 3300005543 | Bacteria | 1921 |
| 100 | Ga0070672_100821786 | 3300005543 | Bacteria | 818 |
| 101 | Ga0070686_100179147 | 3300005544 | Bacteria | 1504 |
| 102 | Ga0070686_100504154 | 3300005544 | Bacteria | 939 |
| 103 | Ga0070686_100673244 | 3300005544 | Bacteria | 823 |
| 104 | Ga0070693_100045301 | 3300005547 | Bacteria | 2492 |
| 105 | Ga0070665_100002361 | 3300005548 | Bacteria | 20861 |
| 106 | Ga0070665_100277083 | 3300005548 | Bacteria | 1679 |
| 107 | Ga0070704_100444270 | 3300005549 | Unclassified | 1115 |
| 108 | Ga0068855_100001333 | 3300005563 | Bacteria | 30579 |
| 109 | Ga0068855_100059968 | 3300005563 | Bacteria | 4451 |
| 110 | Ga0068855_100403016 | 3300005563 | Bacteria | 1499 |
| 111 | Ga0070664_100013343 | 3300005564 | Bacteria | 6691 |
| 112 | Ga0070664_100031478 | 3300005564 | Bacteria | 4433 |
| 113 | Ga0070664_100228262 | 3300005564 | Bacteria | 1668 |
| 114 | Ga0070664_100420607 | 3300005564 | Bacteria | 1224 |
| 115 | Ga0068857_100004225 | 3300005577 | Bacteria | 12105 |
| 116 | Ga0068857_100165906 | 3300005577 | Bacteria | 2005 |
| 117 | Ga0068857_100215589 | 3300005577 | Bacteria | 1752 |
| 118 | Ga0068854_100016394 | 3300005578 | Bacteria | 4939 |
| 119 | Ga0068854_100214933 | 3300005578 | Bacteria | 1519 |
| 120 | Ga0068856_100041808 | 3300005614 | Bacteria | 4506 |
| 121 | Ga0068856_100049890 | 3300005614 | Bacteria | 4126 |
| 122 | Ga0068852_100027026 | 3300005616 | Bacteria | 4671 |
| 123 | Ga0068852_100027478 | 3300005616 | Bacteria | 4638 |
| 124 | Ga0068852_100259873 | 3300005616 | Bacteria | 1667 |
| 125 | Ga0068852_100556611 | 3300005616 | Unclassified | 1148 |
| 126 | Ga0068859_100001757 | 3300005617 | Bacteria | 22069 |
| 127 | Ga0068859_100140602 | 3300005617 | Bacteria | 2487 |
| 128 | Ga0068859_100196183 | 3300005617 | Bacteria | 2103 |
| 129 | Ga0068859_100287176 | 3300005617 | Bacteria | 1738 |
| 130 | Ga0068859_100383246 | 3300005617 | Bacteria | 1501 |
| 131 | Ga0068864_100000697 | 3300005618 | Bacteria | 28171 |
| 132 | Ga0068864_100036995 | 3300005618 | Unclassified | 4162 |
| 133 | Ga0068864_100112896 | 3300005618 | Bacteria | 2422 |
| 134 | Ga0068864_100283670 | 3300005618 | Unclassified | 1546 |
| 135 | Ga0068866_10024684 | 3300005718 | Bacteria | 2816 |
| 136 | Ga0068866_10469036 | 3300005718 | Viruses | 827 |
| 137 | Ga0068861_100028014 | 3300005719 | Bacteria | 4109 |
| 138 | Ga0068861_100051919 | 3300005719 | Bacteria | 3115 |
| 139 | Ga0068861_100324608 | 3300005719 | Unclassified | 1342 |
| 140 | Ga0068851_10048655 | 3300005834 | Bacteria | 2149 |
| 141 | Ga0068863_100017171 | 3300005841 | Bacteria | 6941 |
| 142 | Ga0068863_100086885 | 3300005841 | Unclassified | 2963 |
| 143 | Ga0068863_100134090 | 3300005841 | Unclassified | 2365 |
| 144 | Ga0068863_100220732 | 3300005841 | Bacteria | 1826 |
| 145 | Ga0068863_100691596 | 3300005841 | Unclassified | 1013 |
| 146 | Ga0068858_100002045 | 3300005842 | Bacteria | 20564 |
| 147 | Ga0068860_100000097 | 3300005843 | Bacteria | 146573 |
| 148 | Ga0068860_100002600 | 3300005843 | Bacteria | 18890 |
| 149 | Ga0068860_100006918 | 3300005843 | Bacteria | 11367 |
| 150 | Ga0068860_100036355 | 3300005843 | Bacteria | 4720 |
| 151 | Ga0068860_100168483 | 3300005843 | Bacteria | 2115 |
| 152 | Ga0068860_100283406 | 3300005843 | Bacteria | 1620 |
| 153 | Ga0068862_100328193 | 3300005844 | Bacteria | 1414 |
| 154 | Ga0068862_100578801 | 3300005844 | Unclassified | 1075 |
| 155 | Ga0081540_1005881 | 3300005983 | Bacteria | 9066 |
| 156 | Ga0081539_10026070 | 3300005985 | Bacteria | 3744 |
| 157 | Ga0075362_10013837 | 3300006177 | Bacteria | 3240 |
| 158 | Ga0097621_100002514 | 3300006237 | Bacteria | 12556 |
| 159 | Ga0097621_100053932 | 3300006237 | Bacteria | 3277 |
| 160 | Ga0097621_100077716 | 3300006237 | Bacteria | 2756 |
| 161 | Ga0075370_10507114 | 3300006353 | Bacteria | 728 |
| 162 | Ga0068871_100023999 | 3300006358 | Unclassified | 4725 |
| 163 | Ga0068871_100024610 | 3300006358 | Bacteria | 4671 |
| 164 | Ga0068871_100060922 | 3300006358 | Unclassified | 3080 |
| 165 | Ga0068871_100139315 | 3300006358 | Bacteria | 2062 |
| 166 | Ga0075428_100027076 | 3300006844 | Bacteria | 6347 |
| 167 | Ga0075428_100057845 | 3300006844 | Bacteria | 4244 |
| 168 | Ga0075428_100243033 | 3300006844 | Bacteria | 1942 |
| 169 | Ga0075428_100316736 | 3300006844 | Bacteria | 1676 |
| 170 | Ga0075428_100820862 | 3300006844 | Unclassified | 988 |
| 171 | Ga0075431_100019063 | 3300006847 | Bacteria | 6990 |
| 172 | Ga0075429_100012284 | 3300006880 | Bacteria | 7427 |
| 173 | Ga0075429_100558675 | 3300006880 | Bacteria | 1003 |
| 174 | Ga0068865_100017180 | 3300006881 | Bacteria | 4648 |
| 175 | Ga0068865_100599920 | 3300006881 | Bacteria | 930 |
| 176 | Ga0097620_100001757 | 3300006931 | Bacteria | 22069 |
| 177 | Ga0097620_100140601 | 3300006931 | Bacteria | 2487 |
| 178 | Ga0097620_100196186 | 3300006931 | Bacteria | 2103 |
| 179 | Ga0097620_100287146 | 3300006931 | Bacteria | 1738 |
| 180 | Ga0097620_100383216 | 3300006931 | Bacteria | 1501 |
| 181 | Ga0105251_10132350 | 3300009011 | Bacteria | 1130 |
| 182 | Ga0105240_10001904 | 3300009093 | Bacteria | 34640 |
| 183 | Ga0105240_10003186 | 3300009093 | Bacteria | 25770 |
| 184 | Ga0105240_10005151 | 3300009093 | Bacteria | 19554 |
| 185 | Ga0105240_10018088 | 3300009093 | Bacteria | 9476 |
| 186 | Ga0105240_10055447 | 3300009093 | Bacteria | 4962 |
| 187 | Ga0105240_10100537 | 3300009093 | Bacteria | 3518 |
| 188 | Ga0105240_10116414 | 3300009093 | Bacteria | 3225 |
| 189 | Ga0105240_10124078 | 3300009093 | Bacteria | 3106 |
| 190 | Ga0105240_10274119 | 3300009093 | Bacteria | 1941 |
| 191 | Ga0111539_10038533 | 3300009094 | Bacteria | 5765 |
| 192 | Ga0111539_10445108 | 3300009094 | Bacteria | 1509 |
| 193 | Ga0105245_10580144 | 3300009098 | Bacteria | 1146 |
| 194 | Ga0105247_10000982 | 3300009101 | Bacteria | 21489 |
| 195 | Ga0105247_10372700 | 3300009101 | Bacteria | 1010 |
| 196 | Ga0114129_10043343 | 3300009147 | Bacteria | 6330 |
| 197 | Ga0114129_10055854 | 3300009147 | Bacteria | 5533 |
| 198 | Ga0114129_11172992 | 3300009147 | Bacteria | 958 |
| 199 | Ga0105243_10163300 | 3300009148 | Bacteria | 1922 |
| 200 | Ga0105241_10000224 | 3300009174 | Bacteria | 42685 |
| 201 | Ga0105241_10000614 | 3300009174 | Bacteria | 26776 |
| 202 | Ga0105241_10068803 | 3300009174 | Bacteria | 2744 |
| 203 | Ga0105241_10267194 | 3300009174 | Unclassified | 1456 |
| 204 | Ga0105242_10031974 | 3300009176 | Bacteria | 4207 |
| 205 | Ga0105242_10090660 | 3300009176 | Unclassified | 2572 |
| 206 | Ga0105248_10011550 | 3300009177 | Bacteria | 9730 |
| 207 | Ga0105237_10001017 | 3300009545 | Bacteria | 37740 |
| 208 | Ga0105237_10011860 | 3300009545 | Bacteria | 9216 |
| 209 | Ga0105237_10021908 | 3300009545 | Bacteria | 6563 |
| 210 | Ga0105237_10042813 | 3300009545 | Bacteria | 4563 |
| 211 | Ga0105237_10058858 | 3300009545 | Bacteria | 3845 |
| 212 | Ga0105237_10221775 | 3300009545 | Bacteria | 1891 |
| 213 | Ga0105237_10357436 | 3300009545 | Bacteria | 1465 |
| 214 | Ga0105238_10069232 | 3300009551 | Bacteria | 3529 |
| 215 | Ga0105238_10153848 | 3300009551 | Bacteria | 2275 |
| 216 | Ga0105238_10768409 | 3300009551 | Bacteria | 978 |
| 217 | Ga0105238_10943333 | 3300009551 | Bacteria | 882 |
| 218 | Ga0105238_11238130 | 3300009551 | Unclassified | 771 |
| 219 | Ga0105249_10001004 | 3300009553 | Bacteria | 25009 |
| 220 | Ga0105249_10020949 | 3300009553 | Bacteria | 5849 |
| 221 | Ga0105249_10307793 | 3300009553 | Bacteria | 1591 |
| 222 | Ga0105249_10384291 | 3300009553 | Bacteria | 1431 |
| 223 | Ga0105249_10418161 | 3300009553 | Unclassified | 1374 |
| 224 | Ga0105239_10000436 | 3300010375 | Bacteria | 61031 |
| 225 | Ga0105239_10000950 | 3300010375 | Bacteria | 40845 |
| 226 | Ga0105239_10018021 | 3300010375 | Bacteria | 7811 |
| 227 | Ga0105239_10044571 | 3300010375 | Bacteria | 4862 |
| 228 | Ga0105239_10052181 | 3300010375 | Bacteria | 4484 |
| 229 | Ga0105239_10220863 | 3300010375 | Bacteria | 2125 |
| 230 | Ga0105239_10311490 | 3300010375 | Bacteria | 1774 |
| 231 | Ga0157373_10004590 | 3300013100 | Bacteria | 10395 |
| 232 | Ga0157371_10016646 | 3300013102 | Bacteria | 5481 |
| 233 | Ga0157371_10024778 | 3300013102 | Bacteria | 4378 |
| 234 | Ga0157371_10045471 | 3300013102 | Bacteria | 3124 |
| 235 | Ga0157371_10108651 | 3300013102 | Bacteria | 1968 |
| 236 | Ga0157371_10190462 | 3300013102 | Bacteria | 1468 |
| 237 | Ga0157371_10206562 | 3300013102 | Bacteria | 1409 |
| 238 | Ga0157371_10343877 | 3300013102 | Bacteria | 1085 |
| 239 | Ga0157370_10004443 | 3300013104 | Bacteria | 16068 |
| 240 | Ga0157370_10016530 | 3300013104 | Bacteria | 7465 |
| 241 | Ga0157370_10039463 | 3300013104 | Bacteria | 4563 |
| 242 | Ga0157370_10056510 | 3300013104 | Bacteria | 3735 |
| 243 | Ga0157369_10010809 | 3300013105 | Bacteria | 10394 |
| 244 | Ga0157369_10052831 | 3300013105 | Bacteria | 4394 |
| 245 | Ga0157369_10098008 | 3300013105 | Bacteria | 3127 |
| 246 | Ga0157369_10141867 | 3300013105 | Bacteria | 2542 |
| 247 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 248 | Ga0157374_10043425 | 3300013296 | Bacteria | 4153 |
| 249 | Ga0157374_10067871 | 3300013296 | Bacteria | 3354 |
| 250 | Ga0157374_10144131 | 3300013296 | Bacteria | 2313 |
| 251 | Ga0157374_10458457 | 3300013296 | Bacteria | 1277 |
| 252 | Ga0157378_10007269 | 3300013297 | Bacteria | 9671 |
| 253 | Ga0157378_10105414 | 3300013297 | Bacteria | 2578 |
| 254 | Ga0157378_10415797 | 3300013297 | Bacteria | 1328 |
| 255 | Ga0157378_10840759 | 3300013297 | Bacteria | 946 |
| 256 | Ga0157378_10899656 | 3300013297 | Bacteria | 916 |
| 257 | Ga0163162_10002183 | 3300013306 | Bacteria | 18347 |
| 258 | Ga0163162_10056597 | 3300013306 | Bacteria | 3949 |
| 259 | Ga0163162_10073563 | 3300013306 | Unclassified | 3474 |
| 260 | Ga0163162_10099428 | 3300013306 | Unclassified | 3000 |
| 261 | Ga0163162_10275806 | 3300013306 | Bacteria | 1813 |
| 262 | Ga0163162_10393774 | 3300013306 | Bacteria | 1518 |
| 263 | Ga0163162_11116772 | 3300013306 | Unclassified | 893 |
| 264 | Ga0157372_10000595 | 3300013307 | Bacteria | 39419 |
| 265 | Ga0157372_10002860 | 3300013307 | Bacteria | 18657 |
| 266 | Ga0157372_10024140 | 3300013307 | Bacteria | 6600 |
| 267 | Ga0157372_10050299 | 3300013307 | Bacteria | 4636 |
| 268 | Ga0157372_10123578 | 3300013307 | Bacteria | 2975 |
| 269 | Ga0157372_10181700 | 3300013307 | Bacteria | 2435 |
| 270 | Ga0157372_10182766 | 3300013307 | Bacteria | 2428 |
| 271 | Ga0157372_10193476 | 3300013307 | Bacteria | 2356 |
| 272 | Ga0157372_10441827 | 3300013307 | Bacteria | 1516 |
| 273 | Ga0157372_10475534 | 3300013307 | Bacteria | 1457 |
| 274 | Ga0157372_10500768 | 3300013307 | Bacteria | 1417 |
| 275 | Ga0157372_11362987 | 3300013307 | Bacteria | 818 |
| 276 | Ga0157375_10156395 | 3300013308 | Bacteria | 2419 |
| 277 | Ga0157375_10157860 | 3300013308 | Unclassified | 2408 |
| 278 | Ga0157375_10229430 | 3300013308 | Bacteria | 2016 |
| 279 | Ga0157375_10366991 | 3300013308 | Bacteria | 1606 |
| 280 | Ga0163163_10000254 | 3300014325 | Bacteria | 54049 |
| 281 | Ga0163163_10306165 | 3300014325 | Bacteria | 1641 |
| 282 | Ga0163163_10562626 | 3300014325 | Unclassified | 1203 |
| 283 | Ga0157380_10031820 | 3300014326 | Bacteria | 4052 |
| 284 | Ga0157380_10059590 | 3300014326 | Bacteria | 3047 |
| 285 | Ga0157380_10108857 | 3300014326 | Bacteria | 2324 |
| 286 | Ga0157380_10583785 | 3300014326 | Unclassified | 1103 |
| 287 | Ga0157380_10900803 | 3300014326 | Bacteria | 910 |
| 288 | Ga0157377_10053165 | 3300014745 | Bacteria | 2289 |
| 289 | Ga0157377_10072135 | 3300014745 | Bacteria | 1998 |
| 290 | Ga0157377_10268223 | 3300014745 | Unclassified | 1114 |
| 291 | Ga0157379_10000834 | 3300014968 | Bacteria | 24929 |
| 292 | Ga0157379_10298920 | 3300014968 | Bacteria | 1467 |
| 293 | Ga0157376_10004691 | 3300014969 | Bacteria | 9526 |
| 294 | Ga0157376_10023949 | 3300014969 | Bacteria | 4788 |
| 295 | Ga0157376_10051047 | 3300014969 | Bacteria | 3434 |
| 296 | Ga0157376_10082968 | 3300014969 | Bacteria | 2756 |
| 297 | Ga0157376_10114509 | 3300014969 | Unclassified | 2379 |
| 298 | Ga0182005_1000023 | 3300015265 | Bacteria | 246328 |
| 299 | Ga0163161_10032911 | 3300017792 | Unclassified | 3703 |
| 300 | Ga0163161_10330948 | 3300017792 | Bacteria | 1206 |
| 301 | Ga0163161_10589028 | 3300017792 | Bacteria | 916 |
| 302 | Ga0209436_101974 | 3300025208 | Bacteria | 6562 |
| 303 | Ga0209436_103713 | 3300025208 | Bacteria | 3967 |
| 304 | Ga0209258_100068 | 3300025242 | Bacteria | 286288 |
| 305 | Ga0209646_1000025 | 3300025246 | Bacteria | 406493 |
| 306 | Ga0209026_1000097 | 3300025250 | Bacteria | 163212 |
| 307 | Ga0209148_1000259 | 3300025254 | Bacteria | 82912 |
| 308 | Ga0209129_1011201 | 3300025258 | Bacteria | 2162 |
| 309 | Ga0209130_1009964 | 3300025284 | Bacteria | 2657 |
| 310 | Ga0209758_1001656 | 3300025297 | Bacteria | 25247 |
| 311 | Ga0209050_1000136 | 3300025298 | Bacteria | 179113 |
| 312 | Ga0207426_1000164 | 3300025302 | Bacteria | 171465 |
| 313 | Ga0207426_1000220 | 3300025302 | Bacteria | 134979 |
| 314 | Ga0207426_1000543 | 3300025302 | Bacteria | 53486 |
| 315 | Ga0209257_1002016 | 3300025304 | Bacteria | 21697 |
| 316 | Ga0207656_10058306 | 3300025321 | Bacteria | 1686 |
| 317 | Ga0207656_10154167 | 3300025321 | Bacteria | 1090 |
| 318 | Ga0207642_10058208 | 3300025899 | Bacteria | 1782 |
| 319 | Ga0207642_10132087 | 3300025899 | Bacteria | 1304 |
| 320 | Ga0207710_10055048 | 3300025900 | Bacteria | 1793 |
| 321 | Ga0207688_10036895 | 3300025901 | Bacteria | 2710 |
| 322 | Ga0207680_10000847 | 3300025903 | Bacteria | 14466 |
| 323 | Ga0207647_10001653 | 3300025904 | Bacteria | 17156 |
| 324 | Ga0207647_10004651 | 3300025904 | Bacteria | 10169 |
| 325 | Ga0207645_10001168 | 3300025907 | Bacteria | 21656 |
| 326 | Ga0207645_10012253 | 3300025907 | Bacteria | 5824 |
| 327 | Ga0207643_10045475 | 3300025908 | Bacteria | 2480 |
| 328 | Ga0207654_10009301 | 3300025911 | Bacteria | 4988 |
| 329 | Ga0207707_10000574 | 3300025912 | Bacteria | 37317 |
| 330 | Ga0207695_10000076 | 3300025913 | Bacteria | 307969 |
| 331 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 332 | Ga0207695_10000090 | 3300025913 | Bacteria | 272143 |
| 333 | Ga0207695_10028249 | 3300025913 | Bacteria | 6226 |
| 334 | Ga0207695_10045209 | 3300025913 | Bacteria | 4676 |
| 335 | Ga0207695_10185214 | 3300025913 | Bacteria | 2001 |
| 336 | Ga0207671_10001353 | 3300025914 | Bacteria | 28612 |
| 337 | Ga0207671_10019690 | 3300025914 | Bacteria | 5154 |
| 338 | Ga0207671_10030012 | 3300025914 | Bacteria | 4056 |
| 339 | Ga0207671_10257547 | 3300025914 | Bacteria | 1372 |
| 340 | Ga0207660_10015118 | 3300025917 | Bacteria | 5089 |
| 341 | Ga0207662_10045653 | 3300025918 | Unclassified | 2590 |
| 342 | Ga0207662_10364559 | 3300025918 | Unclassified | 973 |
| 343 | Ga0207657_10096121 | 3300025919 | Bacteria | 2464 |
| 344 | Ga0207649_10104806 | 3300025920 | Bacteria | 1878 |
| 345 | Ga0207649_10109016 | 3300025920 | Bacteria | 1846 |
| 346 | Ga0207649_10643792 | 3300025920 | Unclassified | 818 |
| 347 | Ga0207652_10040033 | 3300025921 | Bacteria | 3979 |
| 348 | Ga0207681_10028240 | 3300025923 | Bacteria | 3633 |
| 349 | Ga0207681_10087502 | 3300025923 | Bacteria | 2217 |
| 350 | Ga0207681_10269037 | 3300025923 | Bacteria | 1337 |
| 351 | Ga0207694_10048175 | 3300025924 | Bacteria | 3297 |
| 352 | Ga0207694_10064195 | 3300025924 | Bacteria | 2862 |
| 353 | Ga0207694_10332733 | 3300025924 | Bacteria | 1255 |
| 354 | Ga0207650_10012336 | 3300025925 | Bacteria | 5899 |
| 355 | Ga0207650_10047872 | 3300025925 | Bacteria | 3152 |
| 356 | Ga0207650_10100195 | 3300025925 | Bacteria | 2228 |
| 357 | Ga0207650_10140969 | 3300025925 | Bacteria | 1895 |
| 358 | Ga0207650_10390509 | 3300025925 | Bacteria | 1150 |
| 359 | Ga0207650_10409483 | 3300025925 | Bacteria | 1124 |
| 360 | Ga0207650_10586318 | 3300025925 | Bacteria | 937 |
| 361 | Ga0207659_10133973 | 3300025926 | Bacteria | 1916 |
| 362 | Ga0207659_10353755 | 3300025926 | Bacteria | 1219 |
| 363 | Ga0207644_10148048 | 3300025931 | Bacteria | 1815 |
| 364 | Ga0207690_10279726 | 3300025932 | Bacteria | 1299 |
| 365 | Ga0207706_10057757 | 3300025933 | Bacteria | 3418 |
| 366 | Ga0207706_10367470 | 3300025933 | Bacteria | 1249 |
| 367 | Ga0207706_10507906 | 3300025933 | Bacteria | 1040 |
| 368 | Ga0207686_10020673 | 3300025934 | Bacteria | 3764 |
| 369 | Ga0207686_10051166 | 3300025934 | Unclassified | 2572 |
| 370 | Ga0207709_10226143 | 3300025935 | Unclassified | 1352 |
| 371 | Ga0207670_10067709 | 3300025936 | Bacteria | 2457 |
| 372 | Ga0207704_10005751 | 3300025938 | Bacteria | 5734 |
| 373 | Ga0207691_10000835 | 3300025940 | Bacteria | 30734 |
| 374 | Ga0207691_10011149 | 3300025940 | Bacteria | 8627 |
| 375 | Ga0207691_10149323 | 3300025940 | Bacteria | 2055 |
| 376 | Ga0207691_10253973 | 3300025940 | Bacteria | 1517 |
| 377 | Ga0207689_10003622 | 3300025942 | Bacteria | 14120 |
| 378 | Ga0207689_10027179 | 3300025942 | Bacteria | 4791 |
| 379 | Ga0207689_10067862 | 3300025942 | Bacteria | 2930 |
| 380 | Ga0207689_10725778 | 3300025942 | Unclassified | 838 |
| 381 | Ga0207661_10007166 | 3300025944 | Bacteria | 7922 |
| 382 | Ga0207661_10017068 | 3300025944 | Bacteria | 5364 |
| 383 | Ga0207661_10112482 | 3300025944 | Bacteria | 2305 |
| 384 | Ga0207661_10528799 | 3300025944 | Bacteria | 1079 |
| 385 | Ga0207661_10869637 | 3300025944 | Unclassified | 830 |
| 386 | Ga0207679_10008161 | 3300025945 | Bacteria | 6664 |
| 387 | Ga0207679_10019154 | 3300025945 | Bacteria | 4595 |
| 388 | Ga0207667_10000911 | 3300025949 | Bacteria | 37650 |
| 389 | Ga0207667_10001676 | 3300025949 | Bacteria | 27897 |
| 390 | Ga0207667_10015139 | 3300025949 | Bacteria | 8771 |
| 391 | Ga0207667_10051804 | 3300025949 | Bacteria | 4325 |
| 392 | Ga0207667_10100740 | 3300025949 | Bacteria | 2980 |
| 393 | Ga0207667_10332416 | 3300025949 | Bacteria | 1551 |
| 394 | Ga0207667_10987775 | 3300025949 | Bacteria | 830 |
| 395 | Ga0207651_10001175 | 3300025960 | Bacteria | 11739 |
| 396 | Ga0207651_10463322 | 3300025960 | Bacteria | 1089 |
| 397 | Ga0207712_10002266 | 3300025961 | Bacteria | 12484 |
| 398 | Ga0207712_10005926 | 3300025961 | Bacteria | 7704 |
| 399 | Ga0207712_10016043 | 3300025961 | Bacteria | 4842 |
| 400 | Ga0207712_10057660 | 3300025961 | Bacteria | 2741 |
| 401 | Ga0207712_10193269 | 3300025961 | Bacteria | 1608 |
| 402 | Ga0207712_10221912 | 3300025961 | Bacteria | 1512 |
| 403 | Ga0207712_10548180 | 3300025961 | Unclassified | 994 |
| 404 | Ga0207712_10611057 | 3300025961 | Bacteria | 944 |
| 405 | Ga0207668_10000881 | 3300025972 | Bacteria | 18105 |
| 406 | Ga0207668_10060441 | 3300025972 | Bacteria | 2660 |
| 407 | Ga0207658_10001477 | 3300025986 | Bacteria | 18258 |
| 408 | Ga0207677_10024807 | 3300026023 | Bacteria | 3731 |
| 409 | Ga0207677_10049561 | 3300026023 | Bacteria | 2835 |
| 410 | Ga0207677_10263284 | 3300026023 | Bacteria | 1406 |
| 411 | Ga0207703_10011298 | 3300026035 | Bacteria | 6944 |
| 412 | Ga0207639_10019483 | 3300026041 | Bacteria | 4840 |
| 413 | Ga0207639_10023273 | 3300026041 | Bacteria | 4473 |
| 414 | Ga0207639_10040686 | 3300026041 | Bacteria | 3471 |
| 415 | Ga0207639_10102348 | 3300026041 | Bacteria | 2318 |
| 416 | Ga0207639_10111886 | 3300026041 | Bacteria | 2227 |
| 417 | Ga0207639_10132276 | 3300026041 | Bacteria | 2067 |
| 418 | Ga0207639_10158858 | 3300026041 | Bacteria | 1903 |
| 419 | Ga0207639_10252731 | 3300026041 | Bacteria | 1538 |
| 420 | Ga0207639_10313968 | 3300026041 | Bacteria | 1389 |
| 421 | Ga0207678_10035118 | 3300026067 | Bacteria | 4366 |
| 422 | Ga0207708_10246608 | 3300026075 | Bacteria | 1438 |
| 423 | Ga0207708_10333639 | 3300026075 | Bacteria | 1240 |
| 424 | Ga0207702_10368187 | 3300026078 | Bacteria | 1379 |
| 425 | Ga0207641_10006594 | 3300026088 | Bacteria | 9751 |
| 426 | Ga0207641_10023686 | 3300026088 | Bacteria | 5058 |
| 427 | Ga0207641_10102556 | 3300026088 | Bacteria | 2523 |
| 428 | Ga0207641_10256143 | 3300026088 | Unclassified | 1636 |
| 429 | Ga0207648_10001518 | 3300026089 | Bacteria | 25557 |
| 430 | Ga0207648_10100431 | 3300026089 | Bacteria | 2535 |
| 431 | Ga0207648_10183046 | 3300026089 | Bacteria | 1855 |
| 432 | Ga0207676_10003724 | 3300026095 | Bacteria | 10780 |
| 433 | Ga0207676_10013789 | 3300026095 | Bacteria | 5803 |
| 434 | Ga0207676_10383994 | 3300026095 | Unclassified | 1308 |
| 435 | Ga0207674_10001819 | 3300026116 | Bacteria | 27221 |
| 436 | Ga0207674_10049407 | 3300026116 | Bacteria | 4302 |
| 437 | Ga0207674_10191428 | 3300026116 | Bacteria | 1995 |
| 438 | Ga0207674_10191432 | 3300026116 | Bacteria | 1995 |
| 439 | Ga0207675_100129414 | 3300026118 | Bacteria | 2393 |
| 440 | Ga0207675_100318837 | 3300026118 | Bacteria | 1517 |
| 441 | Ga0207675_100633625 | 3300026118 | Bacteria | 1074 |
| 442 | Ga0207675_100961924 | 3300026118 | Bacteria | 871 |
| 443 | Ga0207698_10014385 | 3300026142 | Bacteria | 5258 |
| 444 | Ga0207698_10087259 | 3300026142 | Bacteria | 2541 |
| 445 | Ga0207698_10112823 | 3300026142 | Bacteria | 2282 |
| 446 | Ga0207698_10218981 | 3300026142 | Bacteria | 1719 |
| 447 | Ga0268266_10000038 | 3300028379 | Bacteria | 325729 |
| 448 | Ga0268266_10007473 | 3300028379 | Bacteria | 9854 |
| 449 | Ga0268266_10364279 | 3300028379 | Unclassified | 1361 |
| 450 | Ga0268265_10697715 | 3300028380 | Bacteria | 980 |
| 451 | Ga0268264_10000525 | 3300028381 | Bacteria | 48553 |
| 452 | Ga0268264_10006805 | 3300028381 | Bacteria | 9603 |
| 453 | Ga0268264_10018300 | 3300028381 | Bacteria | 5730 |
| 454 | Ga0268264_10159157 | 3300028381 | Bacteria | 2032 |
| 455 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 456 | Ga0307515_10310094 | 3300028794 | Bacteria | 1254 |
| 457 | Ga0316177_1221645 | 3300030731 | Unclassified | 964 |
| 458 | Ga0265327_10000729 | 3300031251 | Bacteria | 51312 |
| 459 | Ga0265327_10056116 | 3300031251 | Bacteria | 2031 |
| 460 | Ga0307513_10148404 | 3300031456 | Bacteria | 2259 |
| 461 | Ga0307513_10202249 | 3300031456 | Bacteria | 1826 |
| 462 | Ga0307513_10517973 | 3300031456 | Bacteria | 908 |
| 463 | Ga0307509_10057770 | 3300031507 | Bacteria | 4112 |
| 464 | Ga0307509_10111693 | 3300031507 | Bacteria | 2735 |
| 465 | Ga0265313_10019801 | 3300031595 | Bacteria | 3733 |
| 466 | Ga0307508_10002190 | 3300031616 | Bacteria | 20884 |
| 467 | Ga0307508_10067009 | 3300031616 | Bacteria | 3159 |
| 468 | Ga0316576_10281721 | 3300031727 | Bacteria | 1245 |
| 469 | Ga0307516_10003848 | 3300031730 | Bacteria | 18983 |
| 470 | Ga0307516_10280655 | 3300031730 | Bacteria | 1348 |
| 471 | Ga0307413_10139242 | 3300031824 | Bacteria | 1674 |
| 472 | Ga0307414_10066550 | 3300032004 | Bacteria | 2576 |
| 473 | Ga0307414_10104360 | 3300032004 | Bacteria | 2141 |
| 474 | Ga0307414_10572589 | 3300032004 | Bacteria | 1009 |
| 475 | Ga0307510_10008223 | 3300033180 | Bacteria | 12424 |
| 476 | Ga0316574_0150691 | 3300035398 | Bacteria | 1499 |
| 477 | Ga0316574_0196822 | 3300035398 | Bacteria | 1295 |
| 478 | Ga0316574_0270919 | 3300035398 | Bacteria | 1083 |
| 479 | Ga0373935_0128425 | 3300035692 | Bacteria | 1701 |
| 480 | Ga0373937_0410381 | 3300036401 | Bacteria | 1285 |
| 481 | Ga0316582_0591881 | 3300036647 | Bacteria | 764 |
| 482 | Ga0316584_0016898 | 3300036712 | Bacteria | 5236 |
| 483 | Ga0316584_0061774 | 3300036712 | Bacteria | 2806 |
| 484 | Ga0395899_0000159 | 3300037312 | Bacteria | 102831 |
| 485 | Ga0395900_0427680 | 3300037418 | Bacteria | 1284 |
| 486 | Ga0395905_0014932 | 3300037471 | Bacteria | 7408 |
| 487 | Ga0395905_0049455 | 3300037471 | Bacteria | 3940 |
| 488 | Ga0395905_0076975 | 3300037471 | Bacteria | 3126 |
| 489 | Ga0439436_0054285 | 3300041404 | Bacteria | 1127 |
| 490 | Ga0439439_0048161 | 3300041406 | Bacteria | 1114 |
| 491 | Ga0451804_0285986 | 3300041463 | Bacteria | 958 |
| 492 | Ga0451855_0590891 | 3300041511 | Bacteria | 1149 |
| 493 | Ga0451855_1209573 | 3300041511 | Bacteria | 2142 |
| 494 | Ga0451855_1969024 | 3300041511 | Bacteria | 1308 |
| 495 | Ga0451855_2010349 | 3300041511 | Bacteria | 2764 |
| 496 | Ga0451853_2224368 | 3300041512 | Bacteria | 1878 |
| 497 | Ga0439431_0022991 | 3300041997 | Bacteria | 1506 |
| 498 | Ga0439442_002870 | 3300042002 | Bacteria | 3395 |
| 499 | Ga0439445_0002485 | 3300042004 | Bacteria | 4103 |
| 500 | Ga0439449_0002035 | 3300042007 | Bacteria | 7960 |
| 501 | Ga0439449_0006096 | 3300042007 | Bacteria | 4607 |
| 502 | Ga0439457_012705 | 3300042014 | Bacteria | 1896 |
| 503 | Ga0439457_019823 | 3300042014 | Bacteria | 1494 |
| 504 | Ga0450896_007498 | 3300042133 | Bacteria | 1505 |
| 505 | Ga0450898_046384 | 3300042134 | Bacteria | 831 |
| 506 | Ga0439434_0019877 | 3300042435 | Bacteria | 2015 |
| 507 | Ga0466969_0002777 | 3300044656 | Bacteria | 9362 |
| 508 | Ga0466972_0000102 | 3300044658 | Bacteria | 75316 |
| 509 | Ga0466972_0000639 | 3300044658 | Bacteria | 16960 |
| 510 | Ga0466972_0006790 | 3300044658 | Bacteria | 5745 |
| 511 | Ga0466972_0086378 | 3300044658 | Bacteria | 1491 |
| 512 | Ga0453683_0095431 | 3300044673 | Bacteria | 1866 |
| 513 | Ga0453683_0247990 | 3300044673 | Bacteria | 1135 |
| 514 | Ga0466965_0074204 | 3300044683 | Bacteria | 1714 |
| 515 | Ga0466961_0018217 | 3300044693 | Bacteria | 4515 |
| 516 | Ga0466961_0314608 | 3300044693 | Bacteria | 955 |
| 517 | Ga0453684_0170870 | 3300044712 | Bacteria | 2562 |
| 518 | Ga0466971_0164791 | 3300044719 | Bacteria | 1038 |
| 519 | Ga0466968_0096002 | 3300044735 | Bacteria | 1319 |
| 520 | Ga0466957_0008397 | 3300044842 | Bacteria | 5872 |
| 521 | Ga0466959_0000017 | 3300045049 | Bacteria | 143170 |
| 522 | Ga0466959_0011513 | 3300045049 | Bacteria | 6359 |
| 523 | Ga0451576_0201519 | 3300045051 | Bacteria | 2078 |
| 524 | Ga0466958_0417503 | 3300045836 | Unclassified | 867 |
| 525 | Ga0495617_000005 | 3300046452 | Bacteria | 404687 |
| 526 | Ga0495627_000038 | 3300046453 | Bacteria | 198316 |
| 527 | Ga0495629_0284519 | 3300046459 | Bacteria | 1134 |
| 528 | Ga0495653_0000031 | 3300046463 | Bacteria | 137159 |
| 529 | Ga0495650_0000480 | 3300046471 | Bacteria | 61049 |
| 530 | Ga0495650_0005526 | 3300046471 | Bacteria | 8170 |
| 531 | Ga0495650_0106035 | 3300046471 | Bacteria | 1049 |
| 532 | Ga0495580_0027404 | 3300046472 | Bacteria | 4146 |
| 533 | Ga0495605_0000082 | 3300046474 | Bacteria | 125136 |
| 534 | Ga0495639_0293726 | 3300046475 | Bacteria | 809 |
| 535 | Ga0495662_0173312 | 3300046476 | Bacteria | 1063 |
| 536 | Ga0495585_0005600 | 3300046492 | Bacteria | 7892 |
| 537 | Ga0495606_0004940 | 3300046507 | Bacteria | 13040 |
| 538 | Ga0495606_0010571 | 3300046507 | Bacteria | 7640 |
| 539 | Ga0495606_0010684 | 3300046507 | Bacteria | 7583 |
| 540 | Ga0495610_0000038 | 3300046512 | Bacteria | 181669 |
| 541 | Ga0495630_0051522 | 3300046517 | Bacteria | 3081 |
| 542 | Ga0495637_0002015 | 3300046520 | Bacteria | 11466 |
| 543 | Ga0495643_0075385 | 3300046522 | Bacteria | 1765 |
| 544 | Ga0495643_0234791 | 3300046522 | Bacteria | 863 |
| 545 | Ga0495644_0020433 | 3300046523 | Bacteria | 2527 |
| 546 | Ga0495648_0016117 | 3300046524 | Bacteria | 5393 |
| 547 | Ga0495648_0074059 | 3300046524 | Bacteria | 1963 |
| 548 | Ga0495648_0139714 | 3300046524 | Bacteria | 1276 |
| 549 | Ga0495642_0035308 | 3300046528 | Bacteria | 2017 |
| 550 | Ga0495652_0587005 | 3300046529 | Bacteria | 762 |
| 551 | Ga0495654_0000047 | 3300046530 | Bacteria | 147597 |
| 552 | Ga0495654_0032241 | 3300046530 | Bacteria | 2656 |
| 553 | Ga0495609_0003278 | 3300046538 | Bacteria | 9342 |
| 554 | Ga0495622_0202344 | 3300046557 | Bacteria | 885 |
| 555 | Ga0495668_0005172 | 3300046616 | Bacteria | 8957 |
| 556 | Ga0495668_0013302 | 3300046616 | Bacteria | 4859 |
| 557 | Ga0495611_0001301 | 3300046648 | Bacteria | 12718 |
| 558 | Ga0495625_0013765 | 3300046660 | Bacteria | 6485 |
| 559 | Ga0495625_0101006 | 3300046660 | Bacteria | 1981 |
| 560 | Ga0495625_0323885 | 3300046660 | Bacteria | 981 |
| 561 | Ga0495661_0076192 | 3300046665 | Bacteria | 1947 |
| 562 | Ga0495647_0015452 | 3300046681 | Bacteria | 2676 |
| 563 | Ga0495658_0029956 | 3300046683 | Bacteria | 2951 |
| 564 | Ga0495613_0088924 | 3300046689 | Bacteria | 2238 |
| 565 | Ga0495671_0007850 | 3300046692 | Bacteria | 6036 |
| 566 | Ga0495671_0081346 | 3300046692 | Bacteria | 1587 |
| 567 | Ga0495600_0251453 | 3300046809 | Bacteria | 1124 |
| 568 | Ga0495660_0002170 | 3300046810 | Bacteria | 12640 |
| 569 | Ga0495660_0005705 | 3300046810 | Bacteria | 7436 |
| 570 | Ga0495660_0128716 | 3300046810 | Bacteria | 1272 |
| 571 | Ga0495674_0060425 | 3300047319 | Bacteria | 3307 |
| 572 | Ga0495674_0122819 | 3300047319 | Bacteria | 2193 |
| 573 | Ga0495672_0019406 | 3300047320 | Bacteria | 4484 |
| 574 | Ga0495672_0071109 | 3300047320 | Bacteria | 1970 |
| 575 | Ga0495683_0007635 | 3300047323 | Bacteria | 5824 |
| 576 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 577 | Ga0495673_0000057 | 3300047469 | Bacteria | 239715 |
| 578 | Ga0495673_0000060 | 3300047469 | Bacteria | 231642 |
| 579 | Ga0495673_0001499 | 3300047469 | Bacteria | 18453 |
| 580 | Ga0495681_0005784 | 3300047470 | Bacteria | 8219 |
| 581 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 582 | Ga0496110_0139725 | 3300048913 | Bacteria | 2190 |
| 583 | Ga0496114_0118480 | 3300048917 | Bacteria | 2275 |
| 584 | Ga0496114_0350935 | 3300048917 | Bacteria | 1305 |
| 585 | Ga0496116_0174029 | 3300048919 | Bacteria | 1162 |
| 586 | Ga0496118_0107338 | 3300048921 | Bacteria | 1865 |
| 587 | Ga0496120_0013718 | 3300048923 | Bacteria | 5440 |
| 588 | Ga0496121_0063939 | 3300048924 | Bacteria | 3003 |
| 589 | Ga0496122_0064999 | 3300048925 | Bacteria | 2649 |
| 590 | Ga0496122_0121491 | 3300048925 | Bacteria | 1683 |
| 591 | Ga0496123_0005878 | 3300048926 | Bacteria | 12142 |
| 592 | Ga0496124_0030281 | 3300048927 | Bacteria | 4806 |
| 593 | Ga0496124_0161710 | 3300048927 | Bacteria | 1744 |
| 594 | Ga0495678_000001 | 3300049459 | Bacteria | 1060340 |
| 595 | Ga0501033_0162028 | 3300049570 | Bacteria | 1610 |
| 596 | Ga0501033_0267137 | 3300049570 | Bacteria | 1210 |
| 597 | Ga0501034_0000002 | 3300049571 | Bacteria | 565510 |
| 598 | Ga0501034_0105806 | 3300049571 | Bacteria | 2806 |
| 599 | Ga0501034_0419454 | 3300049571 | Bacteria | 1260 |
| 600 | Ga0501037_0070596 | 3300049573 | Bacteria | 2541 |
| 601 | Ga0501038_0042362 | 3300049574 | Bacteria | 3965 |
| 602 | Ga0501039_0284788 | 3300049575 | Bacteria | 1299 |
| 603 | Ga0501043_0427145 | 3300049579 | Bacteria | 998 |
| 604 | Ga0501047_0008255 | 3300049581 | Bacteria | 9830 |
| 605 | Ga0501047_0026878 | 3300049581 | Bacteria | 5541 |
| 606 | Ga0501047_0521984 | 3300049581 | Bacteria | 1013 |
| 607 | Ga0501198_006925 | 3300049649 | Bacteria | 1623 |
| 608 | Ga0501202_032700 | 3300049652 | Bacteria | 1092 |
| 609 | Ga0501207_002857 | 3300049654 | Bacteria | 2256 |
| 610 | Ga0501222_004118 | 3300049662 | Bacteria | 1974 |
| 611 | Ga0501223_001541 | 3300049663 | Bacteria | 5309 |
| 612 | Ga0501224_032780 | 3300049664 | Bacteria | 779 |
| 613 | Ga0501235_016806 | 3300049669 | Bacteria | 1617 |
| 614 | Ga0501243_015685 | 3300049675 | Bacteria | 1219 |
| 615 | Ga0501253_036539 | 3300049683 | Bacteria | 968 |
| 616 | Ga0501253_083495 | 3300049683 | Bacteria | 724 |
| 617 | Ga0501259_002180 | 3300049688 | Bacteria | 3209 |
| 618 | Ga0501261_006510 | 3300049690 | Bacteria | 1485 |
| 619 | Ga0501219_000057 | 3300049703 | Bacteria | 18218 |
| 620 | Ga0501221_002141 | 3300049704 | Bacteria | 3281 |
| 621 | Ga0501225_0002651 | 3300049705 | Bacteria | 5495 |
| 622 | Ga0501225_0007024 | 3300049705 | Bacteria | 3276 |
| 623 | Ga0501225_0125371 | 3300049705 | Bacteria | 766 |
| 624 | Ga0501234_007721 | 3300049707 | Bacteria | 1681 |
| 625 | Ga0501080_0368783 | 3300049742 | Bacteria | 1295 |
| 626 | Ga0501232_006687 | 3300049757 | Bacteria | 1194 |
| 627 | Ga0501280_020643 | 3300049776 | Unclassified | 979 |
| 628 | Ga0501282_009016 | 3300049778 | Bacteria | 1070 |
| 629 | Ga0501035_0559296 | 3300049822 | Unclassified | 936 |
| 630 | Ga0501044_0020052 | 3300049823 | Bacteria | 7139 |
| 631 | Ga0501044_0150927 | 3300049823 | Bacteria | 2306 |
| 632 | Ga0501044_0350670 | 3300049823 | Bacteria | 1395 |
| 633 | Ga0501284_00010 | 3300050005 | Bacteria | 136120 |
| 634 | nmdc:mga0k408_198576_c1 | 3300050493 | Unclassified | 1197 |
| 635 | nmdc:mga0k408_269877_c1 | 3300050493 | Bacteria | 1016 |
| 636 | nmdc:mga05p37_1005544_c1 | 3300050507 | Bacteria | 885 |
| 637 | nmdc:mga05p37_157653_c1 | 3300050507 | Bacteria | 2773 |
| 638 | nmdc:mga05p37_16597_c1 | 3300050507 | Bacteria | 5356 |
| 639 | nmdc:mga09592_165054_c1 | 3300050508 | Bacteria | 1914 |
| 640 | nmdc:mga09592_212040_c1 | 3300050508 | Bacteria | 1678 |
| 641 | nmdc:mga09592_245322_c1 | 3300050508 | Bacteria | 1552 |
| 642 | nmdc:mga09592_41195_c1 | 3300050508 | Bacteria | 3883 |
| 643 | nmdc:mga09592_735425_c1 | 3300050508 | Bacteria | 838 |
| 644 | nmdc:mga0qj67_166438_c1 | 3300050509 | Bacteria | 1790 |
| 645 | nmdc:mga06r32_191576_c1 | 3300050510 | Unclassified | 2032 |
| 646 | nmdc:mga08y16_470308_c1 | 3300050511 | Bacteria | 1280 |
| 647 | nmdc:mga08y16_558049_c1 | 3300050511 | Bacteria | 1158 |
| 648 | Ga0500578_0000136 | 3300053086 | Bacteria | 88612 |
| 649 | Ga0500578_0013503 | 3300053086 | Bacteria | 5261 |
| 650 | Ga0500644_0000268 | 3300053088 | Bacteria | 29387 |
| 651 | Ga0500646_0032395 | 3300053090 | Bacteria | 1442 |
| 652 | Ga0500583_0030990 | 3300053092 | Bacteria | 2346 |
| 653 | Ga0500641_0000161 | 3300053096 | Bacteria | 24937 |
| 654 | Ga0500641_0004448 | 3300053096 | Bacteria | 4954 |
| 655 | Ga0500569_000810 | 3300053109 | Bacteria | 5506 |
| 656 | Ga0500572_050590 | 3300053111 | Bacteria | 1237 |
| 657 | Ga0500618_002053 | 3300053125 | Bacteria | 8117 |
| 658 | Ga0500652_014804 | 3300053131 | Unclassified | 2799 |
| 659 | Ga0500658_0103091 | 3300053134 | Bacteria | 1247 |
| 660 | Ga0500559_0002564 | 3300053136 | Bacteria | 9321 |
| 661 | Ga0500568_0000416 | 3300053139 | Bacteria | 32392 |
| 662 | Ga0500568_0006996 | 3300053139 | Bacteria | 5584 |
| 663 | Ga0500568_0013389 | 3300053139 | Bacteria | 3741 |
| 664 | Ga0500577_0005210 | 3300053142 | Bacteria | 3488 |
| 665 | Ga0500586_046454 | 3300053145 | Bacteria | 1488 |
| 666 | Ga0500588_0006086 | 3300053146 | Unclassified | 2712 |
| 667 | Ga0500603_058476 | 3300053150 | Bacteria | 1073 |
| 668 | Ga0500616_0004904 | 3300053153 | Bacteria | 9306 |
| 669 | Ga0500616_0023189 | 3300053153 | Bacteria | 3459 |
| 670 | Ga0500622_0010853 | 3300053156 | Bacteria | 4977 |
| 671 | Ga0500633_0001348 | 3300053160 | Bacteria | 4569 |
| 672 | Ga0500636_0049515 | 3300053177 | Bacteria | 2472 |
| 673 | Ga0500611_000074 | 3300053727 | Bacteria | 39951 |
| 674 | Ga0500587_007408 | 3300053739 | Bacteria | 1429 |
| 675 | Ga0466962_0105864 | 3300061719 | Bacteria | 1352 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041511 | Ga0451855_0590891 | Ga0451855_0590891_490_1122 | 191 |
| 2 | 3300044673 | Ga0453683_0095431 | Ga0453683_0095431_1197_1841 | 209 |
| 3 | 3300013105 | Ga0157369_10098008 | Ga0157369_100980083 | 210 |
| 4 | 3300037418 | Ga0395900_0427680 | Ga0395900_0427680_627_1262 | 210 |
| 5 | 3300013296 | Ga0157374_10067871 | Ga0157374_100678713 | 212 |
| 6 | 3300049705 | Ga0501225_0125371 | Ga0501225_0125371_71_751 | 212 |
| 7 | 3300033180 | Ga0307510_10008223 | Ga0307510_100082236 | 214 |
| 8 | 3300031456 | Ga0307513_10202249 | Ga0307513_102022492 | 216 |
| 9 | 3300046507 | Ga0495606_0004940 | Ga0495606_0004940_9827_10528 | 217 |
| 10 | iso_pu_bacteria | 2738541297 | 2738827229 | 218 |
| 11 | iso_pu_bacteria | 2738541357 | 2739151026 | 218 |
| 12 | iso_pu_bacteria | 2738543003 | 2739192945 | 218 |
| 13 | iso_pu_bacteria | 2738543026 | 2739319422 | 218 |
| 14 | iso_pu_bacteria | 2738543029 | 2739337663 | 218 |
| 15 | iso_pu_bacteria | 2821131069 | 2821134586 | 218 |
| 16 | iso_pu_bacteria | 2857553236 | 2857557096 | 218 |
| 17 | iso_pu_bacteria | 2857564685 | 2857570019 | 218 |
| 18 | 3300002738 | JGI25154J39366_1000495 | JGI25154J39366_10004955 | 219 |
| 19 | 3300003763 | Ga0055529_1000100 | Ga0055529_10001009 | 219 |
| 20 | 3300046452 | Ga0495617_000005 | Ga0495617_000005_174422_175090 | 219 |
| 21 | 3300046453 | Ga0495627_000038 | Ga0495627_000038_18897_19565 | 219 |
| 22 | 3300046463 | Ga0495653_0000031 | Ga0495653_0000031_21331_21999 | 219 |
| 23 | 3300046471 | Ga0495650_0000480 | Ga0495650_0000480_24255_24923 | 219 |
| 24 | 3300046471 | Ga0495650_0005526 | Ga0495650_0005526_169_837 | 219 |
| 25 | 3300046471 | Ga0495650_0106035 | Ga0495650_0106035_137_805 | 219 |
| 26 | 3300046474 | Ga0495605_0000082 | Ga0495605_0000082_850_1518 | 219 |
| 27 | 3300046492 | Ga0495585_0005600 | Ga0495585_0005600_766_1434 | 219 |
| 28 | 3300046507 | Ga0495606_0010571 | Ga0495606_0010571_6544_7212 | 219 |
| 29 | 3300046507 | Ga0495606_0010684 | Ga0495606_0010684_6376_7044 | 219 |
| 30 | 3300046512 | Ga0495610_0000038 | Ga0495610_0000038_175448_176116 | 219 |
| 31 | 3300046520 | Ga0495637_0002015 | Ga0495637_0002015_10145_10813 | 219 |
| 32 | 3300046522 | Ga0495643_0234791 | Ga0495643_0234791_145_813 | 219 |
| 33 | 3300046523 | Ga0495644_0020433 | Ga0495644_0020433_269_937 | 219 |
| 34 | 3300046524 | Ga0495648_0016117 | Ga0495648_0016117_976_1644 | 219 |
| 35 | 3300046524 | Ga0495648_0139714 | Ga0495648_0139714_477_1145 | 219 |
| 36 | 3300046530 | Ga0495654_0000047 | Ga0495654_0000047_142249_142917 | 219 |
| 37 | 3300046530 | Ga0495654_0032241 | Ga0495654_0032241_1679_2347 | 219 |
| 38 | 3300046538 | Ga0495609_0003278 | Ga0495609_0003278_1501_2169 | 219 |
| 39 | 3300046616 | Ga0495668_0005172 | Ga0495668_0005172_7771_8439 | 219 |
| 40 | 3300046660 | Ga0495625_0013765 | Ga0495625_0013765_5655_6323 | 219 |
| 41 | 3300046660 | Ga0495625_0101006 | Ga0495625_0101006_951_1619 | 219 |
| 42 | 3300046665 | Ga0495661_0076192 | Ga0495661_0076192_750_1418 | 219 |
| 43 | 3300046692 | Ga0495671_0007850 | Ga0495671_0007850_658_1326 | 219 |
| 44 | 3300046692 | Ga0495671_0081346 | Ga0495671_0081346_161_829 | 219 |
| 45 | 3300046810 | Ga0495660_0002170 | Ga0495660_0002170_2357_3025 | 219 |
| 46 | 3300046810 | Ga0495660_0005705 | Ga0495660_0005705_6153_6821 | 219 |
| 47 | 3300046810 | Ga0495660_0128716 | Ga0495660_0128716_502_1170 | 219 |
| 48 | 3300047323 | Ga0495683_0007635 | Ga0495683_0007635_4612_5280 | 219 |
| 49 | 3300047469 | Ga0495673_0000057 | Ga0495673_0000057_238651_239319 | 219 |
| 50 | 3300047469 | Ga0495673_0000060 | Ga0495673_0000060_161097_161765 | 219 |
| 51 | 3300047469 | Ga0495673_0001499 | Ga0495673_0001499_17390_18058 | 219 |
| 52 | 3300047470 | Ga0495681_0005784 | Ga0495681_0005784_6868_7536 | 219 |
| 53 | 3300048919 | Ga0496116_0174029 | Ga0496116_0174029_342_1010 | 219 |
| 54 | 3300048921 | Ga0496118_0107338 | Ga0496118_0107338_576_1244 | 219 |
| 55 | 3300048923 | Ga0496120_0013718 | Ga0496120_0013718_475_1143 | 219 |
| 56 | 3300048924 | Ga0496121_0063939 | Ga0496121_0063939_61_729 | 219 |
| 57 | 3300048925 | Ga0496122_0064999 | Ga0496122_0064999_500_1168 | 219 |
| 58 | 3300048925 | Ga0496122_0121491 | Ga0496122_0121491_343_1011 | 219 |
| 59 | 3300048926 | Ga0496123_0005878 | Ga0496123_0005878_908_1576 | 219 |
| 60 | 3300048927 | Ga0496124_0030281 | Ga0496124_0030281_741_1409 | 219 |
| 61 | 3300048927 | Ga0496124_0161710 | Ga0496124_0161710_407_1075 | 219 |
| 62 | 3300049459 | Ga0495678_000001 | Ga0495678_000001_172785_173453 | 219 |
| 63 | 3300053125 | Ga0500618_002053 | Ga0500618_002053_6441_7109 | 219 |
| 64 | 3300053145 | Ga0500586_046454 | Ga0500586_046454_710_1378 | 219 |
| 65 | 3300005456 | Ga0070678_100572284 | Ga0070678_1005722842 | 220 |
| 66 | 3300013306 | Ga0163162_11116772 | Ga0163162_111167721 | 220 |
| 67 | 3300025913 | Ga0207695_10185214 | Ga0207695_101852142 | 220 |
| 68 | 3300005337 | Ga0070682_100620238 | Ga0070682_1006202381 | 221 |
| 69 | 3300006177 | Ga0075362_10013837 | Ga0075362_100138372 | 221 |
| 70 | 3300006353 | Ga0075370_10507114 | Ga0075370_105071141 | 221 |
| 71 | 3300026089 | Ga0207648_10100431 | Ga0207648_101004312 | 221 |
| 72 | 3300046529 | Ga0495652_0587005 | Ga0495652_0587005_13_678 | 221 |
| 73 | iso_pu_bacteria | 2914759650 | 2914760435 | 221 |
| 74 | 3300003320 | rootH2_10030436 | rootH2_100304362 | 222 |
| 75 | 3300003320 | rootH2_10044418 | rootH2_100444182 | 222 |
| 76 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002214 | 222 |
| 77 | 3300044693 | Ga0466961_0314608 | Ga0466961_0314608_57_752 | 222 |
| 78 | 3300003320 | rootH2_10035373 | rootH2_100353732 | 223 |
| 79 | 3300005539 | Ga0068853_100000862 | Ga0068853_10000086219 | 223 |
| 80 | 3300005983 | Ga0081540_1005881 | Ga0081540_10058817 | 223 |
| 81 | 3300006358 | Ga0068871_100139315 | Ga0068871_1001393152 | 223 |
| 82 | 3300009093 | Ga0105240_10018088 | Ga0105240_100180882 | 223 |
| 83 | 3300009093 | Ga0105240_10055447 | Ga0105240_100554474 | 223 |
| 84 | 3300009093 | Ga0105240_10274119 | Ga0105240_102741192 | 223 |
| 85 | 3300009545 | Ga0105237_10001017 | Ga0105237_1000101719 | 223 |
| 86 | 3300009551 | Ga0105238_10943333 | Ga0105238_109433331 | 223 |
| 87 | 3300010375 | Ga0105239_10000436 | Ga0105239_1000043659 | 223 |
| 88 | 3300010375 | Ga0105239_10052181 | Ga0105239_100521812 | 223 |
| 89 | 3300010375 | Ga0105239_10220863 | Ga0105239_102208632 | 223 |
| 90 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001417 | 223 |
| 91 | 3300013307 | Ga0157372_10000595 | Ga0157372_1000059527 | 223 |
| 92 | 3300014969 | Ga0157376_10023949 | Ga0157376_100239493 | 223 |
| 93 | 3300025913 | Ga0207695_10000084 | Ga0207695_100000849 | 223 |
| 94 | 3300025914 | Ga0207671_10001353 | Ga0207671_1000135318 | 223 |
| 95 | 3300025924 | Ga0207694_10332733 | Ga0207694_103327331 | 223 |
| 96 | 3300025949 | Ga0207667_10100740 | Ga0207667_101007402 | 223 |
| 97 | 3300026041 | Ga0207639_10019483 | Ga0207639_100194832 | 223 |
| 98 | 3300031251 | Ga0265327_10000729 | Ga0265327_1000072911 | 223 |
| 99 | 3300044683 | Ga0466965_0074204 | Ga0466965_0074204_808_1494 | 223 |
| 100 | 3300044693 | Ga0466961_0018217 | Ga0466961_0018217_2339_3016 | 223 |
| 101 | 3300044719 | Ga0466971_0164791 | Ga0466971_0164791_53_730 | 223 |
| 102 | 3300045049 | Ga0466959_0011513 | Ga0466959_0011513_132_809 | 223 |
| 103 | 3300045836 | Ga0466958_0417503 | Ga0466958_0417503_166_843 | 223 |
| 104 | 3300046528 | Ga0495642_0035308 | Ga0495642_0035308_686_1369 | 223 |
| 105 | 3300046660 | Ga0495625_0323885 | Ga0495625_0323885_255_935 | 223 |
| 106 | 3300049703 | Ga0501219_000057 | Ga0501219_000057_3893_4570 | 223 |
| 107 | 3300050005 | Ga0501284_00010 | Ga0501284_00010_42797_43474 | 223 |
| 108 | 3300050493 | nmdc:mga0k408_198576_c1 | nmdc:mga0k408_198576_c1_398_1075 | 223 |
| 109 | 3300061719 | Ga0466962_0105864 | Ga0466962_0105864_639_1316 | 223 |
| 110 | 3300002459 | JGI24751J29686_10000878 | JGI24751J29686_100008786 | 224 |
| 111 | 3300003322 | rootL2_10002240 | rootL2_100022402 | 224 |
| 112 | 3300005329 | Ga0070683_100427908 | Ga0070683_1004279081 | 224 |
| 113 | 3300005330 | Ga0070690_100075264 | Ga0070690_1000752642 | 224 |
| 114 | 3300005331 | Ga0070670_100010352 | Ga0070670_1000103526 | 224 |
| 115 | 3300005331 | Ga0070670_100353460 | Ga0070670_1003534602 | 224 |
| 116 | 3300005331 | Ga0070670_100789649 | Ga0070670_1007896491 | 224 |
| 117 | 3300005335 | Ga0070666_10255039 | Ga0070666_102550392 | 224 |
| 118 | 3300005338 | Ga0068868_100087536 | Ga0068868_1000875362 | 224 |
| 119 | 3300005355 | Ga0070671_100287385 | Ga0070671_1002873852 | 224 |
| 120 | 3300005366 | Ga0070659_100088862 | Ga0070659_1000888622 | 224 |
| 121 | 3300005458 | Ga0070681_10548516 | Ga0070681_105485161 | 224 |
| 122 | 3300005539 | Ga0068853_100012555 | Ga0068853_1000125554 | 224 |
| 123 | 3300005539 | Ga0068853_100316906 | Ga0068853_1003169062 | 224 |
| 124 | 3300005577 | Ga0068857_100004225 | Ga0068857_1000042256 | 224 |
| 125 | 3300005577 | Ga0068857_100215589 | Ga0068857_1002155892 | 224 |
| 126 | 3300005578 | Ga0068854_100016394 | Ga0068854_1000163943 | 224 |
| 127 | 3300005614 | Ga0068856_100049890 | Ga0068856_1000498902 | 224 |
| 128 | 3300005616 | Ga0068852_100027478 | Ga0068852_1000274782 | 224 |
| 129 | 3300005618 | Ga0068864_100112896 | Ga0068864_1001128961 | 224 |
| 130 | 3300005718 | Ga0068866_10024684 | Ga0068866_100246842 | 224 |
| 131 | 3300005843 | Ga0068860_100036355 | Ga0068860_1000363552 | 224 |
| 132 | 3300005843 | Ga0068860_100168483 | Ga0068860_1001684832 | 224 |
| 133 | 3300006844 | Ga0075428_100057845 | Ga0075428_1000578453 | 224 |
| 134 | 3300006847 | Ga0075431_100019063 | Ga0075431_1000190633 | 224 |
| 135 | 3300009093 | Ga0105240_10116414 | Ga0105240_101164142 | 224 |
| 136 | 3300009093 | Ga0105240_10124078 | Ga0105240_101240782 | 224 |
| 137 | 3300009147 | Ga0114129_10043343 | Ga0114129_100433431 | 224 |
| 138 | 3300009174 | Ga0105241_10267194 | Ga0105241_102671942 | 224 |
| 139 | 3300009545 | Ga0105237_10042813 | Ga0105237_100428132 | 224 |
| 140 | 3300009545 | Ga0105237_10058858 | Ga0105237_100588582 | 224 |
| 141 | 3300009553 | Ga0105249_10001004 | Ga0105249_1000100415 | 224 |
| 142 | 3300010375 | Ga0105239_10018021 | Ga0105239_100180212 | 224 |
| 143 | 3300013104 | Ga0157370_10016530 | Ga0157370_100165302 | 224 |
| 144 | 3300013105 | Ga0157369_10010809 | Ga0157369_100108093 | 224 |
| 145 | 3300013297 | Ga0157378_10415797 | Ga0157378_104157972 | 224 |
| 146 | 3300013297 | Ga0157378_10899656 | Ga0157378_108996561 | 224 |
| 147 | 3300013307 | Ga0157372_10002860 | Ga0157372_100028603 | 224 |
| 148 | 3300025899 | Ga0207642_10058208 | Ga0207642_100582082 | 224 |
| 149 | 3300025904 | Ga0207647_10004651 | Ga0207647_100046512 | 224 |
| 150 | 3300025913 | Ga0207695_10045209 | Ga0207695_100452093 | 224 |
| 151 | 3300025914 | Ga0207671_10019690 | Ga0207671_100196903 | 224 |
| 152 | 3300025914 | Ga0207671_10030012 | Ga0207671_100300122 | 224 |
| 153 | 3300025925 | Ga0207650_10012336 | Ga0207650_100123365 | 224 |
| 154 | 3300025925 | Ga0207650_10390509 | Ga0207650_103905092 | 224 |
| 155 | 3300025925 | Ga0207650_10586318 | Ga0207650_105863182 | 224 |
| 156 | 3300025944 | Ga0207661_10528799 | Ga0207661_105287991 | 224 |
| 157 | 3300025949 | Ga0207667_10001676 | Ga0207667_1000167619 | 224 |
| 158 | 3300025961 | Ga0207712_10005926 | Ga0207712_100059264 | 224 |
| 159 | 3300026023 | Ga0207677_10049561 | Ga0207677_100495612 | 224 |
| 160 | 3300026041 | Ga0207639_10023273 | Ga0207639_100232732 | 224 |
| 161 | 3300026041 | Ga0207639_10040686 | Ga0207639_100406863 | 224 |
| 162 | 3300026089 | Ga0207648_10183046 | Ga0207648_101830462 | 224 |
| 163 | 3300026095 | Ga0207676_10013789 | Ga0207676_100137893 | 224 |
| 164 | 3300026116 | Ga0207674_10001819 | Ga0207674_100018194 | 224 |
| 165 | 3300026116 | Ga0207674_10049407 | Ga0207674_100494071 | 224 |
| 166 | 3300026118 | Ga0207675_100318837 | Ga0207675_1003188372 | 224 |
| 167 | 3300026142 | Ga0207698_10014385 | Ga0207698_100143854 | 224 |
| 168 | 3300028381 | Ga0268264_10006805 | Ga0268264_100068052 | 224 |
| 169 | 3300032004 | Ga0307414_10572589 | Ga0307414_105725891 | 224 |
| 170 | 3300044842 | Ga0466957_0008397 | Ga0466957_0008397_761_1441 | 224 |
| 171 | 3300050508 | nmdc:mga09592_41195_c1 | nmdc:mga09592_41195_c1_2892_3569 | 224 |
| 172 | 3300050510 | nmdc:mga06r32_191576_c1 | nmdc:mga06r32_191576_c1_568_1245 | 224 |
| 173 | 3300053146 | Ga0500588_0006086 | Ga0500588_0006086_28_711 | 224 |
| 174 | iso_pu_bacteria | 2818991442 | 2819572394 | 224 |
| 175 | iso_pu_bacteria | 2821136567 | 2821140234 | 224 |
| 176 | iso_pu_bacteria | 2904467357 | 2904472357 | 224 |
| 177 | 3300003320 | rootH2_10265654 | rootH2_102656542 | 225 |
| 178 | 3300003322 | rootL2_10213538 | rootL2_102135382 | 225 |
| 179 | 3300003323 | rootH1_10159857 | rootH1_101598572 | 225 |
| 180 | 3300005337 | Ga0070682_100000436 | Ga0070682_10000043613 | 225 |
| 181 | 3300005341 | Ga0070691_10000902 | Ga0070691_1000090211 | 225 |
| 182 | 3300005347 | Ga0070668_100265854 | Ga0070668_1002658541 | 225 |
| 183 | 3300005457 | Ga0070662_100264293 | Ga0070662_1002642931 | 225 |
| 184 | 3300005458 | Ga0070681_10283823 | Ga0070681_102838231 | 225 |
| 185 | 3300005530 | Ga0070679_100006566 | Ga0070679_1000065662 | 225 |
| 186 | 3300005547 | Ga0070693_100045301 | Ga0070693_1000453012 | 225 |
| 187 | 3300005563 | Ga0068855_100403016 | Ga0068855_1004030162 | 225 |
| 188 | 3300005577 | Ga0068857_100165906 | Ga0068857_1001659061 | 225 |
| 189 | 3300005614 | Ga0068856_100041808 | Ga0068856_1000418082 | 225 |
| 190 | 3300005617 | Ga0068859_100287176 | Ga0068859_1002871762 | 225 |
| 191 | 3300005719 | Ga0068861_100028014 | Ga0068861_1000280142 | 225 |
| 192 | 3300005841 | Ga0068863_100691596 | Ga0068863_1006915962 | 225 |
| 193 | 3300005843 | Ga0068860_100000097 | Ga0068860_10000009724 | 225 |
| 194 | 3300006358 | Ga0068871_100024610 | Ga0068871_1000246102 | 225 |
| 195 | 3300006931 | Ga0097620_100287146 | Ga0097620_1002871462 | 225 |
| 196 | 3300009093 | Ga0105240_10005151 | Ga0105240_1000515113 | 225 |
| 197 | 3300009101 | Ga0105247_10372700 | Ga0105247_103727002 | 225 |
| 198 | 3300009174 | Ga0105241_10000224 | Ga0105241_100002242 | 225 |
| 199 | 3300009174 | Ga0105241_10068803 | Ga0105241_100688033 | 225 |
| 200 | 3300009545 | Ga0105237_10011860 | Ga0105237_100118606 | 225 |
| 201 | 3300009545 | Ga0105237_10357436 | Ga0105237_103574362 | 225 |
| 202 | 3300010375 | Ga0105239_10000950 | Ga0105239_1000095029 | 225 |
| 203 | 3300013102 | Ga0157371_10045471 | Ga0157371_100454712 | 225 |
| 204 | 3300013102 | Ga0157371_10343877 | Ga0157371_103438771 | 225 |
| 205 | 3300013104 | Ga0157370_10004443 | Ga0157370_100044432 | 225 |
| 206 | 3300013104 | Ga0157370_10056510 | Ga0157370_100565102 | 225 |
| 207 | 3300013296 | Ga0157374_10144131 | Ga0157374_101441312 | 225 |
| 208 | 3300013306 | Ga0163162_10002183 | Ga0163162_1000218315 | 225 |
| 209 | 3300013307 | Ga0157372_10441827 | Ga0157372_104418271 | 225 |
| 210 | 3300014969 | Ga0157376_10004691 | Ga0157376_100046917 | 225 |
| 211 | 3300025911 | Ga0207654_10009301 | Ga0207654_100093014 | 225 |
| 212 | 3300025912 | Ga0207707_10000574 | Ga0207707_1000057429 | 225 |
| 213 | 3300025913 | Ga0207695_10028249 | Ga0207695_100282492 | 225 |
| 214 | 3300025917 | Ga0207660_10015118 | Ga0207660_100151181 | 225 |
| 215 | 3300025918 | Ga0207662_10364559 | Ga0207662_103645591 | 225 |
| 216 | 3300025921 | Ga0207652_10040033 | Ga0207652_100400331 | 225 |
| 217 | 3300025933 | Ga0207706_10367470 | Ga0207706_103674702 | 225 |
| 218 | 3300025949 | Ga0207667_10015139 | Ga0207667_100151396 | 225 |
| 219 | 3300025949 | Ga0207667_10332416 | Ga0207667_103324162 | 225 |
| 220 | 3300026041 | Ga0207639_10111886 | Ga0207639_101118862 | 225 |
| 221 | 3300026041 | Ga0207639_10158858 | Ga0207639_101588582 | 225 |
| 222 | 3300026078 | Ga0207702_10368187 | Ga0207702_103681871 | 225 |
| 223 | 3300026088 | Ga0207641_10102556 | Ga0207641_101025562 | 225 |
| 224 | 3300026116 | Ga0207674_10191428 | Ga0207674_101914281 | 225 |
| 225 | 3300026142 | Ga0207698_10218981 | Ga0207698_102189811 | 225 |
| 226 | 3300028379 | Ga0268266_10000038 | Ga0268266_10000038188 | 225 |
| 227 | 3300028381 | Ga0268264_10000525 | Ga0268264_1000052524 | 225 |
| 228 | 3300028794 | Ga0307515_10310094 | Ga0307515_103100942 | 225 |
| 229 | 3300031251 | Ga0265327_10056116 | Ga0265327_100561162 | 225 |
| 230 | 3300031456 | Ga0307513_10148404 | Ga0307513_101484042 | 225 |
| 231 | 3300031456 | Ga0307513_10517973 | Ga0307513_105179731 | 225 |
| 232 | 3300031507 | Ga0307509_10057770 | Ga0307509_100577703 | 225 |
| 233 | 3300031507 | Ga0307509_10111693 | Ga0307509_101116932 | 225 |
| 234 | 3300031616 | Ga0307508_10067009 | Ga0307508_100670093 | 225 |
| 235 | 3300031730 | Ga0307516_10003848 | Ga0307516_100038481 | 225 |
| 236 | 3300031730 | Ga0307516_10280655 | Ga0307516_102806552 | 225 |
| 237 | 3300041404 | Ga0439436_0054285 | Ga0439436_0054285_27_713 | 225 |
| 238 | 3300041406 | Ga0439439_0048161 | Ga0439439_0048161_89_772 | 225 |
| 239 | 3300041511 | Ga0451855_1969024 | Ga0451855_1969024_434_1123 | 225 |
| 240 | 3300041512 | Ga0451853_2224368 | Ga0451853_2224368_655_1353 | 225 |
| 241 | 3300042007 | Ga0439449_0006096 | Ga0439449_0006096_3667_4359 | 225 |
| 242 | 3300044656 | Ga0466969_0002777 | Ga0466969_0002777_2773_3474 | 225 |
| 243 | 3300044658 | Ga0466972_0000102 | Ga0466972_0000102_6377_7069 | 225 |
| 244 | 3300044658 | Ga0466972_0000639 | Ga0466972_0000639_10275_10961 | 225 |
| 245 | 3300044658 | Ga0466972_0006790 | Ga0466972_0006790_2469_3161 | 225 |
| 246 | 3300044673 | Ga0453683_0247990 | Ga0453683_0247990_118_804 | 225 |
| 247 | 3300045049 | Ga0466959_0000017 | Ga0466959_0000017_9544_10245 | 225 |
| 248 | 3300046524 | Ga0495648_0074059 | Ga0495648_0074059_1039_1725 | 225 |
| 249 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_668597_669283 | 225 |
| 250 | 3300049571 | Ga0501034_0419454 | Ga0501034_0419454_514_1206 | 225 |
| 251 | 3300049579 | Ga0501043_0427145 | Ga0501043_0427145_50_742 | 225 |
| 252 | 3300049581 | Ga0501047_0026878 | Ga0501047_0026878_1066_1758 | 225 |
| 253 | 3300049649 | Ga0501198_006925 | Ga0501198_006925_372_1055 | 225 |
| 254 | 3300049652 | Ga0501202_032700 | Ga0501202_032700_327_1010 | 225 |
| 255 | 3300049654 | Ga0501207_002857 | Ga0501207_002857_757_1440 | 225 |
| 256 | 3300049662 | Ga0501222_004118 | Ga0501222_004118_63_746 | 225 |
| 257 | 3300049663 | Ga0501223_001541 | Ga0501223_001541_431_1114 | 225 |
| 258 | 3300049664 | Ga0501224_032780 | Ga0501224_032780_77_760 | 225 |
| 259 | 3300049669 | Ga0501235_016806 | Ga0501235_016806_95_778 | 225 |
| 260 | 3300049675 | Ga0501243_015685 | Ga0501243_015685_51_734 | 225 |
| 261 | 3300049683 | Ga0501253_036539 | Ga0501253_036539_172_855 | 225 |
| 262 | 3300049688 | Ga0501259_002180 | Ga0501259_002180_1266_1949 | 225 |
| 263 | 3300049690 | Ga0501261_006510 | Ga0501261_006510_335_1018 | 225 |
| 264 | 3300049704 | Ga0501221_002141 | Ga0501221_002141_545_1228 | 225 |
| 265 | 3300049705 | Ga0501225_0002651 | Ga0501225_0002651_3138_3836 | 225 |
| 266 | 3300049705 | Ga0501225_0007024 | Ga0501225_0007024_2119_2802 | 225 |
| 267 | 3300049707 | Ga0501234_007721 | Ga0501234_007721_689_1372 | 225 |
| 268 | 3300049757 | Ga0501232_006687 | Ga0501232_006687_434_1117 | 225 |
| 269 | 3300049778 | Ga0501282_009016 | Ga0501282_009016_63_746 | 225 |
| 270 | 3300049823 | Ga0501044_0020052 | Ga0501044_0020052_2187_2879 | 225 |
| 271 | 3300050507 | nmdc:mga05p37_16597_c1 | nmdc:mga05p37_16597_c1_2535_3218 | 225 |
| 272 | 3300053086 | Ga0500578_0000136 | Ga0500578_0000136_63878_64570 | 225 |
| 273 | 3300053086 | Ga0500578_0013503 | Ga0500578_0013503_1437_2129 | 225 |
| 274 | 3300053111 | Ga0500572_050590 | Ga0500572_050590_176_874 | 225 |
| 275 | 3300053131 | Ga0500652_014804 | Ga0500652_014804_1981_2685 | 225 |
| 276 | 3300053139 | Ga0500568_0006996 | Ga0500568_0006996_1017_1703 | 225 |
| 277 | 3300053150 | Ga0500603_058476 | Ga0500603_058476_89_790 | 225 |
| 278 | 3300053153 | Ga0500616_0023189 | Ga0500616_0023189_1169_1867 | 225 |
| 279 | 3300053156 | Ga0500622_0010853 | Ga0500622_0010853_3868_4554 | 225 |
| 280 | 3300053739 | Ga0500587_007408 | Ga0500587_007408_550_1254 | 225 |
| 281 | iso_pu_bacteria | 2840677318 | 2840677799 | 225 |
| 282 | iso_pu_bacteria | 2883068021 | 2883071068 | 225 |
| 283 | iso_pu_bacteria | 2884791551 | 2884797953 | 225 |
| 284 | iso_pu_bacteria | 2896085136 | 2896085617 | 225 |
| 285 | iso_pu_bacteria | 2896109856 | 2896113825 | 225 |
| 286 | iso_pu_bacteria | 2929177148 | 2929182910 | 225 |
| 287 | iso_pu_bacteria | 2945977869 | 2945978868 | 225 |
| 288 | iso_pu_bacteria | 2946013367 | 2946015266 | 225 |
| 289 | 3300005288 | Ga0065714_10118317 | Ga0065714_101183172 | 226 |
| 290 | 3300005289 | Ga0065704_10157563 | Ga0065704_101575631 | 226 |
| 291 | 3300005290 | Ga0065712_10134766 | Ga0065712_101347662 | 226 |
| 292 | 3300005293 | Ga0065715_10032656 | Ga0065715_100326562 | 226 |
| 293 | 3300005295 | Ga0065707_10115278 | Ga0065707_101152781 | 226 |
| 294 | 3300005295 | Ga0065707_10239343 | Ga0065707_102393431 | 226 |
| 295 | 3300005327 | Ga0070658_10635485 | Ga0070658_106354851 | 226 |
| 296 | 3300005328 | Ga0070676_10002015 | Ga0070676_100020154 | 226 |
| 297 | 3300005328 | Ga0070676_10026397 | Ga0070676_100263972 | 226 |
| 298 | 3300005328 | Ga0070676_10078119 | Ga0070676_100781192 | 226 |
| 299 | 3300005329 | Ga0070683_100006190 | Ga0070683_1000061903 | 226 |
| 300 | 3300005329 | Ga0070683_100144781 | Ga0070683_1001447812 | 226 |
| 301 | 3300005329 | Ga0070683_100432397 | Ga0070683_1004323971 | 226 |
| 302 | 3300005329 | Ga0070683_100938709 | Ga0070683_1009387091 | 226 |
| 303 | 3300005330 | Ga0070690_100080739 | Ga0070690_1000807392 | 226 |
| 304 | 3300005331 | Ga0070670_100109869 | Ga0070670_1001098692 | 226 |
| 305 | 3300005331 | Ga0070670_100155603 | Ga0070670_1001556033 | 226 |
| 306 | 3300005331 | Ga0070670_100655742 | Ga0070670_1006557421 | 226 |
| 307 | 3300005331 | Ga0070670_100669057 | Ga0070670_1006690571 | 226 |
| 308 | 3300005334 | Ga0068869_100746194 | Ga0068869_1007461941 | 226 |
| 309 | 3300005335 | Ga0070666_10003629 | Ga0070666_100036294 | 226 |
| 310 | 3300005338 | Ga0068868_100016918 | Ga0068868_1000169182 | 226 |
| 311 | 3300005339 | Ga0070660_100225733 | Ga0070660_1002257332 | 226 |
| 312 | 3300005340 | Ga0070689_100148146 | Ga0070689_1001481461 | 226 |
| 313 | 3300005347 | Ga0070668_100000401 | Ga0070668_10000040117 | 226 |
| 314 | 3300005347 | Ga0070668_100635383 | Ga0070668_1006353831 | 226 |
| 315 | 3300005353 | Ga0070669_100417189 | Ga0070669_1004171891 | 226 |
| 316 | 3300005354 | Ga0070675_100131429 | Ga0070675_1001314292 | 226 |
| 317 | 3300005354 | Ga0070675_100324930 | Ga0070675_1003249301 | 226 |
| 318 | 3300005354 | Ga0070675_100381000 | Ga0070675_1003810001 | 226 |
| 319 | 3300005356 | Ga0070674_100079478 | Ga0070674_1000794782 | 226 |
| 320 | 3300005364 | Ga0070673_100050165 | Ga0070673_1000501652 | 226 |
| 321 | 3300005365 | Ga0070688_100049115 | Ga0070688_1000491152 | 226 |
| 322 | 3300005365 | Ga0070688_100053780 | Ga0070688_1000537802 | 226 |
| 323 | 3300005367 | Ga0070667_100000533 | Ga0070667_10000053310 | 226 |
| 324 | 3300005367 | Ga0070667_100135381 | Ga0070667_1001353812 | 226 |
| 325 | 3300005457 | Ga0070662_100387975 | Ga0070662_1003879752 | 226 |
| 326 | 3300005459 | Ga0068867_100150829 | Ga0068867_1001508292 | 226 |
| 327 | 3300005466 | Ga0070685_10171506 | Ga0070685_101715061 | 226 |
| 328 | 3300005471 | Ga0070698_100000791 | Ga0070698_10000079111 | 226 |
| 329 | 3300005471 | Ga0070698_100004354 | Ga0070698_1000043549 | 226 |
| 330 | 3300005535 | Ga0070684_100582146 | Ga0070684_1005821461 | 226 |
| 331 | 3300005539 | Ga0068853_100130045 | Ga0068853_1001300452 | 226 |
| 332 | 3300005539 | Ga0068853_100348311 | Ga0068853_1003483112 | 226 |
| 333 | 3300005539 | Ga0068853_100674548 | Ga0068853_1006745481 | 226 |
| 334 | 3300005543 | Ga0070672_100001693 | Ga0070672_1000016939 | 226 |
| 335 | 3300005543 | Ga0070672_100151119 | Ga0070672_1001511192 | 226 |
| 336 | 3300005543 | Ga0070672_100821786 | Ga0070672_1008217861 | 226 |
| 337 | 3300005544 | Ga0070686_100179147 | Ga0070686_1001791472 | 226 |
| 338 | 3300005544 | Ga0070686_100504154 | Ga0070686_1005041541 | 226 |
| 339 | 3300005544 | Ga0070686_100673244 | Ga0070686_1006732441 | 226 |
| 340 | 3300005548 | Ga0070665_100002361 | Ga0070665_10000236118 | 226 |
| 341 | 3300005548 | Ga0070665_100277083 | Ga0070665_1002770831 | 226 |
| 342 | 3300005563 | Ga0068855_100001333 | Ga0068855_1000013339 | 226 |
| 343 | 3300005563 | Ga0068855_100059968 | Ga0068855_1000599683 | 226 |
| 344 | 3300005564 | Ga0070664_100013343 | Ga0070664_1000133433 | 226 |
| 345 | 3300005564 | Ga0070664_100228262 | Ga0070664_1002282623 | 226 |
| 346 | 3300005564 | Ga0070664_100420607 | Ga0070664_1004206072 | 226 |
| 347 | 3300005578 | Ga0068854_100214933 | Ga0068854_1002149332 | 226 |
| 348 | 3300005616 | Ga0068852_100027026 | Ga0068852_1000270265 | 226 |
| 349 | 3300005616 | Ga0068852_100259873 | Ga0068852_1002598732 | 226 |
| 350 | 3300005616 | Ga0068852_100556611 | Ga0068852_1005566112 | 226 |
| 351 | 3300005617 | Ga0068859_100140602 | Ga0068859_1001406022 | 226 |
| 352 | 3300005617 | Ga0068859_100196183 | Ga0068859_1001961833 | 226 |
| 353 | 3300005617 | Ga0068859_100383246 | Ga0068859_1003832462 | 226 |
| 354 | 3300005618 | Ga0068864_100000697 | Ga0068864_1000006979 | 226 |
| 355 | 3300005618 | Ga0068864_100036995 | Ga0068864_1000369953 | 226 |
| 356 | 3300005618 | Ga0068864_100283670 | Ga0068864_1002836701 | 226 |
| 357 | 3300005718 | Ga0068866_10469036 | Ga0068866_104690361 | 226 |
| 358 | 3300005719 | Ga0068861_100051919 | Ga0068861_1000519192 | 226 |
| 359 | 3300005719 | Ga0068861_100324608 | Ga0068861_1003246081 | 226 |
| 360 | 3300005834 | Ga0068851_10048655 | Ga0068851_100486551 | 226 |
| 361 | 3300005841 | Ga0068863_100017171 | Ga0068863_1000171711 | 226 |
| 362 | 3300005841 | Ga0068863_100086885 | Ga0068863_1000868852 | 226 |
| 363 | 3300005841 | Ga0068863_100134090 | Ga0068863_1001340903 | 226 |
| 364 | 3300005842 | Ga0068858_100002045 | Ga0068858_1000020454 | 226 |
| 365 | 3300005843 | Ga0068860_100002600 | Ga0068860_1000026002 | 226 |
| 366 | 3300005844 | Ga0068862_100328193 | Ga0068862_1003281932 | 226 |
| 367 | 3300006237 | Ga0097621_100002514 | Ga0097621_1000025148 | 226 |
| 368 | 3300006237 | Ga0097621_100053932 | Ga0097621_1000539323 | 226 |
| 369 | 3300006358 | Ga0068871_100023999 | Ga0068871_1000239993 | 226 |
| 370 | 3300006358 | Ga0068871_100060922 | Ga0068871_1000609223 | 226 |
| 371 | 3300006844 | Ga0075428_100820862 | Ga0075428_1008208622 | 226 |
| 372 | 3300006881 | Ga0068865_100017180 | Ga0068865_1000171802 | 226 |
| 373 | 3300006881 | Ga0068865_100599920 | Ga0068865_1005999201 | 226 |
| 374 | 3300006931 | Ga0097620_100140601 | Ga0097620_1001406012 | 226 |
| 375 | 3300006931 | Ga0097620_100196186 | Ga0097620_1001961863 | 226 |
| 376 | 3300006931 | Ga0097620_100383216 | Ga0097620_1003832162 | 226 |
| 377 | 3300009011 | Ga0105251_10132350 | Ga0105251_101323502 | 226 |
| 378 | 3300009093 | Ga0105240_10001904 | Ga0105240_1000190426 | 226 |
| 379 | 3300009093 | Ga0105240_10003186 | Ga0105240_1000318622 | 226 |
| 380 | 3300009093 | Ga0105240_10100537 | Ga0105240_101005373 | 226 |
| 381 | 3300009098 | Ga0105245_10580144 | Ga0105245_105801442 | 226 |
| 382 | 3300009147 | Ga0114129_11172992 | Ga0114129_111729922 | 226 |
| 383 | 3300009174 | Ga0105241_10000614 | Ga0105241_1000061423 | 226 |
| 384 | 3300009176 | Ga0105242_10031974 | Ga0105242_100319741 | 226 |
| 385 | 3300009176 | Ga0105242_10090660 | Ga0105242_100906601 | 226 |
| 386 | 3300009177 | Ga0105248_10011550 | Ga0105248_100115505 | 226 |
| 387 | 3300009545 | Ga0105237_10221775 | Ga0105237_102217752 | 226 |
| 388 | 3300009551 | Ga0105238_10069232 | Ga0105238_100692321 | 226 |
| 389 | 3300009551 | Ga0105238_10153848 | Ga0105238_101538482 | 226 |
| 390 | 3300009551 | Ga0105238_10768409 | Ga0105238_107684091 | 226 |
| 391 | 3300009551 | Ga0105238_11238130 | Ga0105238_112381301 | 226 |
| 392 | 3300009553 | Ga0105249_10020949 | Ga0105249_100209495 | 226 |
| 393 | 3300009553 | Ga0105249_10418161 | Ga0105249_104181612 | 226 |
| 394 | 3300010375 | Ga0105239_10311490 | Ga0105239_103114902 | 226 |
| 395 | 3300013100 | Ga0157373_10004590 | Ga0157373_100045909 | 226 |
| 396 | 3300013102 | Ga0157371_10016646 | Ga0157371_100166462 | 226 |
| 397 | 3300013102 | Ga0157371_10108651 | Ga0157371_101086512 | 226 |
| 398 | 3300013104 | Ga0157370_10039463 | Ga0157370_100394633 | 226 |
| 399 | 3300013105 | Ga0157369_10141867 | Ga0157369_101418672 | 226 |
| 400 | 3300013296 | Ga0157374_10043425 | Ga0157374_100434253 | 226 |
| 401 | 3300013296 | Ga0157374_10458457 | Ga0157374_104584571 | 226 |
| 402 | 3300013297 | Ga0157378_10007269 | Ga0157378_100072695 | 226 |
| 403 | 3300013297 | Ga0157378_10105414 | Ga0157378_101054141 | 226 |
| 404 | 3300013306 | Ga0163162_10056597 | Ga0163162_100565971 | 226 |
| 405 | 3300013306 | Ga0163162_10073563 | Ga0163162_100735633 | 226 |
| 406 | 3300013306 | Ga0163162_10099428 | Ga0163162_100994281 | 226 |
| 407 | 3300013307 | Ga0157372_10123578 | Ga0157372_101235784 | 226 |
| 408 | 3300013307 | Ga0157372_10193476 | Ga0157372_101934762 | 226 |
| 409 | 3300013307 | Ga0157372_10500768 | Ga0157372_105007682 | 226 |
| 410 | 3300013307 | Ga0157372_11362987 | Ga0157372_113629871 | 226 |
| 411 | 3300013308 | Ga0157375_10157860 | Ga0157375_101578602 | 226 |
| 412 | 3300013308 | Ga0157375_10229430 | Ga0157375_102294304 | 226 |
| 413 | 3300013308 | Ga0157375_10366991 | Ga0157375_103669911 | 226 |
| 414 | 3300014325 | Ga0163163_10000254 | Ga0163163_100002542 | 226 |
| 415 | 3300014325 | Ga0163163_10306165 | Ga0163163_103061652 | 226 |
| 416 | 3300014325 | Ga0163163_10562626 | Ga0163163_105626261 | 226 |
| 417 | 3300014326 | Ga0157380_10031820 | Ga0157380_100318201 | 226 |
| 418 | 3300014326 | Ga0157380_10583785 | Ga0157380_105837852 | 226 |
| 419 | 3300014326 | Ga0157380_10900803 | Ga0157380_109008032 | 226 |
| 420 | 3300014745 | Ga0157377_10072135 | Ga0157377_100721352 | 226 |
| 421 | 3300014745 | Ga0157377_10268223 | Ga0157377_102682232 | 226 |
| 422 | 3300014968 | Ga0157379_10000834 | Ga0157379_1000083414 | 226 |
| 423 | 3300014969 | Ga0157376_10082968 | Ga0157376_100829681 | 226 |
| 424 | 3300014969 | Ga0157376_10114509 | Ga0157376_101145092 | 226 |
| 425 | 3300017792 | Ga0163161_10032911 | Ga0163161_100329113 | 226 |
| 426 | 3300017792 | Ga0163161_10330948 | Ga0163161_103309481 | 226 |
| 427 | 3300017792 | Ga0163161_10589028 | Ga0163161_105890281 | 226 |
| 428 | 3300025321 | Ga0207656_10058306 | Ga0207656_100583061 | 226 |
| 429 | 3300025321 | Ga0207656_10154167 | Ga0207656_101541672 | 226 |
| 430 | 3300025899 | Ga0207642_10132087 | Ga0207642_101320872 | 226 |
| 431 | 3300025903 | Ga0207680_10000847 | Ga0207680_100008476 | 226 |
| 432 | 3300025907 | Ga0207645_10001168 | Ga0207645_100011685 | 226 |
| 433 | 3300025907 | Ga0207645_10012253 | Ga0207645_100122534 | 226 |
| 434 | 3300025908 | Ga0207643_10045475 | Ga0207643_100454752 | 226 |
| 435 | 3300025913 | Ga0207695_10000076 | Ga0207695_100000769 | 226 |
| 436 | 3300025913 | Ga0207695_10000090 | Ga0207695_100000909 | 226 |
| 437 | 3300025918 | Ga0207662_10045653 | Ga0207662_100456532 | 226 |
| 438 | 3300025920 | Ga0207649_10104806 | Ga0207649_101048063 | 226 |
| 439 | 3300025920 | Ga0207649_10109016 | Ga0207649_101090161 | 226 |
| 440 | 3300025920 | Ga0207649_10643792 | Ga0207649_106437921 | 226 |
| 441 | 3300025923 | Ga0207681_10087502 | Ga0207681_100875022 | 226 |
| 442 | 3300025924 | Ga0207694_10048175 | Ga0207694_100481751 | 226 |
| 443 | 3300025924 | Ga0207694_10064195 | Ga0207694_100641952 | 226 |
| 444 | 3300025925 | Ga0207650_10047872 | Ga0207650_100478722 | 226 |
| 445 | 3300025925 | Ga0207650_10100195 | Ga0207650_101001952 | 226 |
| 446 | 3300025925 | Ga0207650_10140969 | Ga0207650_101409691 | 226 |
| 447 | 3300025925 | Ga0207650_10409483 | Ga0207650_104094831 | 226 |
| 448 | 3300025926 | Ga0207659_10133973 | Ga0207659_101339731 | 226 |
| 449 | 3300025926 | Ga0207659_10353755 | Ga0207659_103537552 | 226 |
| 450 | 3300025931 | Ga0207644_10148048 | Ga0207644_101480481 | 226 |
| 451 | 3300025933 | Ga0207706_10057757 | Ga0207706_100577572 | 226 |
| 452 | 3300025933 | Ga0207706_10507906 | Ga0207706_105079062 | 226 |
| 453 | 3300025934 | Ga0207686_10020673 | Ga0207686_100206731 | 226 |
| 454 | 3300025934 | Ga0207686_10051166 | Ga0207686_100511662 | 226 |
| 455 | 3300025935 | Ga0207709_10226143 | Ga0207709_102261431 | 226 |
| 456 | 3300025936 | Ga0207670_10067709 | Ga0207670_100677092 | 226 |
| 457 | 3300025938 | Ga0207704_10005751 | Ga0207704_100057515 | 226 |
| 458 | 3300025940 | Ga0207691_10000835 | Ga0207691_1000083515 | 226 |
| 459 | 3300025940 | Ga0207691_10011149 | Ga0207691_100111492 | 226 |
| 460 | 3300025940 | Ga0207691_10149323 | Ga0207691_101493232 | 226 |
| 461 | 3300025940 | Ga0207691_10253973 | Ga0207691_102539731 | 226 |
| 462 | 3300025942 | Ga0207689_10027179 | Ga0207689_100271794 | 226 |
| 463 | 3300025942 | Ga0207689_10725778 | Ga0207689_107257781 | 226 |
| 464 | 3300025944 | Ga0207661_10007166 | Ga0207661_100071665 | 226 |
| 465 | 3300025944 | Ga0207661_10017068 | Ga0207661_100170684 | 226 |
| 466 | 3300025944 | Ga0207661_10112482 | Ga0207661_101124822 | 226 |
| 467 | 3300025944 | Ga0207661_10869637 | Ga0207661_108696371 | 226 |
| 468 | 3300025945 | Ga0207679_10008161 | Ga0207679_100081614 | 226 |
| 469 | 3300025949 | Ga0207667_10000911 | Ga0207667_1000091114 | 226 |
| 470 | 3300025949 | Ga0207667_10051804 | Ga0207667_100518042 | 226 |
| 471 | 3300025949 | Ga0207667_10987775 | Ga0207667_109877752 | 226 |
| 472 | 3300025960 | Ga0207651_10001175 | Ga0207651_100011752 | 226 |
| 473 | 3300025960 | Ga0207651_10463322 | Ga0207651_104633221 | 226 |
| 474 | 3300025961 | Ga0207712_10002266 | Ga0207712_1000226611 | 226 |
| 475 | 3300025961 | Ga0207712_10057660 | Ga0207712_100576602 | 226 |
| 476 | 3300025961 | Ga0207712_10193269 | Ga0207712_101932691 | 226 |
| 477 | 3300025961 | Ga0207712_10548180 | Ga0207712_105481801 | 226 |
| 478 | 3300025972 | Ga0207668_10000881 | Ga0207668_1000088112 | 226 |
| 479 | 3300025972 | Ga0207668_10060441 | Ga0207668_100604412 | 226 |
| 480 | 3300025986 | Ga0207658_10001477 | Ga0207658_100014772 | 226 |
| 481 | 3300026023 | Ga0207677_10263284 | Ga0207677_102632842 | 226 |
| 482 | 3300026035 | Ga0207703_10011298 | Ga0207703_100112983 | 226 |
| 483 | 3300026041 | Ga0207639_10102348 | Ga0207639_101023482 | 226 |
| 484 | 3300026041 | Ga0207639_10132276 | Ga0207639_101322762 | 226 |
| 485 | 3300026041 | Ga0207639_10252731 | Ga0207639_102527311 | 226 |
| 486 | 3300026041 | Ga0207639_10313968 | Ga0207639_103139682 | 226 |
| 487 | 3300026067 | Ga0207678_10035118 | Ga0207678_100351182 | 226 |
| 488 | 3300026075 | Ga0207708_10333639 | Ga0207708_103336392 | 226 |
| 489 | 3300026088 | Ga0207641_10006594 | Ga0207641_100065942 | 226 |
| 490 | 3300026088 | Ga0207641_10023686 | Ga0207641_100236861 | 226 |
| 491 | 3300026088 | Ga0207641_10256143 | Ga0207641_102561432 | 226 |
| 492 | 3300026089 | Ga0207648_10001518 | Ga0207648_1000151811 | 226 |
| 493 | 3300026095 | Ga0207676_10003724 | Ga0207676_100037244 | 226 |
| 494 | 3300026095 | Ga0207676_10383994 | Ga0207676_103839942 | 226 |
| 495 | 3300026116 | Ga0207674_10191432 | Ga0207674_101914322 | 226 |
| 496 | 3300026118 | Ga0207675_100129414 | Ga0207675_1001294142 | 226 |
| 497 | 3300026118 | Ga0207675_100961924 | Ga0207675_1009619242 | 226 |
| 498 | 3300028379 | Ga0268266_10007473 | Ga0268266_100074733 | 226 |
| 499 | 3300028379 | Ga0268266_10364279 | Ga0268266_103642791 | 226 |
| 500 | 3300028380 | Ga0268265_10697715 | Ga0268265_106977151 | 226 |
| 501 | 3300028381 | Ga0268264_10018300 | Ga0268264_100183002 | 226 |
| 502 | 3300031824 | Ga0307413_10139242 | Ga0307413_101392422 | 226 |
| 503 | 3300032004 | Ga0307414_10066550 | Ga0307414_100665501 | 226 |
| 504 | 3300035398 | Ga0316574_0270919 | Ga0316574_0270919_145_843 | 226 |
| 505 | 3300035692 | Ga0373935_0128425 | Ga0373935_0128425_299_1021 | 226 |
| 506 | 3300036712 | Ga0316584_0016898 | Ga0316584_0016898_782_1480 | 226 |
| 507 | 3300037471 | Ga0395905_0076975 | Ga0395905_0076975_323_1003 | 226 |
| 508 | 3300041511 | Ga0451855_1209573 | Ga0451855_1209573_791_1480 | 226 |
| 509 | 3300041511 | Ga0451855_2010349 | Ga0451855_2010349_1917_2609 | 226 |
| 510 | 3300042007 | Ga0439449_0002035 | Ga0439449_0002035_212_901 | 226 |
| 511 | 3300042014 | Ga0439457_012705 | Ga0439457_012705_725_1414 | 226 |
| 512 | 3300044735 | Ga0466968_0096002 | Ga0466968_0096002_114_824 | 226 |
| 513 | 3300046648 | Ga0495611_0001301 | Ga0495611_0001301_9344_10063 | 226 |
| 514 | 3300046809 | Ga0495600_0251453 | Ga0495600_0251453_369_1091 | 226 |
| 515 | 3300047320 | Ga0495672_0019406 | Ga0495672_0019406_3741_4424 | 226 |
| 516 | 3300048913 | Ga0496110_0139725 | Ga0496110_0139725_1214_1906 | 226 |
| 517 | 3300048917 | Ga0496114_0118480 | Ga0496114_0118480_840_1532 | 226 |
| 518 | 3300050507 | nmdc:mga05p37_1005544_c1 | nmdc:mga05p37_1005544_c1_129_872 | 226 |
| 519 | 3300050511 | nmdc:mga08y16_470308_c1 | nmdc:mga08y16_470308_c1_546_1229 | 226 |
| 520 | 3300050511 | nmdc:mga08y16_558049_c1 | nmdc:mga08y16_558049_c1_277_981 | 226 |
| 521 | 3300053096 | Ga0500641_0000161 | Ga0500641_0000161_9110_9802 | 226 |
| 522 | 3300053139 | Ga0500568_0000416 | Ga0500568_0000416_15275_15958 | 226 |
| 523 | 3300053727 | Ga0500611_000074 | Ga0500611_000074_3055_3738 | 226 |
| 524 | iso_pu_bacteria | 2881955468 | 2881957188 | 226 |
| 525 | iso_pu_bacteria | 2929921140 | 2929927317 | 226 |
| 526 | iso_pu_bacteria | 8003151029 | 8003151202 | 226 |
| 527 | 3300003316 | rootH1_10061546 | rootH1_100615462 | 227 |
| 528 | 3300005329 | Ga0070683_100313284 | Ga0070683_1003132842 | 227 |
| 529 | 3300005334 | Ga0068869_100027165 | Ga0068869_1000271651 | 227 |
| 530 | 3300005367 | Ga0070667_100034803 | Ga0070667_1000348031 | 227 |
| 531 | 3300005549 | Ga0070704_100444270 | Ga0070704_1004442702 | 227 |
| 532 | 3300005841 | Ga0068863_100220732 | Ga0068863_1002207323 | 227 |
| 533 | 3300005843 | Ga0068860_100283406 | Ga0068860_1002834062 | 227 |
| 534 | 3300005844 | Ga0068862_100578801 | Ga0068862_1005788011 | 227 |
| 535 | 3300006844 | Ga0075428_100243033 | Ga0075428_1002430333 | 227 |
| 536 | 3300006844 | Ga0075428_100316736 | Ga0075428_1003167362 | 227 |
| 537 | 3300006880 | Ga0075429_100558675 | Ga0075429_1005586752 | 227 |
| 538 | 3300009094 | Ga0111539_10038533 | Ga0111539_100385332 | 227 |
| 539 | 3300009147 | Ga0114129_10055854 | Ga0114129_100558544 | 227 |
| 540 | 3300009148 | Ga0105243_10163300 | Ga0105243_101633002 | 227 |
| 541 | 3300009553 | Ga0105249_10307793 | Ga0105249_103077932 | 227 |
| 542 | 3300013297 | Ga0157378_10840759 | Ga0157378_108407592 | 227 |
| 543 | 3300014326 | Ga0157380_10108857 | Ga0157380_101088572 | 227 |
| 544 | 3300025942 | Ga0207689_10003622 | Ga0207689_1000362210 | 227 |
| 545 | 3300025961 | Ga0207712_10611057 | Ga0207712_106110572 | 227 |
| 546 | 3300030731 | Ga0316177_1221645 | Ga0316177_12216451 | 227 |
| 547 | 3300031727 | Ga0316576_10281721 | Ga0316576_102817212 | 227 |
| 548 | 3300035398 | Ga0316574_0150691 | Ga0316574_0150691_368_1066 | 227 |
| 549 | 3300035398 | Ga0316574_0196822 | Ga0316574_0196822_487_1182 | 227 |
| 550 | 3300036647 | Ga0316582_0591881 | Ga0316582_0591881_49_753 | 227 |
| 551 | 3300036712 | Ga0316584_0061774 | Ga0316584_0061774_263_967 | 227 |
| 552 | 3300037312 | Ga0395899_0000159 | Ga0395899_0000159_24532_25233 | 227 |
| 553 | 3300041463 | Ga0451804_0285986 | Ga0451804_0285986_114_797 | 227 |
| 554 | 3300042002 | Ga0439442_002870 | Ga0439442_002870_1468_2154 | 227 |
| 555 | 3300042004 | Ga0439445_0002485 | Ga0439445_0002485_613_1299 | 227 |
| 556 | 3300042014 | Ga0439457_019823 | Ga0439457_019823_284_970 | 227 |
| 557 | 3300042133 | Ga0450896_007498 | Ga0450896_007498_482_1168 | 227 |
| 558 | 3300042134 | Ga0450898_046384 | Ga0450898_046384_128_814 | 227 |
| 559 | 3300042435 | Ga0439434_0019877 | Ga0439434_0019877_29_715 | 227 |
| 560 | 3300045051 | Ga0451576_0201519 | Ga0451576_0201519_758_1462 | 227 |
| 561 | 3300046522 | Ga0495643_0075385 | Ga0495643_0075385_955_1701 | 227 |
| 562 | 3300047320 | Ga0495672_0071109 | Ga0495672_0071109_1135_1821 | 227 |
| 563 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_217520_218272 | 227 |
| 564 | 3300049570 | Ga0501033_0267137 | Ga0501033_0267137_340_1026 | 227 |
| 565 | 3300049571 | Ga0501034_0105806 | Ga0501034_0105806_17_712 | 227 |
| 566 | 3300049573 | Ga0501037_0070596 | Ga0501037_0070596_61_756 | 227 |
| 567 | 3300049574 | Ga0501038_0042362 | Ga0501038_0042362_23_718 | 227 |
| 568 | 3300049575 | Ga0501039_0284788 | Ga0501039_0284788_560_1255 | 227 |
| 569 | 3300049581 | Ga0501047_0521984 | Ga0501047_0521984_95_790 | 227 |
| 570 | 3300049822 | Ga0501035_0559296 | Ga0501035_0559296_87_782 | 227 |
| 571 | 3300049823 | Ga0501044_0150927 | Ga0501044_0150927_161_925 | 227 |
| 572 | 3300049823 | Ga0501044_0350670 | Ga0501044_0350670_398_1093 | 227 |
| 573 | 3300050507 | nmdc:mga05p37_157653_c1 | nmdc:mga05p37_157653_c1_88_783 | 227 |
| 574 | 3300050508 | nmdc:mga09592_212040_c1 | nmdc:mga09592_212040_c1_810_1505 | 227 |
| 575 | 3300050508 | nmdc:mga09592_245322_c1 | nmdc:mga09592_245322_c1_687_1373 | 227 |
| 576 | 3300002739 | JGI25158J39367_1009660 | JGI25158J39367_10096601 | 228 |
| 577 | 3300003322 | rootL2_10275685 | rootL2_102756852 | 228 |
| 578 | 3300003761 | Ga0055535_1005189 | Ga0055535_10051894 | 228 |
| 579 | 3300003762 | Ga0055542_1003200 | Ga0055542_10032003 | 228 |
| 580 | 3300005262 | Ga0065165_1009569 | Ga0065165_10095692 | 228 |
| 581 | 3300005331 | Ga0070670_100794598 | Ga0070670_1007945981 | 228 |
| 582 | 3300005339 | Ga0070660_100137935 | Ga0070660_1001379353 | 228 |
| 583 | 3300005344 | Ga0070661_100262999 | Ga0070661_1002629991 | 228 |
| 584 | 3300005366 | Ga0070659_100251877 | Ga0070659_1002518772 | 228 |
| 585 | 3300005539 | Ga0068853_100042031 | Ga0068853_1000420312 | 228 |
| 586 | 3300005617 | Ga0068859_100001757 | Ga0068859_10000175716 | 228 |
| 587 | 3300005843 | Ga0068860_100006918 | Ga0068860_1000069186 | 228 |
| 588 | 3300005985 | Ga0081539_10026070 | Ga0081539_100260702 | 228 |
| 589 | 3300006844 | Ga0075428_100027076 | Ga0075428_1000270764 | 228 |
| 590 | 3300006880 | Ga0075429_100012284 | Ga0075429_1000122847 | 228 |
| 591 | 3300006931 | Ga0097620_100001757 | Ga0097620_10000175716 | 228 |
| 592 | 3300009101 | Ga0105247_10000982 | Ga0105247_1000098213 | 228 |
| 593 | 3300009545 | Ga0105237_10021908 | Ga0105237_100219083 | 228 |
| 594 | 3300009553 | Ga0105249_10384291 | Ga0105249_103842912 | 228 |
| 595 | 3300013102 | Ga0157371_10024778 | Ga0157371_100247782 | 228 |
| 596 | 3300013105 | Ga0157369_10052831 | Ga0157369_100528313 | 228 |
| 597 | 3300013306 | Ga0163162_10275806 | Ga0163162_102758062 | 228 |
| 598 | 3300013307 | Ga0157372_10024140 | Ga0157372_100241403 | 228 |
| 599 | 3300013307 | Ga0157372_10050299 | Ga0157372_100502992 | 228 |
| 600 | 3300013307 | Ga0157372_10181700 | Ga0157372_101817002 | 228 |
| 601 | 3300013307 | Ga0157372_10475534 | Ga0157372_104755342 | 228 |
| 602 | 3300014326 | Ga0157380_10059590 | Ga0157380_100595902 | 228 |
| 603 | 3300014968 | Ga0157379_10298920 | Ga0157379_102989201 | 228 |
| 604 | 3300015265 | Ga0182005_1000023 | Ga0182005_1000023178 | 228 |
| 605 | 3300025208 | Ga0209436_103713 | Ga0209436_1037132 | 228 |
| 606 | 3300025242 | Ga0209258_100068 | Ga0209258_10006857 | 228 |
| 607 | 3300025254 | Ga0209148_1000259 | Ga0209148_100025956 | 228 |
| 608 | 3300025900 | Ga0207710_10055048 | Ga0207710_100550482 | 228 |
| 609 | 3300025904 | Ga0207647_10001653 | Ga0207647_100016532 | 228 |
| 610 | 3300025914 | Ga0207671_10257547 | Ga0207671_102575471 | 228 |
| 611 | 3300025919 | Ga0207657_10096121 | Ga0207657_100961211 | 228 |
| 612 | 3300025923 | Ga0207681_10028240 | Ga0207681_100282402 | 228 |
| 613 | 3300025932 | Ga0207690_10279726 | Ga0207690_102797261 | 228 |
| 614 | 3300025961 | Ga0207712_10016043 | Ga0207712_100160435 | 228 |
| 615 | 3300025961 | Ga0207712_10221912 | Ga0207712_102219121 | 228 |
| 616 | 3300026142 | Ga0207698_10112823 | Ga0207698_101128231 | 228 |
| 617 | 3300028381 | Ga0268264_10159157 | Ga0268264_101591573 | 228 |
| 618 | 3300031595 | Ga0265313_10019801 | Ga0265313_100198012 | 228 |
| 619 | 3300031616 | Ga0307508_10002190 | Ga0307508_100021904 | 228 |
| 620 | 3300036401 | Ga0373937_0410381 | Ga0373937_0410381_440_1132 | 228 |
| 621 | 3300037471 | Ga0395905_0014932 | Ga0395905_0014932_300_992 | 228 |
| 622 | 3300037471 | Ga0395905_0049455 | Ga0395905_0049455_12_704 | 228 |
| 623 | 3300044712 | Ga0453684_0170870 | Ga0453684_0170870_1761_2474 | 228 |
| 624 | 3300046459 | Ga0495629_0284519 | Ga0495629_0284519_323_1015 | 228 |
| 625 | 3300046472 | Ga0495580_0027404 | Ga0495580_0027404_1896_2588 | 228 |
| 626 | 3300046475 | Ga0495639_0293726 | Ga0495639_0293726_80_772 | 228 |
| 627 | 3300046476 | Ga0495662_0173312 | Ga0495662_0173312_242_934 | 228 |
| 628 | 3300046517 | Ga0495630_0051522 | Ga0495630_0051522_2162_2854 | 228 |
| 629 | 3300046557 | Ga0495622_0202344 | Ga0495622_0202344_28_714 | 228 |
| 630 | 3300046616 | Ga0495668_0013302 | Ga0495668_0013302_391_1104 | 228 |
| 631 | 3300046681 | Ga0495647_0015452 | Ga0495647_0015452_1485_2177 | 228 |
| 632 | 3300046683 | Ga0495658_0029956 | Ga0495658_0029956_1794_2486 | 228 |
| 633 | 3300046689 | Ga0495613_0088924 | Ga0495613_0088924_82_774 | 228 |
| 634 | 3300047319 | Ga0495674_0060425 | Ga0495674_0060425_1692_2384 | 228 |
| 635 | 3300049683 | Ga0501253_083495 | Ga0501253_083495_17_706 | 228 |
| 636 | 3300049742 | Ga0501080_0368783 | Ga0501080_0368783_184_876 | 228 |
| 637 | 3300049776 | Ga0501280_020643 | Ga0501280_020643_158_856 | 228 |
| 638 | 3300050508 | nmdc:mga09592_165054_c1 | nmdc:mga09592_165054_c1_648_1352 | 228 |
| 639 | 3300050509 | nmdc:mga0qj67_166438_c1 | nmdc:mga0qj67_166438_c1_383_1087 | 228 |
| 640 | 3300053088 | Ga0500644_0000268 | Ga0500644_0000268_12768_13454 | 228 |
| 641 | 3300053090 | Ga0500646_0032395 | Ga0500646_0032395_252_938 | 228 |
| 642 | 3300053092 | Ga0500583_0030990 | Ga0500583_0030990_133_819 | 228 |
| 643 | 3300053096 | Ga0500641_0004448 | Ga0500641_0004448_213_905 | 228 |
| 644 | 3300053109 | Ga0500569_000810 | Ga0500569_000810_2477_3163 | 228 |
| 645 | 3300053134 | Ga0500658_0103091 | Ga0500658_0103091_304_990 | 228 |
| 646 | 3300053136 | Ga0500559_0002564 | Ga0500559_0002564_681_1367 | 228 |
| 647 | 3300053142 | Ga0500577_0005210 | Ga0500577_0005210_2260_2946 | 228 |
| 648 | 3300053153 | Ga0500616_0004904 | Ga0500616_0004904_7712_8398 | 228 |
| 649 | 3300053160 | Ga0500633_0001348 | Ga0500633_0001348_918_1604 | 228 |
| 650 | 3300053177 | Ga0500636_0049515 | Ga0500636_0049515_580_1266 | 228 |
| 651 | 3300003322 | rootL2_10099562 | rootL2_100995628 | 229 |
| 652 | 3300003323 | rootH1_10081552 | rootH1_100815523 | 229 |
| 653 | 3300005564 | Ga0070664_100031478 | Ga0070664_1000314783 | 229 |
| 654 | 3300006237 | Ga0097621_100077716 | Ga0097621_1000777162 | 229 |
| 655 | 3300009094 | Ga0111539_10445108 | Ga0111539_104451081 | 229 |
| 656 | 3300010375 | Ga0105239_10044571 | Ga0105239_100445713 | 229 |
| 657 | 3300013102 | Ga0157371_10190462 | Ga0157371_101904622 | 229 |
| 658 | 3300013102 | Ga0157371_10206562 | Ga0157371_102065621 | 229 |
| 659 | 3300013306 | Ga0163162_10393774 | Ga0163162_103937742 | 229 |
| 660 | 3300013307 | Ga0157372_10182766 | Ga0157372_101827662 | 229 |
| 661 | 3300013308 | Ga0157375_10156395 | Ga0157375_101563953 | 229 |
| 662 | 3300014745 | Ga0157377_10053165 | Ga0157377_100531653 | 229 |
| 663 | 3300014969 | Ga0157376_10051047 | Ga0157376_100510472 | 229 |
| 664 | 3300025208 | Ga0209436_101974 | Ga0209436_1019743 | 229 |
| 665 | 3300025284 | Ga0209130_1009964 | Ga0209130_10099642 | 229 |
| 666 | 3300025298 | Ga0209050_1000136 | Ga0209050_1000136116 | 229 |
| 667 | 3300025302 | Ga0207426_1000164 | Ga0207426_100016462 | 229 |
| 668 | 3300025302 | Ga0207426_1000543 | Ga0207426_100054334 | 229 |
| 669 | 3300025304 | Ga0209257_1002016 | Ga0209257_10020165 | 229 |
| 670 | 3300025901 | Ga0207688_10036895 | Ga0207688_100368953 | 229 |
| 671 | 3300025923 | Ga0207681_10269037 | Ga0207681_102690372 | 229 |
| 672 | 3300025942 | Ga0207689_10067862 | Ga0207689_100678623 | 229 |
| 673 | 3300025945 | Ga0207679_10019154 | Ga0207679_100191544 | 229 |
| 674 | 3300026023 | Ga0207677_10024807 | Ga0207677_100248073 | 229 |
| 675 | 3300026075 | Ga0207708_10246608 | Ga0207708_102466083 | 229 |
| 676 | 3300026118 | Ga0207675_100633625 | Ga0207675_1006336252 | 229 |
| 677 | 3300026142 | Ga0207698_10087259 | Ga0207698_100872593 | 229 |
| 678 | 3300032004 | Ga0307414_10104360 | Ga0307414_101043603 | 229 |
| 679 | 3300041997 | Ga0439431_0022991 | Ga0439431_0022991_328_1017 | 229 |
| 680 | 3300044658 | Ga0466972_0086378 | Ga0466972_0086378_74_850 | 229 |
| 681 | 3300047319 | Ga0495674_0122819 | Ga0495674_0122819_698_1396 | 229 |
| 682 | 3300048917 | Ga0496114_0350935 | Ga0496114_0350935_224_922 | 229 |
| 683 | 3300049570 | Ga0501033_0162028 | Ga0501033_0162028_210_899 | 229 |
| 684 | 3300049571 | Ga0501034_0000002 | Ga0501034_0000002_482070_482762 | 229 |
| 685 | 3300050493 | nmdc:mga0k408_269877_c1 | nmdc:mga0k408_269877_c1_19_708 | 229 |
| 686 | 3300050508 | nmdc:mga09592_735425_c1 | nmdc:mga09592_735425_c1_12_710 | 229 |
| 687 | 3300001979 | JGI24740J21852_10013889 | JGI24740J21852_100138892 | 230 |
| 688 | 3300002738 | JGI25154J39366_1000004 | JGI25154J39366_1000004266 | 230 |
| 689 | 3300002741 | JGI25157J39369_1003031 | JGI25157J39369_10030312 | 230 |
| 690 | 3300003354 | JGI25160J50197_1009532 | JGI25160J50197_10095323 | 230 |
| 691 | 3300005262 | Ga0065165_1011900 | Ga0065165_10119003 | 230 |
| 692 | 3300025246 | Ga0209646_1000025 | Ga0209646_100002569 | 230 |
| 693 | 3300025250 | Ga0209026_1000097 | Ga0209026_100009797 | 230 |
| 694 | 3300025258 | Ga0209129_1011201 | Ga0209129_10112012 | 230 |
| 695 | 3300025297 | Ga0209758_1001656 | Ga0209758_10016567 | 230 |
| 696 | 3300025302 | Ga0207426_1000220 | Ga0207426_100022060 | 230 |
| 697 | 3300049581 | Ga0501047_0008255 | Ga0501047_0008255_2931_3725 | 230 |
| 698 | 3300053139 | Ga0500568_0013389 | Ga0500568_0013389_2949_3659 | 230 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2h92-assembly3.cif.gz_C | crystal structure of staphylococcus aureus cytidine monophosphate kinase in complex with cytidine-5'-monophosphate | 0.9412 | 4 | 223 |
| 2feo-assembly1.cif.gz_A | mutant r188m of the cytidine monophosphate kinase from e. coli complexed with dcmp | 0.9362 | 4 | 223 |
| 3r8c-assembly1.cif.gz_A | crystal structure of cytidylate kinase (cmk) from mycobacterium abscessus | 0.9304 | 4 | 223 |
| 3akc-assembly1.cif.gz_A | crystal structure of cmp kinase in complex with cdp and adp from thermus thermophilus hb8 | 0.929 | 2 | 222 |
| 3akd-assembly1.cif.gz_A | crystal structure of cmp kinase in complex with cdp from thermus thermophilus hb8 | 0.9288 | 2 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9412 | 4 | 223 | 3.40.50.300 |
| af_Q2FYF5_1_183_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9354 | 38 | 222 | 3.40.50.300 |
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9287 | 4 | 223 | 3.40.50.300 |
| 4dieB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9236 | 4 | 223 | 3.40.50.300 |
| af_Q2FYF5_1_183_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9111 | 38 | 222 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q7MLT9-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9965 | 2 | 224 |
GO:0005524
GO:0005829 GO:0006220 GO:0015949 GO:0036430 GO:0036431 |
| AF-A0A836SXV6-F1-model_v4 | (d)CMP kinase (EC 2.7.4.25) | 0.986 | 99 | 225 |
GO:0004127
GO:0005524 |
| AF-A0A2E6LH79-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9816 | 1 | 224 |
GO:0005524
GO:0005737 GO:0006220 GO:0036430 GO:0036431 |
| AF-A0A6M1YJ98-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9805 | 4 | 224 |
GO:0003841
GO:0004127 GO:0005524 GO:0005737 GO:0006220 GO:0006654 |
| AF-A0A2E0VWI0-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9794 | 1 | 229 |
GO:0005524
GO:0005829 GO:0006220 GO:0015949 GO:0036430 GO:0036431 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar