F475912

General Info

Members Datasets Scaffolds Average Seq Length
697 399 1392 319

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0079921|Ga0496105_0079921_1338_2489
Length 383
Sequence MKRQISFAEAECAGKKRVTRRQRFLTEMDSVVPWVRLLAALDPYYPKGARGRPPIGLERMLRIYFLQQWYGLSDEGLEDALYDSIAMRAFVGIDLAVENVPDATTLLKFRRLLLKHDLTRRLFDEIGISLCERGLMMKEGTLVDATIIEAPSSTKNAEKQRDPEMHQTKKGNEWHFGMKAHVGVDADSGLVHSVVGTAANESDVSQAHALLHGHEQHAFGDAGYTGVHKREEMQGATVKWHVAIRRGKIKAMREGALKELLIAAERTKAQIRARVEHPFHVIKNLFGHRKLRYKGLAKNTAQLLSLFALANLVLAKKSLLICHGCWRRRKSDTRRRRKVELNTRPCAAGIVTRRAVQAGSEPALDVVDIGIGGRRTLLADQPV

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
109 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
172 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
173 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
176 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
181 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
185 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
186 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
187 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
188 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
195 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
198 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
199 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
205 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
220 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
221 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
222 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
223 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
224 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
225 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
226 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
227 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
228 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
229 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
230 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
231 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
234 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
235 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
236 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
237 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
238 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
239 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
240 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
241 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
242 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
243 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
244 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
245 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
246 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
247 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
248 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
249 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
250 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
251 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
252 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
253 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
257 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
258 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
259 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
260 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
261 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
269 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
270 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
271 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
290 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
291 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
292 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
297 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
298 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
308 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
309 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
310 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
311 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
321 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
322 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
323 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
324 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
325 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
329 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
330 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
349 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
350 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
351 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
352 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
353 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
357 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
358 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
359 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
366 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
367 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
368 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
369 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
370 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
371 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
372 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
373 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
374 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
375 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
376 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
377 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
379 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
380 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
381 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
382 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
383 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
384 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
385 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
386 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
387 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
388 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
389 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
390 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
391 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
392 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
393 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
394 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
395 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
396 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
397 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
398 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
399 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.55
Metatranscriptomes 0.57
Isolates 4.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 1
Rhizoplane 4.59
Rhizosphere 88.52
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0079921 3300048908 Bacteria 2700
2 JGI24741J21665_1015797 3300001915 Bacteria 1241
3 JGI24740J21852_10059074 3300001979 Unclassified 1064
4 JGI24739J22299_10057958 3300001989 Unclassified 1231
5 JGI24739J22299_10058828 3300001989 Bacteria 1219
6 JGI24737J22298_10035922 3300001990 Unclassified 1532
7 JGI24737J22298_10054719 3300001990 Bacteria 1207
8 JGI24743J22301_10021782 3300001991 Bacteria 1226
9 JGI24735J21928_10025433 3300002067 Bacteria 1787
10 JGI24735J21928_10045645 3300002067 Unclassified 1272
11 JGI24738J21930_10025360 3300002075 Unclassified 1217
12 JGI24749J21850_1011296 3300002076 Bacteria 1253
13 rootH2_10159444 3300003320 Bacteria 5974
14 rootH1_10161342 3300003323 Bacteria 3075
15 Ga0055540_1005665 3300003792 Bacteria 5179
16 Ga0065712_10188685 3300005290 Bacteria 1111
17 Ga0070658_10006460 3300005327 Bacteria 9501
18 Ga0070658_10308314 3300005327 Bacteria 1350
19 Ga0070658_10365869 3300005327 Bacteria 1236
20 Ga0070658_10466532 3300005327 Bacteria 1089
21 Ga0070676_10156339 3300005328 Bacteria 1464
22 Ga0070683_100198672 3300005329 Bacteria 1904
23 Ga0070690_100120486 3300005330 Bacteria 1760
24 Ga0070670_100256326 3300005331 Bacteria 1524
25 Ga0070670_100274074 3300005331 Bacteria 1473
26 Ga0070677_10103236 3300005333 Bacteria 1261
27 Ga0070680_100004259 3300005336 Bacteria 10747
28 Ga0070680_100157749 3300005336 Bacteria 1906
29 Ga0070680_100219790 3300005336 Bacteria 1604
30 Ga0070680_100258244 3300005336 Bacteria 1473
31 Ga0070680_100285851 3300005336 Bacteria 1398
32 Ga0070682_100129836 3300005337 Bacteria 1704
33 Ga0070660_100172852 3300005339 Bacteria 1746
34 Ga0070660_100214354 3300005339 Bacteria 1564
35 Ga0070691_10132620 3300005341 Bacteria 1264
36 Ga0070661_100033138 3300005344 Bacteria 3741
37 Ga0070661_100173615 3300005344 Bacteria 1638
38 Ga0070661_100249236 3300005344 Bacteria 1370
39 Ga0070661_100252763 3300005344 Bacteria 1361
40 Ga0070692_10115395 3300005345 Bacteria 1491
41 Ga0070692_10226464 3300005345 Bacteria 1108
42 Ga0070668_100121067 3300005347 Bacteria 2092
43 Ga0070668_100326142 3300005347 Bacteria 1294
44 Ga0070668_100335611 3300005347 Bacteria 1276
45 Ga0070669_100234548 3300005353 Bacteria 1455
46 Ga0070669_100305451 3300005353 Bacteria 1281
47 Ga0070675_100217238 3300005354 Bacteria 1664
48 Ga0070675_100258450 3300005354 Bacteria 1525
49 Ga0070675_100331309 3300005354 Bacteria 1346
50 Ga0070671_100303567 3300005355 Bacteria 1359
51 Ga0070671_100311054 3300005355 Bacteria 1342
52 Ga0070674_100232142 3300005356 Bacteria 1440
53 Ga0070674_100263512 3300005356 Bacteria 1359
54 Ga0070673_100239700 3300005364 Bacteria 1576
55 Ga0070673_100384042 3300005364 Bacteria 1253
56 Ga0070673_100420706 3300005364 Bacteria 1198
57 Ga0070659_100180833 3300005366 Bacteria 1731
58 Ga0070659_100194881 3300005366 Bacteria 1666
59 Ga0070667_100100278 3300005367 Bacteria 2501
60 Ga0070709_10246931 3300005434 Bacteria 1284
61 Ga0070714_100350908 3300005435 Bacteria 1386
62 Ga0070710_10141280 3300005437 Bacteria 1477
63 Ga0070705_100168996 3300005440 Bacteria 1470
64 Ga0070700_100242848 3300005441 Bacteria 1288
65 Ga0070694_100342601 3300005444 Bacteria 1156
66 Ga0070708_100286115 3300005445 Bacteria 1551
67 Ga0070708_100308607 3300005445 Unclassified 1490
68 Ga0070663_100237149 3300005455 Bacteria 1438
69 Ga0070678_100388330 3300005456 Bacteria 1209
70 Ga0070662_100260560 3300005457 Bacteria 1397
71 Ga0070662_100275144 3300005457 Bacteria 1361
72 Ga0070681_10000064 3300005458 Bacteria 77251
73 Ga0070681_10178105 3300005458 Bacteria 2048
74 Ga0070681_10281211 3300005458 Bacteria 1574
75 Ga0070681_10408338 3300005458 Bacteria 1270
76 Ga0068867_100000196 3300005459 Bacteria 39994
77 Ga0068867_100249647 3300005459 Bacteria 1442
78 Ga0070685_10208720 3300005466 Bacteria 1274
79 Ga0070679_100000528 3300005530 Bacteria 32503
80 Ga0070679_100227794 3300005530 Bacteria 1823
81 Ga0070679_100246739 3300005530 Bacteria 1742
82 Ga0070679_100376365 3300005530 Bacteria 1367
83 Ga0070684_100020866 3300005535 Bacteria 5438
84 Ga0070684_100385112 3300005535 Bacteria 1292
85 Ga0068853_100182702 3300005539 Bacteria 1902
86 Ga0068853_100375007 3300005539 Bacteria 1328
87 Ga0070686_100295292 3300005544 Bacteria 1200
88 Ga0070696_100192934 3300005546 Bacteria 1517
89 Ga0070693_100116642 3300005547 Bacteria 1651
90 Ga0070693_100155036 3300005547 Bacteria 1454
91 Ga0068855_100079943 3300005563 Bacteria 3791
92 Ga0068855_100119004 3300005563 Bacteria 3024
93 Ga0068855_100453324 3300005563 Bacteria 1399
94 Ga0068855_100487756 3300005563 Bacteria 1341
95 Ga0070664_100330231 3300005564 Bacteria 1383
96 Ga0068857_100165916 3300005577 Bacteria 2005
97 Ga0068854_100033114 3300005578 Bacteria 3601
98 Ga0068854_100209509 3300005578 Bacteria 1537
99 Ga0068854_100254467 3300005578 Bacteria 1404
100 Ga0068854_100278597 3300005578 Bacteria 1345
101 Ga0068854_100328780 3300005578 Bacteria 1245
102 Ga0068856_100195736 3300005614 Bacteria 2035
103 Ga0068856_100408008 3300005614 Bacteria 1378
104 Ga0070702_100121877 3300005615 Bacteria 1634
105 Ga0068852_100239953 3300005616 Bacteria 1731
106 Ga0068852_100272375 3300005616 Bacteria 1629
107 Ga0068852_100402513 3300005616 Bacteria 1347
108 Ga0068852_100483078 3300005616 Bacteria 1231
109 Ga0068859_100348157 3300005617 Bacteria 1576
110 Ga0068859_100431751 3300005617 Bacteria 1414
111 Ga0068864_100238446 3300005618 Bacteria 1684
112 Ga0068866_10035400 3300005718 Bacteria 2438
113 Ga0068861_100205347 3300005719 Bacteria 1656
114 Ga0068861_100297301 3300005719 Bacteria 1397
115 Ga0068851_10089060 3300005834 Bacteria 1623
116 Ga0068851_10171139 3300005834 Bacteria 1199
117 Ga0068858_100365304 3300005842 Bacteria 1384
118 Ga0068858_100378200 3300005842 Bacteria 1359
119 Ga0068860_100534815 3300005843 Bacteria 1173
120 Ga0081455_10181178 3300005937 Bacteria 1595
121 Ga0081539_10110939 3300005985 Unclassified 1381
122 Ga0075363_100138954 3300006048 Unclassified 1367
123 Ga0097621_100399209 3300006237 Bacteria 1231
124 Ga0068871_100201419 3300006358 Bacteria 1719
125 Ga0068871_100346169 3300006358 Bacteria 1314
126 Ga0068871_100356113 3300006358 Bacteria 1295
127 Ga0075428_100673717 3300006844 Bacteria 1102
128 Ga0097620_100348159 3300006931 Bacteria 1576
129 Ga0097620_100431793 3300006931 Bacteria 1414
130 Ga0099794_10041448 3300007265 Bacteria 2192
131 Ga0099794_10080146 3300007265 Bacteria 1609
132 Ga0099794_10111587 3300007265 Bacteria 1370
133 Ga0099794_10120341 3300007265 Bacteria 1320
134 Ga0105251_10000069 3300009011 Bacteria 98334
135 Ga0105251_10066088 3300009011 Bacteria 1691
136 Ga0105250_10016634 3300009092 Bacteria 2994
137 Ga0105240_10374217 3300009093 Bacteria 1610
138 Ga0105240_10621494 3300009093 Bacteria 1187
139 Ga0111539_10572825 3300009094 Bacteria 1315
140 Ga0114129_10474742 3300009147 Bacteria 1637
141 Ga0105243_10001002 3300009148 Bacteria 26106
142 Ga0105243_10226658 3300009148 Bacteria 1655
143 Ga0105243_10402488 3300009148 Bacteria 1272
144 Ga0105241_10114044 3300009174 Bacteria 2167
145 Ga0105241_10225058 3300009174 Bacteria 1579
146 Ga0105242_10272895 3300009176 Unclassified 1533
147 Ga0105248_10474618 3300009177 Bacteria 1410
148 Ga0105237_10229306 3300009545 Bacteria 1858
149 Ga0105237_10229406 3300009545 Bacteria 1858
150 Ga0105237_10361757 3300009545 Bacteria 1455
151 Ga0105238_10382706 3300009551 Bacteria 1398
152 Ga0105238_10536006 3300009551 Bacteria 1174
153 Ga0105249_10373400 3300009553 Bacteria 1450
154 Ga0105249_10375199 3300009553 Bacteria 1447
155 Ga0105239_10428465 3300010375 Bacteria 1499
156 Ga0105239_10492155 3300010375 Bacteria 1394
157 Ga0105239_10566096 3300010375 Bacteria 1295
158 Ga0105239_10668412 3300010375 Bacteria 1187
159 Ga0105246_10160494 3300011119 Bacteria 1712
160 Ga0105246_10330349 3300011119 Bacteria 1242
161 Ga0157345_1003230 3300012498 Bacteria 1184
162 Ga0157373_10062182 3300013100 Bacteria 2644
163 Ga0157373_10088502 3300013100 Bacteria 2181
164 Ga0157373_10182047 3300013100 Bacteria 1480
165 Ga0157371_10154838 3300013102 Bacteria 1635
166 Ga0157371_10217288 3300013102 Bacteria 1373
167 Ga0157370_10056298 3300013104 Bacteria 3742
168 Ga0157370_10061273 3300013104 Bacteria 3571
169 Ga0157370_10179095 3300013104 Bacteria 1970
170 Ga0157370_10241059 3300013104 Bacteria 1673
171 Ga0157370_10245683 3300013104 Bacteria 1656
172 Ga0157369_10415013 3300013105 Bacteria 1396
173 Ga0157369_10432168 3300013105 Bacteria 1364
174 Ga0157374_10150195 3300013296 Bacteria 2265
175 Ga0157374_10318177 3300013296 Bacteria 1542
176 Ga0163162_10449798 3300013306 Bacteria 1420
177 Ga0163162_10513761 3300013306 Bacteria 1328
178 Ga0157372_10012211 3300013307 Bacteria 9150
179 Ga0157372_10474679 3300013307 Bacteria 1458
180 Ga0157372_10621657 3300013307 Bacteria 1259
181 Ga0157372_10743491 3300013307 Bacteria 1141
182 Ga0157375_10327107 3300013308 Bacteria 1698
183 Ga0157375_10449855 3300013308 Bacteria 1454
184 Ga0157375_10545399 3300013308 Bacteria 1322
185 Ga0163163_10481875 3300014325 Bacteria 1301
186 Ga0157380_10317798 3300014326 Bacteria 1442
187 Ga0182008_10060309 3300014497 Bacteria 1870
188 Ga0182008_10093077 3300014497 Bacteria 1487
189 Ga0157377_10000080 3300014745 Bacteria 74445
190 Ga0157377_10000227 3300014745 Bacteria 29511
191 Ga0157377_10154374 3300014745 Bacteria 1422
192 Ga0157379_10238396 3300014968 Bacteria 1650
193 Ga0157376_10368881 3300014969 Bacteria 1379
194 Ga0182006_1039297 3300015261 Bacteria 1868
195 Ga0182005_1018614 3300015265 Bacteria 1920
196 Ga0163161_10276917 3300017792 Bacteria 1315
197 Ga0213873_10044697 3300021358 Bacteria 1153
198 Ga0213872_10001268 3300021361 Bacteria 16972
199 Ga0213872_10103529 3300021361 Bacteria 1267
200 Ga0213872_10108257 3300021361 Bacteria 1235
201 Ga0213872_10109159 3300021361 Bacteria 1229
202 Ga0209051_1000316 3300025303 Bacteria 73202
203 Ga0209257_1010462 3300025304 Bacteria 4689
204 Ga0207697_10102895 3300025315 Bacteria 1218
205 Ga0207656_10070058 3300025321 Bacteria 1556
206 Ga0207656_10122825 3300025321 Bacteria 1210
207 Ga0207713_1001033 3300025735 Bacteria 24198
208 Ga0207682_10018779 3300025893 Bacteria 2704
209 Ga0207682_10114258 3300025893 Bacteria 1191
210 Ga0207692_10186799 3300025898 Bacteria 1211
211 Ga0207642_10151165 3300025899 Bacteria 1236
212 Ga0207688_10072484 3300025901 Bacteria 1956
213 Ga0207647_10093896 3300025904 Bacteria 1787
214 Ga0207699_10229379 3300025906 Bacteria 1271
215 Ga0207645_10062664 3300025907 Bacteria 2376
216 Ga0207645_10123453 3300025907 Bacteria 1682
217 Ga0207643_10179645 3300025908 Bacteria 1280
218 Ga0207705_10005518 3300025909 Bacteria 9460
219 Ga0207705_10213676 3300025909 Bacteria 1463
220 Ga0207705_10276317 3300025909 Bacteria 1285
221 Ga0207654_10075396 3300025911 Bacteria 2016
222 Ga0207654_10133929 3300025911 Bacteria 1572
223 Ga0207707_10000133 3300025912 Bacteria 77264
224 Ga0207707_10287786 3300025912 Bacteria 1422
225 Ga0207707_10338701 3300025912 Bacteria 1297
226 Ga0207707_10363843 3300025912 Bacteria 1245
227 Ga0207707_10506928 3300025912 Bacteria 1029
228 Ga0207695_10073292 3300025913 Bacteria 3490
229 Ga0207695_10314297 3300025913 Bacteria 1456
230 Ga0207695_10362355 3300025913 Bacteria 1336
231 Ga0207695_10388412 3300025913 Bacteria 1281
232 Ga0207671_10193611 3300025914 Bacteria 1586
233 Ga0207671_10324957 3300025914 Bacteria 1218
234 Ga0207663_10318975 3300025916 Bacteria 1167
235 Ga0207660_10312071 3300025917 Bacteria 1254
236 Ga0207662_10154272 3300025918 Bacteria 1463
237 Ga0207657_10114723 3300025919 Bacteria 2221
238 Ga0207657_10214199 3300025919 Bacteria 1545
239 Ga0207657_10240835 3300025919 Bacteria 1444
240 Ga0207657_10371035 3300025919 Bacteria 1128
241 Ga0207649_10259958 3300025920 Bacteria 1254
242 Ga0207649_10284132 3300025920 Bacteria 1204
243 Ga0207649_10404450 3300025920 Bacteria 1022
244 Ga0207652_10000701 3300025921 Bacteria 32451
245 Ga0207652_10284709 3300025921 Bacteria 1491
246 Ga0207652_10345948 3300025921 Bacteria 1342
247 Ga0207681_10208271 3300025923 Bacteria 1505
248 Ga0207681_10262938 3300025923 Bacteria 1351
249 Ga0207681_10296333 3300025923 Bacteria 1278
250 Ga0207681_10386514 3300025923 Bacteria 1127
251 Ga0207694_10288922 3300025924 Bacteria 1348
252 Ga0207650_10239943 3300025925 Bacteria 1465
253 Ga0207650_10321282 3300025925 Bacteria 1268
254 Ga0207659_10306163 3300025926 Bacteria 1307
255 Ga0207659_10346152 3300025926 Bacteria 1232
256 Ga0207659_10380936 3300025926 Bacteria 1176
257 Ga0207664_10408592 3300025929 Bacteria 1208
258 Ga0207644_10210642 3300025931 Bacteria 1536
259 Ga0207644_10270166 3300025931 Bacteria 1362
260 Ga0207644_10310209 3300025931 Bacteria 1273
261 Ga0207690_10155201 3300025932 Bacteria 1701
262 Ga0207690_10197026 3300025932 Bacteria 1527
263 Ga0207690_10262841 3300025932 Bacteria 1338
264 Ga0207690_10307524 3300025932 Bacteria 1242
265 Ga0207706_10084243 3300025933 Bacteria 2795
266 Ga0207706_10214091 3300025933 Bacteria 1688
267 Ga0207706_10239613 3300025933 Bacteria 1586
268 Ga0207709_10003148 3300025935 Bacteria 9917
269 Ga0207669_10264896 3300025937 Bacteria 1287
270 Ga0207669_10269348 3300025937 Bacteria 1278
271 Ga0207669_10300552 3300025937 Bacteria 1219
272 Ga0207704_10340346 3300025938 Bacteria 1164
273 Ga0207704_10423900 3300025938 Bacteria 1055
274 Ga0207691_10093255 3300025940 Bacteria 2696
275 Ga0207691_10407313 3300025940 Bacteria 1160
276 Ga0207689_10252542 3300025942 Bacteria 1458
277 Ga0207661_10318942 3300025944 Bacteria 1396
278 Ga0207661_10346489 3300025944 Bacteria 1339
279 Ga0207679_10005216 3300025945 Bacteria 8145
280 Ga0207679_10136472 3300025945 Bacteria 1976
281 Ga0207679_10296677 3300025945 Bacteria 1391
282 Ga0207667_10019817 3300025949 Bacteria 7497
283 Ga0207667_10503332 3300025949 Bacteria 1228
284 Ga0207667_10504447 3300025949 Bacteria 1227
285 Ga0207667_10589920 3300025949 Bacteria 1121
286 Ga0207651_10347662 3300025960 Bacteria 1247
287 Ga0207651_10355701 3300025960 Bacteria 1234
288 Ga0207712_10216680 3300025961 Bacteria 1528
289 Ga0207668_10206140 3300025972 Bacteria 1569
290 Ga0207668_10225106 3300025972 Bacteria 1509
291 Ga0207668_10326913 3300025972 Bacteria 1274
292 Ga0207640_10319657 3300025981 Bacteria 1235
293 Ga0207640_10326757 3300025981 Bacteria 1223
294 Ga0207658_10375837 3300025986 Bacteria 1243
295 Ga0207677_10173931 3300026023 Bacteria 1687
296 Ga0207703_10391343 3300026035 Bacteria 1288
297 Ga0207639_10325103 3300026041 Bacteria 1367
298 Ga0207639_10341332 3300026041 Bacteria 1335
299 Ga0207678_10211815 3300026067 Bacteria 1658
300 Ga0207708_10158000 3300026075 Bacteria 1789
301 Ga0207702_10042178 3300026078 Bacteria 3827
302 Ga0207702_10465828 3300026078 Bacteria 1228
303 Ga0207648_10000615 3300026089 Bacteria 39967
304 Ga0207648_10350955 3300026089 Bacteria 1330
305 Ga0207676_10335670 3300026095 Bacteria 1392
306 Ga0207674_10315867 3300026116 Bacteria 1511
307 Ga0207675_100261797 3300026118 Bacteria 1676
308 Ga0207683_10301912 3300026121 Bacteria 1465
309 Ga0207683_10385028 3300026121 Bacteria 1289
310 Ga0207698_10255952 3300026142 Bacteria 1605
311 Ga0207698_10367871 3300026142 Bacteria 1364
312 Ga0207698_10441879 3300026142 Bacteria 1253
313 Ga0207698_10460077 3300026142 Bacteria 1230
314 Ga0207698_10478801 3300026142 Bacteria 1207
315 Ga0207698_10554088 3300026142 Bacteria 1127
316 Ga0209588_1064288 3300027671 Bacteria 1186
317 Ga0209971_1035750 3300027682 Bacteria 1195
318 Ga0265354_1005140 3300028016 Bacteria 1338
319 Ga0268265_10410185 3300028380 Bacteria 1255
320 Ga0268264_10528233 3300028381 Bacteria 1154
321 Ga0265337_1045148 3300028556 Bacteria 1254
322 Ga0265326_10036578 3300028558 Bacteria 1395
323 Ga0265334_10003670 3300028573 Bacteria 6944
324 Ga0265334_10025633 3300028573 Bacteria 2385
325 Ga0265334_10027855 3300028573 Bacteria 2274
326 Ga0265334_10050270 3300028573 Bacteria 1601
327 Ga0265334_10064361 3300028573 Bacteria 1377
328 Ga0265318_10048914 3300028577 Bacteria 1591
329 Ga0265323_10059161 3300028653 Bacteria 1336
330 Ga0265322_10046020 3300028654 Bacteria 1240
331 Ga0265336_10028216 3300028666 Bacteria 1754
332 Ga0307515_10289498 3300028794 Bacteria 1335
333 Ga0307515_10301130 3300028794 Bacteria 1288
334 Ga0265338_10029514 3300028800 Bacteria 5433
335 Ga0265338_10044580 3300028800 Bacteria 4092
336 Ga0265338_10138979 3300028800 Bacteria 1905
337 Ga0265324_10037018 3300029957 Bacteria 1696
338 Ga0265770_1009028 3300030878 Bacteria 1431
339 Ga0265765_1006687 3300030879 Bacteria 1232
340 Ga0265760_10061513 3300031090 Bacteria 1142
341 Ga0265330_10083619 3300031235 Bacteria 1373
342 Ga0265328_10024040 3300031239 Bacteria 2305
343 Ga0265328_10072914 3300031239 Bacteria 1262
344 Ga0265328_10085797 3300031239 Bacteria 1162
345 Ga0265325_10088531 3300031241 Bacteria 1529
346 Ga0265329_10052077 3300031242 Bacteria 1302
347 Ga0265340_10073612 3300031247 Bacteria 1616
348 Ga0265339_10093560 3300031249 Bacteria 1572
349 Ga0265339_10118706 3300031249 Bacteria 1361
350 Ga0265339_10139045 3300031249 Bacteria 1237
351 Ga0265339_10145858 3300031249 Bacteria 1200
352 Ga0265331_10002717 3300031250 Bacteria 11781
353 Ga0265331_10050054 3300031250 Bacteria 2004
354 Ga0265331_10117389 3300031250 Bacteria 1217
355 Ga0265327_10000120 3300031251 Bacteria 171108
356 Ga0265327_10084342 3300031251 Bacteria 1561
357 Ga0265327_10102055 3300031251 Bacteria 1382
358 Ga0265327_10104647 3300031251 Bacteria 1360
359 Ga0265327_10124628 3300031251 Bacteria 1217
360 Ga0265316_10096221 3300031344 Bacteria 2254
361 Ga0265316_10149456 3300031344 Bacteria 1750
362 Ga0265316_10177839 3300031344 Bacteria 1585
363 Ga0265316_10227466 3300031344 Bacteria 1374
364 Ga0265316_10235050 3300031344 Bacteria 1348
365 Ga0307513_10090894 3300031456 Bacteria 3112
366 Ga0307513_10335894 3300031456 Bacteria 1263
367 Ga0316575_10115987 3300031665 Bacteria 1094
368 Ga0316579_10094831 3300031691 Bacteria 1426
369 Ga0316579_10132262 3300031691 Bacteria 1202
370 Ga0265314_10219017 3300031711 Bacteria 1112
371 Ga0265342_10139442 3300031712 Bacteria 1353
372 Ga0265342_10155853 3300031712 Bacteria 1265
373 Ga0316576_10017938 3300031727 Bacteria 4822
374 Ga0316576_10060470 3300031727 Bacteria 2775
375 Ga0316576_10086900 3300031727 Bacteria 2326
376 Ga0316576_10121894 3300031727 Bacteria 1958
377 Ga0316576_10214484 3300031727 Bacteria 1448
378 Ga0316576_10292836 3300031727 Bacteria 1217
379 Ga0316578_10089582 3300031728 Bacteria 1836
380 Ga0316578_10103744 3300031728 Bacteria 1705
381 Ga0316578_10186848 3300031728 Bacteria 1248
382 Ga0307405_10244217 3300031731 Bacteria 1332
383 Ga0316577_10155030 3300031733 Bacteria 1291
384 Ga0307413_10099258 3300031824 Bacteria 1919
385 Ga0307414_10303037 3300032004 Bacteria 1352
386 Ga0316580_10049397 3300032139 Bacteria 1296
387 Ga0316580_10055301 3300032139 Bacteria 1220
388 Ga0316212_1012309 3300033547 Bacteria 1218
389 Ga0373944_0086160 3300035089 Bacteria 1044
390 Ga0316574_0127823 3300035398 Bacteria 1634
391 Ga0316574_0129344 3300035398 Bacteria 1624
392 Ga0316574_0179452 3300035398 Bacteria 1362
393 Ga0373937_0265237 3300036401 Bacteria 1620
394 Ga0316582_0255895 3300036647 Bacteria 1200
395 Ga0316584_0027785 3300036712 Bacteria 4166
396 Ga0316584_0077956 3300036712 Bacteria 2481
397 Ga0316584_0214354 3300036712 Bacteria 1416
398 Ga0316584_0242837 3300036712 Bacteria 1317
399 Ga0395899_0008036 3300037312 Bacteria 8121
400 Ga0395899_0053179 3300037312 Bacteria 2999
401 Ga0395899_0164774 3300037312 Bacteria 1564
402 Ga0395899_0223714 3300037312 Bacteria 1302
403 Ga0395899_0243569 3300037312 Bacteria 1236
404 Ga0395900_0115728 3300037418 Bacteria 2751
405 Ga0395900_0330076 3300037418 Bacteria 1503
406 Ga0395900_0343506 3300037418 Bacteria 1468
407 Ga0395900_0372509 3300037418 Bacteria 1397
408 Ga0395900_0396795 3300037418 Bacteria 1344
409 Ga0395900_0418269 3300037418 Bacteria 1301
410 Ga0395900_0507001 3300037418 Bacteria 1156
411 Ga0395898_0019446 3300037466 Bacteria 6911
412 Ga0395898_0430425 3300037466 Bacteria 1257
413 Ga0395905_0155970 3300037471 Bacteria 2147
414 Ga0395905_0196373 3300037471 Bacteria 1892
415 Ga0395905_0277396 3300037471 Bacteria 1562
416 Ga0395905_0279578 3300037471 Bacteria 1555
417 Ga0395905_0387667 3300037471 Bacteria 1291
418 Ga0395905_0426647 3300037471 Bacteria 1222
419 Ga0436364_0995520 3300037853 Bacteria 1512
420 Ga0395901_0000501 3300038443 Bacteria 45370
421 Ga0395901_0001487 3300038443 Bacteria 24384
422 Ga0395901_0006410 3300038443 Bacteria 11924
423 Ga0395901_0089377 3300038443 Bacteria 3223
424 Ga0395901_0408349 3300038443 Bacteria 1394
425 Ga0395901_0436695 3300038443 Bacteria 1340
426 Ga0436360_0557693 3300039438 Bacteria 1404
427 Ga0436361_0197250 3300039447 Bacteria 6534
428 Ga0436361_0273719 3300039447 Bacteria 1208
429 Ga0436361_0550915 3300039447 Bacteria 3581
430 Ga0436362_0921283 3300039453 Bacteria 1714
431 Ga0439438_040035 3300041405 Bacteria 1218
432 Ga0439447_026695 3300041407 Bacteria 1478
433 Ga0439466_0036262 3300041411 Bacteria 1665
434 Ga0451789_1241053 3300041443 Bacteria 2609
435 Ga0451793_0775467 3300041452 Bacteria 1501
436 Ga0451797_0453329 3300041453 Bacteria 1161
437 Ga0451795_0326044 3300041456 Bacteria 1381
438 Ga0439448_0026284 3300042005 Bacteria 1829
439 Ga0439432_053565 3300042006 Bacteria 1254
440 Ga0439449_0031855 3300042007 Bacteria 1965
441 Ga0439451_024692 3300042009 Bacteria 1210
442 Ga0439452_003526 3300042010 Bacteria 5462
443 Ga0439455_0055471 3300042012 Bacteria 1042
444 Ga0439456_026055 3300042013 Bacteria 1242
445 Ga0439462_0049031 3300042015 Bacteria 1133
446 Ga0439463_031557 3300042016 Bacteria 1337
447 Ga0450911_001945 3300042115 Bacteria 4328
448 Ga0450888_004915 3300042126 Bacteria 1409
449 Ga0450892_003281 3300042130 Bacteria 1334
450 Ga0450892_003336 3300042130 Bacteria 1321
451 Ga0450902_015497 3300042137 Bacteria 1236
452 Ga0450903_000442 3300042138 Bacteria 8814
453 Ga0450904_003125 3300042139 Bacteria 1833
454 Ga0450906_014834 3300042145 Bacteria 1423
455 Ga0450910_011274 3300042147 Bacteria 1281
456 Ga0450909_010279 3300042185 Bacteria 1366
457 Ga0439435_0035773 3300042436 Bacteria 1370
458 Ga0439435_0073054 3300042436 Bacteria 1018
459 Ga0439444_0009732 3300042437 Bacteria 1520
460 Ga0439464_0004300 3300042439 Bacteria 3640
461 Ga0439460_0054061 3300042461 Bacteria 1210
462 Ga0439460_0102672 3300042461 Bacteria 920
463 Ga0450893_0022604 3300042532 Bacteria 1090
464 Ga0439440_0001959 3300042993 Bacteria 3829
465 Ga0466972_0069256 3300044658 Bacteria 1685
466 Ga0453684_0363187 3300044712 Bacteria 1629
467 Ga0466968_0019462 3300044735 Bacteria 2732
468 Ga0466967_0323932 3300045976 Bacteria 1487
469 Ga0495603_0016956 3300046455 Bacteria 4407
470 Ga0495603_0177970 3300046455 Bacteria 1231
471 Ga0495603_0238958 3300046455 Bacteria 1046
472 Ga0495590_0063277 3300046457 Bacteria 1294
473 Ga0495629_0200100 3300046459 Bacteria 1381
474 Ga0495629_0242584 3300046459 Bacteria 1240
475 Ga0495638_0155458 3300046460 Bacteria 1323
476 Ga0495650_0048077 3300046471 Bacteria 1780
477 Ga0495650_0061089 3300046471 Bacteria 1511
478 Ga0495580_0015443 3300046472 Bacteria 5756
479 Ga0495580_0036240 3300046472 Bacteria 3542
480 Ga0495580_0054657 3300046472 Bacteria 2815
481 Ga0495580_0085941 3300046472 Bacteria 2190
482 Ga0495580_0187029 3300046472 Bacteria 1429
483 Ga0495580_0250967 3300046472 Bacteria 1211
484 Ga0495605_0021736 3300046474 Bacteria 3394
485 Ga0495605_0038009 3300046474 Bacteria 2417
486 Ga0495605_0102494 3300046474 Bacteria 1314
487 Ga0495664_0180368 3300046477 Bacteria 1280
488 Ga0495584_0096442 3300046491 Bacteria 1493
489 Ga0495596_0038274 3300046500 Bacteria 1896
490 Ga0495607_0120883 3300046501 Bacteria 1375
491 Ga0495607_0157030 3300046501 Bacteria 1159
492 Ga0495583_0044538 3300046506 Bacteria 2057
493 Ga0495583_0100333 3300046506 Bacteria 1236
494 Ga0495606_0114514 3300046507 Bacteria 1622
495 Ga0495606_0122428 3300046507 Bacteria 1556
496 Ga0495610_0101609 3300046512 Bacteria 1287
497 Ga0495610_0115382 3300046512 Bacteria 1184
498 Ga0495616_0068487 3300046513 Bacteria 1723
499 Ga0495620_0058889 3300046515 Bacteria 1607
500 Ga0495628_0015630 3300046516 Bacteria 6336
501 Ga0495628_0169962 3300046516 Bacteria 1653
502 Ga0495628_0210571 3300046516 Bacteria 1462
503 Ga0495628_0307804 3300046516 Bacteria 1172
504 Ga0495632_0126023 3300046519 Bacteria 1194
505 Ga0495643_0118373 3300046522 Bacteria 1340
506 Ga0495644_0053189 3300046523 Bacteria 1521
507 Ga0495648_0008705 3300046524 Bacteria 7949
508 Ga0495648_0076066 3300046524 Bacteria 1928
509 Ga0495642_0064925 3300046528 Bacteria 1519
510 Ga0495642_0096084 3300046528 Bacteria 1257
511 Ga0495652_0099369 3300046529 Bacteria 2363
512 Ga0495652_0148266 3300046529 Bacteria 1836
513 Ga0495652_0246097 3300046529 Bacteria 1327
514 Ga0495654_0105606 3300046530 Bacteria 1291
515 Ga0495654_0111441 3300046530 Bacteria 1248
516 Ga0495665_0086038 3300046531 Bacteria 1652
517 Ga0495586_0087836 3300046535 Bacteria 1714
518 Ga0495586_0128316 3300046535 Bacteria 1419
519 Ga0495598_0061029 3300046537 Bacteria 1163
520 Ga0495645_0230916 3300046543 Bacteria 1239
521 Ga0495622_0023505 3300046557 Bacteria 2874
522 Ga0495668_0184393 3300046616 Bacteria 1143
523 Ga0495611_0075781 3300046648 Bacteria 1541
524 Ga0495625_0094318 3300046660 Bacteria 2065
525 Ga0495635_0005129 3300046663 Bacteria 9114
526 Ga0495659_0068732 3300046664 Bacteria 1323
527 Ga0495599_0030636 3300046678 Bacteria 3377
528 Ga0495599_0166097 3300046678 Bacteria 1363
529 Ga0495623_0102679 3300046679 Bacteria 1740
530 Ga0495623_0146881 3300046679 Bacteria 1397
531 Ga0495623_0150750 3300046679 Bacteria 1374
532 Ga0495646_0101393 3300046680 Bacteria 1650
533 Ga0495646_0130898 3300046680 Bacteria 1412
534 Ga0495647_0093919 3300046681 Bacteria 1234
535 Ga0495669_0051015 3300046684 Bacteria 1856
536 Ga0495669_0079712 3300046684 Bacteria 1501
537 Ga0495624_0184234 3300046690 Bacteria 1271
538 Ga0495671_0054839 3300046692 Bacteria 1975
539 Ga0495649_0057117 3300046694 Bacteria 2105
540 Ga0495649_0099306 3300046694 Bacteria 1548
541 Ga0495589_0100927 3300046794 Bacteria 1396
542 Ga0495589_0110528 3300046794 Bacteria 1326
543 Ga0495660_0125895 3300046810 Bacteria 1291
544 Ga0495581_0044825 3300047315 Bacteria 2557
545 Ga0495604_0145947 3300047317 Bacteria 1686
546 Ga0495604_0195550 3300047317 Bacteria 1406
547 Ga0495604_0273433 3300047317 Bacteria 1144
548 Ga0495636_0088990 3300047318 Bacteria 1338
549 Ga0495636_0105605 3300047318 Bacteria 1235
550 Ga0495674_0014890 3300047319 Bacteria 7277
551 Ga0495674_0286433 3300047319 Bacteria 1348
552 Ga0495672_0048813 3300047320 Bacteria 2508
553 Ga0495680_0029406 3300047322 Bacteria 4499
554 Ga0495680_0107813 3300047322 Bacteria 2068
555 Ga0495683_0007274 3300047323 Bacteria 6003
556 Ga0495683_0035351 3300047323 Bacteria 2539
557 Ga0495687_059372 3300047443 Bacteria 1582
558 Ga0495687_084459 3300047443 Bacteria 1234
559 Ga0495675_0024408 3300047444 Bacteria 3854
560 Ga0495675_0092460 3300047444 Bacteria 1898
561 Ga0495677_0034827 3300047445 Bacteria 1837
562 Ga0495679_023999 3300047446 Bacteria 2060
563 Ga0495679_041588 3300047446 Bacteria 1422
564 Ga0495679_042165 3300047446 Bacteria 1409
565 Ga0495685_029043 3300047447 Bacteria 1902
566 Ga0495685_057730 3300047447 Bacteria 1310
567 Ga0495673_0042638 3300047469 Bacteria 2035
568 Ga0495673_0050148 3300047469 Bacteria 1833
569 Ga0495684_0235016 3300047471 Bacteria 1339
570 Ga0495686_0000415 3300047472 Bacteria 67643
571 Ga0495593_0070622 3300047673 Bacteria 1814
572 Ga0495602_0001272 3300048088 Bacteria 24854
573 Ga0495602_0030910 3300048088 Bacteria 5070
574 Ga0495626_0079363 3300048091 Bacteria 1460
575 Ga0496101_0244027 3300048904 Bacteria 1398
576 Ga0496101_0268514 3300048904 Bacteria 1331
577 Ga0496101_0285690 3300048904 Bacteria 1290
578 Ga0496102_0133427 3300048905 Bacteria 2326
579 Ga0496102_0390237 3300048905 Bacteria 1309
580 Ga0496104_0141489 3300048907 Bacteria 2311
581 Ga0496104_0379814 3300048907 Bacteria 1325
582 Ga0496105_0167160 3300048908 Bacteria 1804
583 Ga0496105_0177711 3300048908 Bacteria 1743
584 Ga0496106_0000973 3300048909 Bacteria 20886
585 Ga0496106_0260531 3300048909 Bacteria 1387
586 Ga0496106_0294375 3300048909 Bacteria 1301
587 Ga0496106_0369195 3300048909 Bacteria 1153
588 Ga0496107_0206176 3300048910 Bacteria 1461
589 Ga0496107_0237767 3300048910 Bacteria 1355
590 Ga0496107_0249432 3300048910 Bacteria 1321
591 Ga0496108_0046345 3300048911 Bacteria 3632
592 Ga0496108_0272116 3300048911 Bacteria 1474
593 Ga0496108_0392591 3300048911 Bacteria 1212
594 Ga0496109_0239766 3300048912 Bacteria 1706
595 Ga0496109_0409351 3300048912 Bacteria 1281
596 Ga0496109_0416416 3300048912 Bacteria 1269
597 Ga0496110_0502871 3300048913 Bacteria 1103
598 Ga0496111_0308517 3300048914 Bacteria 1173
599 Ga0496115_0311723 3300048918 Bacteria 1288
600 Ga0496121_0003901 3300048924 Bacteria 20699
601 Ga0496121_0061097 3300048924 Bacteria 3094
602 Ga0495678_033885 3300049459 Bacteria 2105
603 Ga0495678_055878 3300049459 Bacteria 1504
604 Ga0495682_0047510 3300049460 Bacteria 1565
605 Ga0501031_0053407 3300049568 Bacteria 2633
606 Ga0501031_0106131 3300049568 Bacteria 1833
607 Ga0501032_0185326 3300049569 Bacteria 1361
608 Ga0501033_0222354 3300049570 Bacteria 1343
609 Ga0501034_0431869 3300049571 Bacteria 1237
610 Ga0501034_0459419 3300049571 Bacteria 1190
611 Ga0501036_0124229 3300049572 Bacteria 2179
612 Ga0501037_0131894 3300049573 Bacteria 1791
613 Ga0501038_0262885 3300049574 Bacteria 1363
614 Ga0501038_0298569 3300049574 Bacteria 1264
615 Ga0501043_0231108 3300049579 Bacteria 1428
616 Ga0501043_0298083 3300049579 Bacteria 1232
617 Ga0501046_0281196 3300049580 Bacteria 1219
618 Ga0501047_0024720 3300049581 Bacteria 5767
619 Ga0501047_0181942 3300049581 Bacteria 1968
620 Ga0501067_0162043 3300049583 Bacteria 1245
621 Ga0501068_0188585 3300049584 Bacteria 1305
622 Ga0501069_0070455 3300049585 Bacteria 1958
623 Ga0501070_0103090 3300049586 Bacteria 2359
624 Ga0501070_0177305 3300049586 Bacteria 1754
625 Ga0501071_0053423 3300049587 Bacteria 2914
626 Ga0501072_0406333 3300049588 Bacteria 1080
627 Ga0501073_0129030 3300049589 Bacteria 1752
628 Ga0501074_0013894 3300049590 Bacteria 5851
629 Ga0501076_0280680 3300049592 Bacteria 1364
630 Ga0501077_0137496 3300049593 Bacteria 1549
631 Ga0501236_006508 3300049670 Bacteria 1436
632 Ga0501247_006000 3300049677 Bacteria 1366
633 Ga0501248_002016 3300049678 Bacteria 1347
634 Ga0501249_024011 3300049679 Bacteria 1342
635 Ga0501079_0146767 3300049741 Bacteria 1838
636 Ga0501080_0076770 3300049742 Bacteria 3106
637 Ga0501262_000400 3300049759 Bacteria 5254
638 Ga0501268_005708 3300049765 Bacteria 1798
639 Ga0501272_006631 3300049769 Bacteria 1239
640 Ga0501273_006112 3300049770 Bacteria 1383
641 Ga0501035_0289521 3300049822 Bacteria 1382
642 Ga0501035_0367609 3300049822 Bacteria 1201
643 Ga0501044_0243555 3300049823 Bacteria 1741
644 Ga0501044_0417295 3300049823 Bacteria 1252
645 Ga0501044_0564060 3300049823 Bacteria 1034
646 Ga0501045_0272680 3300049824 Bacteria 1259
647 nmdc:mga03n38_74130_c1 3300050490 Unclassified 1582
648 nmdc:mga05p37_607659_c1 3300050507 Bacteria 1233
649 Ga0500643_002927 3300053087 Bacteria 8471
650 Ga0500646_0004116 3300053090 Bacteria 3692
651 Ga0500647_0111516 3300053091 Bacteria 1299
652 Ga0500651_0019454 3300053093 Bacteria 4219
653 Ga0500650_0049487 3300053098 Bacteria 1950
654 Ga0500642_0099361 3300053130 Bacteria 1352
655 Ga0500652_061846 3300053131 Bacteria 1542
656 Ga0500655_031450 3300053133 Bacteria 1023
657 Ga0500579_036376 3300053143 Bacteria 3126
658 Ga0500622_0003022 3300053156 Bacteria 11619
659 Ga0500622_0008196 3300053156 Bacteria 5868
660 Ga0500570_070968 3300053724 Bacteria 1625
661 Ga0501084_0315411 3300054114 Bacteria 1320
662 Ga0587073_0022571 3300059492 Bacteria 1223
663 2512348281 2512047030 Bacteria 9031815
664 2512348918 2512047030 Bacteria 9031815
665 2512349516 2512047030 Bacteria 9031815
666 2512350005 2512047030 Bacteria 9031815
667 2512350863 2512047030 Bacteria 9031815
668 2512352532 2512047030 Bacteria 9031815
669 2513559349 2513237082 Bacteria 8640282
670 2563064465 2562617112 Bacteria 10918404
671 2587736911 2585428058 Bacteria 6853932
672 2599741853 2599185239 Bacteria 8686614
673 2676747731 2675903129 Bacteria 7964495
674 2713472765 2711768613 Bacteria 11048459
675 2753571328 2751185846 Bacteria 7242164
676 2808974431 2808606384 Bacteria 8474373
677 2809009245 2808606390 Bacteria 8476311
678 2809016352 2808606391 Bacteria 8308166
679 2817262534 2816332253 Bacteria 6764532
680 2817262783 2816332253 Bacteria 6764532
681 2817262787 2816332253 Bacteria 6764532
682 2817262942 2816332253 Bacteria 6764532
683 2817263373 2816332253 Bacteria 6764532
684 2817276080 2816332256 Bacteria 6891714
685 2817276158 2816332256 Bacteria 6891714
686 2817277890 2816332256 Bacteria 6891714
687 2817280967 2816332256 Bacteria 6891714
688 2817456679 2816332286 Bacteria 6853759
689 2823376311 2823373977 Bacteria 4779415
690 2858698310 2858688981 Bacteria 8184122
691 2870076802 2870068957 Bacteria 8925310
692 2919544086 2919543075 Bacteria 4728703
693 8018408666 8018405270 Bacteria 4978981
694 8020812640 8020807995 Bacteria 6801506
695 8040173149 8040167225 Bacteria 6542727
696 8040179489 8040173305 Bacteria 6827067
697 Ga0496105_0079921
698 JGI24741J21665_1015797
699 JGI24740J21852_10059074
700 JGI24739J22299_10057958
701 JGI24739J22299_10058828
702 JGI24737J22298_10035922
703 JGI24737J22298_10054719
704 JGI24743J22301_10021782
705 JGI24735J21928_10025433
706 JGI24735J21928_10045645
707 JGI24738J21930_10025360
708 JGI24749J21850_1011296
709 rootH2_10159444
710 rootH1_10161342
711 Ga0055540_1005665
712 Ga0065712_10188685
713 Ga0070658_10006460
714 Ga0070658_10308314
715 Ga0070658_10365869
716 Ga0070658_10466532
717 Ga0070676_10156339
718 Ga0070683_100198672
719 Ga0070690_100120486
720 Ga0070670_100256326
721 Ga0070670_100274074
722 Ga0070677_10103236
723 Ga0070680_100004259
724 Ga0070680_100157749
725 Ga0070680_100219790
726 Ga0070680_100258244
727 Ga0070680_100285851
728 Ga0070682_100129836
729 Ga0070660_100172852
730 Ga0070660_100214354
731 Ga0070691_10132620
732 Ga0070661_100033138
733 Ga0070661_100173615
734 Ga0070661_100249236
735 Ga0070661_100252763
736 Ga0070692_10115395
737 Ga0070692_10226464
738 Ga0070668_100121067
739 Ga0070668_100326142
740 Ga0070668_100335611
741 Ga0070669_100234548
742 Ga0070669_100305451
743 Ga0070675_100217238
744 Ga0070675_100258450
745 Ga0070675_100331309
746 Ga0070671_100303567
747 Ga0070671_100311054
748 Ga0070674_100232142
749 Ga0070674_100263512
750 Ga0070673_100239700
751 Ga0070673_100384042
752 Ga0070673_100420706
753 Ga0070659_100180833
754 Ga0070659_100194881
755 Ga0070667_100100278
756 Ga0070709_10246931
757 Ga0070714_100350908
758 Ga0070710_10141280
759 Ga0070705_100168996
760 Ga0070700_100242848
761 Ga0070694_100342601
762 Ga0070708_100286115
763 Ga0070708_100308607
764 Ga0070663_100237149
765 Ga0070678_100388330
766 Ga0070662_100260560
767 Ga0070662_100275144
768 Ga0070681_10000064
769 Ga0070681_10178105
770 Ga0070681_10281211
771 Ga0070681_10408338
772 Ga0068867_100000196
773 Ga0068867_100249647
774 Ga0070685_10208720
775 Ga0070679_100000528
776 Ga0070679_100227794
777 Ga0070679_100246739
778 Ga0070679_100376365
779 Ga0070684_100020866
780 Ga0070684_100385112
781 Ga0068853_100182702
782 Ga0068853_100375007
783 Ga0070686_100295292
784 Ga0070696_100192934
785 Ga0070693_100116642
786 Ga0070693_100155036
787 Ga0068855_100079943
788 Ga0068855_100119004
789 Ga0068855_100453324
790 Ga0068855_100487756
791 Ga0070664_100330231
792 Ga0068857_100165916
793 Ga0068854_100033114
794 Ga0068854_100209509
795 Ga0068854_100254467
796 Ga0068854_100278597
797 Ga0068854_100328780
798 Ga0068856_100195736
799 Ga0068856_100408008
800 Ga0070702_100121877
801 Ga0068852_100239953
802 Ga0068852_100272375
803 Ga0068852_100402513
804 Ga0068852_100483078
805 Ga0068859_100348157
806 Ga0068859_100431751
807 Ga0068864_100238446
808 Ga0068866_10035400
809 Ga0068861_100205347
810 Ga0068861_100297301
811 Ga0068851_10089060
812 Ga0068851_10171139
813 Ga0068858_100365304
814 Ga0068858_100378200
815 Ga0068860_100534815
816 Ga0081455_10181178
817 Ga0081539_10110939
818 Ga0075363_100138954
819 Ga0097621_100399209
820 Ga0068871_100201419
821 Ga0068871_100346169
822 Ga0068871_100356113
823 Ga0075428_100673717
824 Ga0097620_100348159
825 Ga0097620_100431793
826 Ga0099794_10041448
827 Ga0099794_10080146
828 Ga0099794_10111587
829 Ga0099794_10120341
830 Ga0105251_10000069
831 Ga0105251_10066088
832 Ga0105250_10016634
833 Ga0105240_10374217
834 Ga0105240_10621494
835 Ga0111539_10572825
836 Ga0114129_10474742
837 Ga0105243_10001002
838 Ga0105243_10226658
839 Ga0105243_10402488
840 Ga0105241_10114044
841 Ga0105241_10225058
842 Ga0105242_10272895
843 Ga0105248_10474618
844 Ga0105237_10229306
845 Ga0105237_10229406
846 Ga0105237_10361757
847 Ga0105238_10382706
848 Ga0105238_10536006
849 Ga0105249_10373400
850 Ga0105249_10375199
851 Ga0105239_10428465
852 Ga0105239_10492155
853 Ga0105239_10566096
854 Ga0105239_10668412
855 Ga0105246_10160494
856 Ga0105246_10330349
857 Ga0157345_1003230
858 Ga0157373_10062182
859 Ga0157373_10088502
860 Ga0157373_10182047
861 Ga0157371_10154838
862 Ga0157371_10217288
863 Ga0157370_10056298
864 Ga0157370_10061273
865 Ga0157370_10179095
866 Ga0157370_10241059
867 Ga0157370_10245683
868 Ga0157369_10415013
869 Ga0157369_10432168
870 Ga0157374_10150195
871 Ga0157374_10318177
872 Ga0163162_10449798
873 Ga0163162_10513761
874 Ga0157372_10012211
875 Ga0157372_10474679
876 Ga0157372_10621657
877 Ga0157372_10743491
878 Ga0157375_10327107
879 Ga0157375_10449855
880 Ga0157375_10545399
881 Ga0163163_10481875
882 Ga0157380_10317798
883 Ga0182008_10060309
884 Ga0182008_10093077
885 Ga0157377_10000080
886 Ga0157377_10000227
887 Ga0157377_10154374
888 Ga0157379_10238396
889 Ga0157376_10368881
890 Ga0182006_1039297
891 Ga0182005_1018614
892 Ga0163161_10276917
893 Ga0213873_10044697
894 Ga0213872_10001268
895 Ga0213872_10103529
896 Ga0213872_10108257
897 Ga0213872_10109159
898 Ga0209051_1000316
899 Ga0209257_1010462
900 Ga0207697_10102895
901 Ga0207656_10070058
902 Ga0207656_10122825
903 Ga0207713_1001033
904 Ga0207682_10018779
905 Ga0207682_10114258
906 Ga0207692_10186799
907 Ga0207642_10151165
908 Ga0207688_10072484
909 Ga0207647_10093896
910 Ga0207699_10229379
911 Ga0207645_10062664
912 Ga0207645_10123453
913 Ga0207643_10179645
914 Ga0207705_10005518
915 Ga0207705_10213676
916 Ga0207705_10276317
917 Ga0207654_10075396
918 Ga0207654_10133929
919 Ga0207707_10000133
920 Ga0207707_10287786
921 Ga0207707_10338701
922 Ga0207707_10363843
923 Ga0207707_10506928
924 Ga0207695_10073292
925 Ga0207695_10314297
926 Ga0207695_10362355
927 Ga0207695_10388412
928 Ga0207671_10193611
929 Ga0207671_10324957
930 Ga0207663_10318975
931 Ga0207660_10312071
932 Ga0207662_10154272
933 Ga0207657_10114723
934 Ga0207657_10214199
935 Ga0207657_10240835
936 Ga0207657_10371035
937 Ga0207649_10259958
938 Ga0207649_10284132
939 Ga0207649_10404450
940 Ga0207652_10000701
941 Ga0207652_10284709
942 Ga0207652_10345948
943 Ga0207681_10208271
944 Ga0207681_10262938
945 Ga0207681_10296333
946 Ga0207681_10386514
947 Ga0207694_10288922
948 Ga0207650_10239943
949 Ga0207650_10321282
950 Ga0207659_10306163
951 Ga0207659_10346152
952 Ga0207659_10380936
953 Ga0207664_10408592
954 Ga0207644_10210642
955 Ga0207644_10270166
956 Ga0207644_10310209
957 Ga0207690_10155201
958 Ga0207690_10197026
959 Ga0207690_10262841
960 Ga0207690_10307524
961 Ga0207706_10084243
962 Ga0207706_10214091
963 Ga0207706_10239613
964 Ga0207709_10003148
965 Ga0207669_10264896
966 Ga0207669_10269348
967 Ga0207669_10300552
968 Ga0207704_10340346
969 Ga0207704_10423900
970 Ga0207691_10093255
971 Ga0207691_10407313
972 Ga0207689_10252542
973 Ga0207661_10318942
974 Ga0207661_10346489
975 Ga0207679_10005216
976 Ga0207679_10136472
977 Ga0207679_10296677
978 Ga0207667_10019817
979 Ga0207667_10503332
980 Ga0207667_10504447
981 Ga0207667_10589920
982 Ga0207651_10347662
983 Ga0207651_10355701
984 Ga0207712_10216680
985 Ga0207668_10206140
986 Ga0207668_10225106
987 Ga0207668_10326913
988 Ga0207640_10319657
989 Ga0207640_10326757
990 Ga0207658_10375837
991 Ga0207677_10173931
992 Ga0207703_10391343
993 Ga0207639_10325103
994 Ga0207639_10341332
995 Ga0207678_10211815
996 Ga0207708_10158000
997 Ga0207702_10042178
998 Ga0207702_10465828
999 Ga0207648_10000615
1000 Ga0207648_10350955
1001 Ga0207676_10335670
1002 Ga0207674_10315867
1003 Ga0207675_100261797
1004 Ga0207683_10301912
1005 Ga0207683_10385028
1006 Ga0207698_10255952
1007 Ga0207698_10367871
1008 Ga0207698_10441879
1009 Ga0207698_10460077
1010 Ga0207698_10478801
1011 Ga0207698_10554088
1012 Ga0209588_1064288
1013 Ga0209971_1035750
1014 Ga0265354_1005140
1015 Ga0268265_10410185
1016 Ga0268264_10528233
1017 Ga0265337_1045148
1018 Ga0265326_10036578
1019 Ga0265334_10003670
1020 Ga0265334_10025633
1021 Ga0265334_10027855
1022 Ga0265334_10050270
1023 Ga0265334_10064361
1024 Ga0265318_10048914
1025 Ga0265323_10059161
1026 Ga0265322_10046020
1027 Ga0265336_10028216
1028 Ga0307515_10289498
1029 Ga0307515_10301130
1030 Ga0265338_10029514
1031 Ga0265338_10044580
1032 Ga0265338_10138979
1033 Ga0265324_10037018
1034 Ga0265770_1009028
1035 Ga0265765_1006687
1036 Ga0265760_10061513
1037 Ga0265330_10083619
1038 Ga0265328_10024040
1039 Ga0265328_10072914
1040 Ga0265328_10085797
1041 Ga0265325_10088531
1042 Ga0265329_10052077
1043 Ga0265340_10073612
1044 Ga0265339_10093560
1045 Ga0265339_10118706
1046 Ga0265339_10139045
1047 Ga0265339_10145858
1048 Ga0265331_10002717
1049 Ga0265331_10050054
1050 Ga0265331_10117389
1051 Ga0265327_10000120
1052 Ga0265327_10084342
1053 Ga0265327_10102055
1054 Ga0265327_10104647
1055 Ga0265327_10124628
1056 Ga0265316_10096221
1057 Ga0265316_10149456
1058 Ga0265316_10177839
1059 Ga0265316_10227466
1060 Ga0265316_10235050
1061 Ga0307513_10090894
1062 Ga0307513_10335894
1063 Ga0316575_10115987
1064 Ga0316579_10094831
1065 Ga0316579_10132262
1066 Ga0265314_10219017
1067 Ga0265342_10139442
1068 Ga0265342_10155853
1069 Ga0316576_10017938
1070 Ga0316576_10060470
1071 Ga0316576_10086900
1072 Ga0316576_10121894
1073 Ga0316576_10214484
1074 Ga0316576_10292836
1075 Ga0316578_10089582
1076 Ga0316578_10103744
1077 Ga0316578_10186848
1078 Ga0307405_10244217
1079 Ga0316577_10155030
1080 Ga0307413_10099258
1081 Ga0307414_10303037
1082 Ga0316580_10049397
1083 Ga0316580_10055301
1084 Ga0316212_1012309
1085 Ga0373944_0086160
1086 Ga0316574_0127823
1087 Ga0316574_0129344
1088 Ga0316574_0179452
1089 Ga0373937_0265237
1090 Ga0316582_0255895
1091 Ga0316584_0027785
1092 Ga0316584_0077956
1093 Ga0316584_0214354
1094 Ga0316584_0242837
1095 Ga0395899_0008036
1096 Ga0395899_0053179
1097 Ga0395899_0164774
1098 Ga0395899_0223714
1099 Ga0395899_0243569
1100 Ga0395900_0115728
1101 Ga0395900_0330076
1102 Ga0395900_0343506
1103 Ga0395900_0372509
1104 Ga0395900_0396795
1105 Ga0395900_0418269
1106 Ga0395900_0507001
1107 Ga0395898_0019446
1108 Ga0395898_0430425
1109 Ga0395905_0155970
1110 Ga0395905_0196373
1111 Ga0395905_0277396
1112 Ga0395905_0279578
1113 Ga0395905_0387667
1114 Ga0395905_0426647
1115 Ga0436364_0995520
1116 Ga0395901_0000501
1117 Ga0395901_0001487
1118 Ga0395901_0006410
1119 Ga0395901_0089377
1120 Ga0395901_0408349
1121 Ga0395901_0436695
1122 Ga0436360_0557693
1123 Ga0436361_0197250
1124 Ga0436361_0273719
1125 Ga0436361_0550915
1126 Ga0436362_0921283
1127 Ga0439438_040035
1128 Ga0439447_026695
1129 Ga0439466_0036262
1130 Ga0451789_1241053
1131 Ga0451793_0775467
1132 Ga0451797_0453329
1133 Ga0451795_0326044
1134 Ga0439448_0026284
1135 Ga0439432_053565
1136 Ga0439449_0031855
1137 Ga0439451_024692
1138 Ga0439452_003526
1139 Ga0439455_0055471
1140 Ga0439456_026055
1141 Ga0439462_0049031
1142 Ga0439463_031557
1143 Ga0450911_001945
1144 Ga0450888_004915
1145 Ga0450892_003281
1146 Ga0450892_003336
1147 Ga0450902_015497
1148 Ga0450903_000442
1149 Ga0450904_003125
1150 Ga0450906_014834
1151 Ga0450910_011274
1152 Ga0450909_010279
1153 Ga0439435_0035773
1154 Ga0439435_0073054
1155 Ga0439444_0009732
1156 Ga0439464_0004300
1157 Ga0439460_0054061
1158 Ga0439460_0102672
1159 Ga0450893_0022604
1160 Ga0439440_0001959
1161 Ga0466972_0069256
1162 Ga0453684_0363187
1163 Ga0466968_0019462
1164 Ga0466967_0323932
1165 Ga0495603_0016956
1166 Ga0495603_0177970
1167 Ga0495603_0238958
1168 Ga0495590_0063277
1169 Ga0495629_0200100
1170 Ga0495629_0242584
1171 Ga0495638_0155458
1172 Ga0495650_0048077
1173 Ga0495650_0061089
1174 Ga0495580_0015443
1175 Ga0495580_0036240
1176 Ga0495580_0054657
1177 Ga0495580_0085941
1178 Ga0495580_0187029
1179 Ga0495580_0250967
1180 Ga0495605_0021736
1181 Ga0495605_0038009
1182 Ga0495605_0102494
1183 Ga0495664_0180368
1184 Ga0495584_0096442
1185 Ga0495596_0038274
1186 Ga0495607_0120883
1187 Ga0495607_0157030
1188 Ga0495583_0044538
1189 Ga0495583_0100333
1190 Ga0495606_0114514
1191 Ga0495606_0122428
1192 Ga0495610_0101609
1193 Ga0495610_0115382
1194 Ga0495616_0068487
1195 Ga0495620_0058889
1196 Ga0495628_0015630
1197 Ga0495628_0169962
1198 Ga0495628_0210571
1199 Ga0495628_0307804
1200 Ga0495632_0126023
1201 Ga0495643_0118373
1202 Ga0495644_0053189
1203 Ga0495648_0008705
1204 Ga0495648_0076066
1205 Ga0495642_0064925
1206 Ga0495642_0096084
1207 Ga0495652_0099369
1208 Ga0495652_0148266
1209 Ga0495652_0246097
1210 Ga0495654_0105606
1211 Ga0495654_0111441
1212 Ga0495665_0086038
1213 Ga0495586_0087836
1214 Ga0495586_0128316
1215 Ga0495598_0061029
1216 Ga0495645_0230916
1217 Ga0495622_0023505
1218 Ga0495668_0184393
1219 Ga0495611_0075781
1220 Ga0495625_0094318
1221 Ga0495635_0005129
1222 Ga0495659_0068732
1223 Ga0495599_0030636
1224 Ga0495599_0166097
1225 Ga0495623_0102679
1226 Ga0495623_0146881
1227 Ga0495623_0150750
1228 Ga0495646_0101393
1229 Ga0495646_0130898
1230 Ga0495647_0093919
1231 Ga0495669_0051015
1232 Ga0495669_0079712
1233 Ga0495624_0184234
1234 Ga0495671_0054839
1235 Ga0495649_0057117
1236 Ga0495649_0099306
1237 Ga0495589_0100927
1238 Ga0495589_0110528
1239 Ga0495660_0125895
1240 Ga0495581_0044825
1241 Ga0495604_0145947
1242 Ga0495604_0195550
1243 Ga0495604_0273433
1244 Ga0495636_0088990
1245 Ga0495636_0105605
1246 Ga0495674_0014890
1247 Ga0495674_0286433
1248 Ga0495672_0048813
1249 Ga0495680_0029406
1250 Ga0495680_0107813
1251 Ga0495683_0007274
1252 Ga0495683_0035351
1253 Ga0495687_059372
1254 Ga0495687_084459
1255 Ga0495675_0024408
1256 Ga0495675_0092460
1257 Ga0495677_0034827
1258 Ga0495679_023999
1259 Ga0495679_041588
1260 Ga0495679_042165
1261 Ga0495685_029043
1262 Ga0495685_057730
1263 Ga0495673_0042638
1264 Ga0495673_0050148
1265 Ga0495684_0235016
1266 Ga0495686_0000415
1267 Ga0495593_0070622
1268 Ga0495602_0001272
1269 Ga0495602_0030910
1270 Ga0495626_0079363
1271 Ga0496101_0244027
1272 Ga0496101_0268514
1273 Ga0496101_0285690
1274 Ga0496102_0133427
1275 Ga0496102_0390237
1276 Ga0496104_0141489
1277 Ga0496104_0379814
1278 Ga0496105_0167160
1279 Ga0496105_0177711
1280 Ga0496106_0000973
1281 Ga0496106_0260531
1282 Ga0496106_0294375
1283 Ga0496106_0369195
1284 Ga0496107_0206176
1285 Ga0496107_0237767
1286 Ga0496107_0249432
1287 Ga0496108_0046345
1288 Ga0496108_0272116
1289 Ga0496108_0392591
1290 Ga0496109_0239766
1291 Ga0496109_0409351
1292 Ga0496109_0416416
1293 Ga0496110_0502871
1294 Ga0496111_0308517
1295 Ga0496115_0311723
1296 Ga0496121_0003901
1297 Ga0496121_0061097
1298 Ga0495678_033885
1299 Ga0495678_055878
1300 Ga0495682_0047510
1301 Ga0501031_0053407
1302 Ga0501031_0106131
1303 Ga0501032_0185326
1304 Ga0501033_0222354
1305 Ga0501034_0431869
1306 Ga0501034_0459419
1307 Ga0501036_0124229
1308 Ga0501037_0131894
1309 Ga0501038_0262885
1310 Ga0501038_0298569
1311 Ga0501043_0231108
1312 Ga0501043_0298083
1313 Ga0501046_0281196
1314 Ga0501047_0024720
1315 Ga0501047_0181942
1316 Ga0501067_0162043
1317 Ga0501068_0188585
1318 Ga0501069_0070455
1319 Ga0501070_0103090
1320 Ga0501070_0177305
1321 Ga0501071_0053423
1322 Ga0501072_0406333
1323 Ga0501073_0129030
1324 Ga0501074_0013894
1325 Ga0501076_0280680
1326 Ga0501077_0137496
1327 Ga0501236_006508
1328 Ga0501247_006000
1329 Ga0501248_002016
1330 Ga0501249_024011
1331 Ga0501079_0146767
1332 Ga0501080_0076770
1333 Ga0501262_000400
1334 Ga0501268_005708
1335 Ga0501272_006631
1336 Ga0501273_006112
1337 Ga0501035_0289521
1338 Ga0501035_0367609
1339 Ga0501044_0243555
1340 Ga0501044_0417295
1341 Ga0501044_0564060
1342 Ga0501045_0272680
1343 nmdc:mga03n38_74130_c1
1344 nmdc:mga05p37_607659_c1
1345 Ga0500643_002927
1346 Ga0500646_0004116
1347 Ga0500647_0111516
1348 Ga0500651_0019454
1349 Ga0500650_0049487
1350 Ga0500642_0099361
1351 Ga0500652_061846
1352 Ga0500655_031450
1353 Ga0500579_036376
1354 Ga0500622_0003022
1355 Ga0500622_0008196
1356 Ga0500570_070968
1357 Ga0501084_0315411
1358 Ga0587073_0022571
1359 2512348281
1360 2512348918
1361 2512349516
1362 2512350005
1363 2512350863
1364 2512352532
1365 2513559349
1366 2563064465
1367 2587736911
1368 2599741853
1369 2676747731
1370 2713472765
1371 2753571328
1372 2808974431
1373 2809009245
1374 2809016352
1375 2817262534
1376 2817262783
1377 2817262787
1378 2817262942
1379 2817263373
1380 2817276080
1381 2817276158
1382 2817277890
1383 2817280967
1384 2817456679
1385 2823376311
1386 2858698310
1387 2870076802
1388 2919544086
1389 8018408666
1390 8020812640
1391 8040173149
1392 8040179489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05598

DUF772

Transposase domain (DUF772)

51

126

0.96

PF01609

DDE_Tnp_1

Transposase DDE domain

136

312

0.94

PF13612

DDE_Tnp_1_3

Transposase DDE domain

136

292

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yx6-assembly3.cif.gz_D-3 crystal structure of ph0822 0.3601 158 223
5tre-assembly1.cif.gz_a zinc and the iron donor frataxin regulate oligomerization of the scaffold protein to form new fe-s cluster assembly centers 0.3384 120 178
2yx6-assembly3.cif.gz_D-3 crystal structure of ph0822 0.2567 158 223
4c7o-assembly1.cif.gz_A the structural basis of ftsy recruitment and gtpase activation by srp rna 0.2374 36 236
3rsm-assembly1.cif.gz_A crystal structure of s108c mutant of pmm/pgm 0.2139 61 234
ID Description Score Start End Superfamily
af_P76071_136_312_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8549 130 290 3.30.420.10
af_P76071_136_312_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.7768 130 290 3.30.420.10
af_P76119_7_94_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.63 38 107 3.30.420.10
af_Q54DC1_86_235_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.5772 139 271 3.30.420.10
af_P76119_7_94_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.5203 38 107 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A828R8W2-F1-model_v4 deleted 1.001 31 112
AF-A0A656GJN5-F1-model_v4 Transposase family protein 0.9967 19 124
AF-A0A4V2W2H1-F1-model_v4 Transposase-like protein DUF772 0.9952 31 115
AF-A0A7W3E463-F1-model_v4 deleted 0.9945 27 124
AF-A0A3L5HBZ6-F1-model_v4 Transposase 0.9944 16 124

Map