F475829
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 696 | 248 | 696 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300005618|Ga0068864_100059848|Ga0068864_1000598482 |
| Length | 295 |
| Sequence | LKSGNAKPTDFTDEYCPAMLLLLPYTEYLRRMIEPRNVADIIFVFLLVYAVLKLLRGTRAAPMAAGIGFLVFLYWLSVKQDLATLEFVLSNGLLYIGIAIIVLFQSEIRQALITFGNRFSVPFTRHHGQFGEGVYDEIILAATTLASTKTGALIVIERNVGLKNVTDGGVQLDAELSYDLLVSIFNTASPLHDGAVVVRRHRIAAASCFLPLTLNPRLSRDLGTRHRAAIGVTEDTDAVAVVVSEETGLISFVQRGDIKRGLDATKLRNAIFEALTGEPKRDREQKHSEEEIASI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 163 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 179 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 180 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 181 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 182 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 183 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 184 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 185 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 205 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 206 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 207 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 208 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 209 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 210 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 211 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 214 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 215 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 216 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 217 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 218 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 219 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 220 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 221 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 222 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 223 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 224 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 225 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 226 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 227 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 228 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 229 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 230 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 231 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 232 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 234 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 235 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 236 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 237 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 239 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 248 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 2.01 |
| Rhizosphere | 96.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2012073 | 2162886007 | Bacteria | 1996 |
| 2 | CNBas_1000927 | 3300000531 | Unclassified | 1456 |
| 3 | CNAas_1001534 | 3300000532 | Unclassified | 1914 |
| 4 | LJQas_1000152 | 3300000549 | Bacteria | 12218 |
| 5 | JGI24751J29686_10000057 | 3300002459 | Bacteria | 62893 |
| 6 | JGI24751J29686_10000130 | 3300002459 | Bacteria | 37822 |
| 7 | JGI25406J46586_10004357 | 3300003203 | Bacteria | 6604 |
| 8 | JGI25406J46586_10005331 | 3300003203 | Bacteria | 5965 |
| 9 | JGI25406J46586_10019649 | 3300003203 | Unclassified | 2747 |
| 10 | JGI25406J46586_10039854 | 3300003203 | Unclassified | 1671 |
| 11 | Ga0065714_10002185 | 3300005288 | Bacteria | 199213 |
| 12 | Ga0065704_10011272 | 3300005289 | Bacteria | 2290 |
| 13 | Ga0065704_10085496 | 3300005289 | Unclassified | 3200 |
| 14 | Ga0065712_10000847 | 3300005290 | Bacteria | 10173 |
| 15 | Ga0065712_10067734 | 3300005290 | Bacteria | 110577 |
| 16 | Ga0065712_10098147 | 3300005290 | Bacteria | 2128 |
| 17 | Ga0065715_10015244 | 3300005293 | Bacteria | 1704 |
| 18 | Ga0065715_10090473 | 3300005293 | Bacteria | 6949 |
| 19 | Ga0065715_10096492 | 3300005293 | Bacteria | 3869 |
| 20 | Ga0065715_10112922 | 3300005293 | Bacteria | 2483 |
| 21 | Ga0065715_10113893 | 3300005293 | Bacteria | 2471 |
| 22 | Ga0065715_10134200 | 3300005293 | Bacteria | 1959 |
| 23 | Ga0065707_10001542 | 3300005295 | Bacteria | 9328 |
| 24 | Ga0065707_10002276 | 3300005295 | Unclassified | 4777 |
| 25 | Ga0065707_10012783 | 3300005295 | Bacteria | 2752 |
| 26 | Ga0070690_100008632 | 3300005330 | Bacteria | 5876 |
| 27 | Ga0070690_100082220 | 3300005330 | Bacteria | 2108 |
| 28 | Ga0070690_100242248 | 3300005330 | Unclassified | 1272 |
| 29 | Ga0070670_100001635 | 3300005331 | Bacteria | 18122 |
| 30 | Ga0070670_100003910 | 3300005331 | Bacteria | 12427 |
| 31 | Ga0070670_100041661 | 3300005331 | Bacteria | 3946 |
| 32 | Ga0068869_100015880 | 3300005334 | Bacteria | 5064 |
| 33 | Ga0068869_100054607 | 3300005334 | Bacteria | 2909 |
| 34 | Ga0068869_100065121 | 3300005334 | Bacteria | 2682 |
| 35 | Ga0068869_100136228 | 3300005334 | Bacteria | 1892 |
| 36 | Ga0070666_10162921 | 3300005335 | Unclassified | 1559 |
| 37 | Ga0070682_100000051 | 3300005337 | Bacteria | 123476 |
| 38 | Ga0070682_100137555 | 3300005337 | Bacteria | 1661 |
| 39 | Ga0068868_100366170 | 3300005338 | Bacteria | 1238 |
| 40 | Ga0070660_100013587 | 3300005339 | Bacteria | 5847 |
| 41 | Ga0070689_100002248 | 3300005340 | Bacteria | 12540 |
| 42 | Ga0070689_100032635 | 3300005340 | Bacteria | 3962 |
| 43 | Ga0070689_100065268 | 3300005340 | Bacteria | 2834 |
| 44 | Ga0070689_100156334 | 3300005340 | Bacteria | 1841 |
| 45 | Ga0070687_100000435 | 3300005343 | Bacteria | 14150 |
| 46 | Ga0070687_100177392 | 3300005343 | Bacteria | 1273 |
| 47 | Ga0070692_10023236 | 3300005345 | Bacteria | 3036 |
| 48 | Ga0070668_100003879 | 3300005347 | Bacteria | 11042 |
| 49 | Ga0070668_100434318 | 3300005347 | Bacteria | 1126 |
| 50 | Ga0070669_100001639 | 3300005353 | Bacteria | 16214 |
| 51 | Ga0070669_100028263 | 3300005353 | Bacteria | 4039 |
| 52 | Ga0070669_100037609 | 3300005353 | Bacteria | 3511 |
| 53 | Ga0070669_100083393 | 3300005353 | Bacteria | 2383 |
| 54 | Ga0070669_100243791 | 3300005353 | Bacteria | 1429 |
| 55 | Ga0070675_100037129 | 3300005354 | Bacteria | 3967 |
| 56 | Ga0070675_100091621 | 3300005354 | Bacteria | 2547 |
| 57 | Ga0070671_100004416 | 3300005355 | Bacteria | 11119 |
| 58 | Ga0070671_100119617 | 3300005355 | Bacteria | 2216 |
| 59 | Ga0070673_100001519 | 3300005364 | Bacteria | 13657 |
| 60 | Ga0070673_100025218 | 3300005364 | Bacteria | 4372 |
| 61 | Ga0070673_100288641 | 3300005364 | Bacteria | 1441 |
| 62 | Ga0070673_100468022 | 3300005364 | Bacteria | 1136 |
| 63 | Ga0070659_100003892 | 3300005366 | Bacteria | 10636 |
| 64 | Ga0070659_100190044 | 3300005366 | Bacteria | 1687 |
| 65 | Ga0070667_100014860 | 3300005367 | Bacteria | 6432 |
| 66 | Ga0070703_10001808 | 3300005406 | Bacteria | 6321 |
| 67 | Ga0070705_100009694 | 3300005440 | Bacteria | 4796 |
| 68 | Ga0070705_100032271 | 3300005440 | Bacteria | 2908 |
| 69 | Ga0070705_100056941 | 3300005440 | Bacteria | 2304 |
| 70 | Ga0070705_100059187 | 3300005440 | Unclassified | 2267 |
| 71 | Ga0070705_100065004 | 3300005440 | Unclassified | 2182 |
| 72 | Ga0070705_100154454 | 3300005440 | Bacteria | 1526 |
| 73 | Ga0070700_100000160 | 3300005441 | Bacteria | 38863 |
| 74 | Ga0070700_100031802 | 3300005441 | Bacteria | 3166 |
| 75 | Ga0070700_100080305 | 3300005441 | Bacteria | 2104 |
| 76 | Ga0070694_100003363 | 3300005444 | Bacteria | 9581 |
| 77 | Ga0070694_100015044 | 3300005444 | Bacteria | 4850 |
| 78 | Ga0070694_100085553 | 3300005444 | Bacteria | 2202 |
| 79 | Ga0070694_100090748 | 3300005444 | Unclassified | 2143 |
| 80 | Ga0070694_100225091 | 3300005444 | Bacteria | 1409 |
| 81 | Ga0070694_100289189 | 3300005444 | Unclassified | 1252 |
| 82 | Ga0070708_100013632 | 3300005445 | Bacteria | 6664 |
| 83 | Ga0070708_100024781 | 3300005445 | Bacteria | 5123 |
| 84 | Ga0070708_100050401 | 3300005445 | Bacteria | 3686 |
| 85 | Ga0070708_100144676 | 3300005445 | Bacteria | 2207 |
| 86 | Ga0070678_100015951 | 3300005456 | Bacteria | 4788 |
| 87 | Ga0070678_100478441 | 3300005456 | Bacteria | 1095 |
| 88 | Ga0070662_100107868 | 3300005457 | Bacteria | 2117 |
| 89 | Ga0070662_100355101 | 3300005457 | Bacteria | 1202 |
| 90 | Ga0070681_10000997 | 3300005458 | Bacteria | 23962 |
| 91 | Ga0070681_10009358 | 3300005458 | Bacteria | 9640 |
| 92 | Ga0070681_10017184 | 3300005458 | Bacteria | 7233 |
| 93 | Ga0070681_10093220 | 3300005458 | Bacteria | 2960 |
| 94 | Ga0068867_100101667 | 3300005459 | Bacteria | 2196 |
| 95 | Ga0068867_100392918 | 3300005459 | Bacteria | 1168 |
| 96 | Ga0068867_100483280 | 3300005459 | Bacteria | 1062 |
| 97 | Ga0070706_100000500 | 3300005467 | Bacteria | 45929 |
| 98 | Ga0070706_100001130 | 3300005467 | Bacteria | 28845 |
| 99 | Ga0070706_100001730 | 3300005467 | Bacteria | 22614 |
| 100 | Ga0070706_100028182 | 3300005467 | Bacteria | 5169 |
| 101 | Ga0070706_100048895 | 3300005467 | Bacteria | 3903 |
| 102 | Ga0070706_100080148 | 3300005467 | Bacteria | 3023 |
| 103 | Ga0070706_100391253 | 3300005467 | Bacteria | 1294 |
| 104 | Ga0070706_100516577 | 3300005467 | Unclassified | 1111 |
| 105 | Ga0070707_100000313 | 3300005468 | Bacteria | 47522 |
| 106 | Ga0070707_100014326 | 3300005468 | Bacteria | 7434 |
| 107 | Ga0070707_100036706 | 3300005468 | Bacteria | 4677 |
| 108 | Ga0070707_100206991 | 3300005468 | Unclassified | 1912 |
| 109 | Ga0070707_100389247 | 3300005468 | Bacteria | 1354 |
| 110 | Ga0070707_100442466 | 3300005468 | Unclassified | 1260 |
| 111 | Ga0070698_100001364 | 3300005471 | Bacteria | 27181 |
| 112 | Ga0070698_100044321 | 3300005471 | Bacteria | 4556 |
| 113 | Ga0070698_100048160 | 3300005471 | Bacteria | 4356 |
| 114 | Ga0070698_100054231 | 3300005471 | Bacteria | 4071 |
| 115 | Ga0070698_100063904 | 3300005471 | Bacteria | 3710 |
| 116 | Ga0070698_100088025 | 3300005471 | Bacteria | 3091 |
| 117 | Ga0070698_100104510 | 3300005471 | Bacteria | 2802 |
| 118 | Ga0070698_100303316 | 3300005471 | Bacteria | 1528 |
| 119 | Ga0070698_100411449 | 3300005471 | Bacteria | 1286 |
| 120 | Ga0070699_100013751 | 3300005518 | Bacteria | 6962 |
| 121 | Ga0070699_100041849 | 3300005518 | Bacteria | 3964 |
| 122 | Ga0070699_100060444 | 3300005518 | Unclassified | 3283 |
| 123 | Ga0070699_100140666 | 3300005518 | Bacteria | 2131 |
| 124 | Ga0070699_100353059 | 3300005518 | Bacteria | 1325 |
| 125 | Ga0070699_100558187 | 3300005518 | Unclassified | 1043 |
| 126 | Ga0070679_100000972 | 3300005530 | Bacteria | 24934 |
| 127 | Ga0070679_100007512 | 3300005530 | Bacteria | 10193 |
| 128 | Ga0070697_100000207 | 3300005536 | Bacteria | 48241 |
| 129 | Ga0070697_100000330 | 3300005536 | Bacteria | 37281 |
| 130 | Ga0070697_100012185 | 3300005536 | Bacteria | 6735 |
| 131 | Ga0070697_100029814 | 3300005536 | Bacteria | 4378 |
| 132 | Ga0070697_100036543 | 3300005536 | Bacteria | 3968 |
| 133 | Ga0070697_100052105 | 3300005536 | Bacteria | 3326 |
| 134 | Ga0070697_100072275 | 3300005536 | Bacteria | 2830 |
| 135 | Ga0070697_100081828 | 3300005536 | Bacteria | 2661 |
| 136 | Ga0070697_100241064 | 3300005536 | Bacteria | 1544 |
| 137 | Ga0070697_100528478 | 3300005536 | Bacteria | 1033 |
| 138 | Ga0068853_100044902 | 3300005539 | Bacteria | 3783 |
| 139 | Ga0068853_100047085 | 3300005539 | Bacteria | 3700 |
| 140 | Ga0068853_100284293 | 3300005539 | Bacteria | 1525 |
| 141 | Ga0068853_100308685 | 3300005539 | Bacteria | 1464 |
| 142 | Ga0070672_100004840 | 3300005543 | Bacteria | 8848 |
| 143 | Ga0070686_100001725 | 3300005544 | Bacteria | 12222 |
| 144 | Ga0070686_100008085 | 3300005544 | Bacteria | 5877 |
| 145 | Ga0070686_100171123 | 3300005544 | Bacteria | 1536 |
| 146 | Ga0070695_100015718 | 3300005545 | Bacteria | 4573 |
| 147 | Ga0070695_100023604 | 3300005545 | Bacteria | 3783 |
| 148 | Ga0070695_100030959 | 3300005545 | Bacteria | 3334 |
| 149 | Ga0070695_100111263 | 3300005545 | Bacteria | 1859 |
| 150 | Ga0070695_100139309 | 3300005545 | Bacteria | 1680 |
| 151 | Ga0070695_100362717 | 3300005545 | Unclassified | 1089 |
| 152 | Ga0070696_100018252 | 3300005546 | Bacteria | 4740 |
| 153 | Ga0070696_100031815 | 3300005546 | Bacteria | 3618 |
| 154 | Ga0070696_100122661 | 3300005546 | Unclassified | 1882 |
| 155 | Ga0070696_100126835 | 3300005546 | Bacteria | 1852 |
| 156 | Ga0070696_100187691 | 3300005546 | Bacteria | 1537 |
| 157 | Ga0070696_100346080 | 3300005546 | Unclassified | 1150 |
| 158 | Ga0070693_100010817 | 3300005547 | Bacteria | 4579 |
| 159 | Ga0070693_100150699 | 3300005547 | Unclassified | 1473 |
| 160 | Ga0070693_100157540 | 3300005547 | Bacteria | 1443 |
| 161 | Ga0070693_100209163 | 3300005547 | Bacteria | 1272 |
| 162 | Ga0070665_100061783 | 3300005548 | Bacteria | 3756 |
| 163 | Ga0070704_100015680 | 3300005549 | Bacteria | 4768 |
| 164 | Ga0070704_100028073 | 3300005549 | Bacteria | 3739 |
| 165 | Ga0070704_100031199 | 3300005549 | Bacteria | 3582 |
| 166 | Ga0070704_100098691 | 3300005549 | Unclassified | 2195 |
| 167 | Ga0070704_100172597 | 3300005549 | Bacteria | 1721 |
| 168 | Ga0070704_100267098 | 3300005549 | Unclassified | 1412 |
| 169 | Ga0070664_100048673 | 3300005564 | Bacteria | 3582 |
| 170 | Ga0070664_100081681 | 3300005564 | Unclassified | 2786 |
| 171 | Ga0070664_100120379 | 3300005564 | Bacteria | 2298 |
| 172 | Ga0070664_100221220 | 3300005564 | Unclassified | 1694 |
| 173 | Ga0070664_100377590 | 3300005564 | Bacteria | 1293 |
| 174 | Ga0070664_100480325 | 3300005564 | Unclassified | 1143 |
| 175 | Ga0068857_100005840 | 3300005577 | Bacteria | 10511 |
| 176 | Ga0068854_100022075 | 3300005578 | Bacteria | 4329 |
| 177 | Ga0068854_100124448 | 3300005578 | Unclassified | 1962 |
| 178 | Ga0070702_100004186 | 3300005615 | Bacteria | 6563 |
| 179 | Ga0070702_100018148 | 3300005615 | Bacteria | 3644 |
| 180 | Ga0070702_100033352 | 3300005615 | Bacteria | 2831 |
| 181 | Ga0070702_100034498 | 3300005615 | Bacteria | 2789 |
| 182 | Ga0070702_100059996 | 3300005615 | Unclassified | 2210 |
| 183 | Ga0068852_100078596 | 3300005616 | Bacteria | 2919 |
| 184 | Ga0068852_100210342 | 3300005616 | Bacteria | 1845 |
| 185 | Ga0068852_100262835 | 3300005616 | Bacteria | 1658 |
| 186 | Ga0068859_100046516 | 3300005617 | Bacteria | 4357 |
| 187 | Ga0068859_100054620 | 3300005617 | Bacteria | 4018 |
| 188 | Ga0068859_100056942 | 3300005617 | Bacteria | 3937 |
| 189 | Ga0068859_100131032 | 3300005617 | Bacteria | 2579 |
| 190 | Ga0068859_100141953 | 3300005617 | Bacteria | 2475 |
| 191 | Ga0068859_100250243 | 3300005617 | Bacteria | 1862 |
| 192 | Ga0068859_100374917 | 3300005617 | Bacteria | 1518 |
| 193 | Ga0068864_100047566 | 3300005618 | Bacteria | 3685 |
| 194 | Ga0068864_100052779 | 3300005618 | Bacteria | 3505 |
| 195 | Ga0068864_100059848 | 3300005618 | Bacteria | 3296 |
| 196 | Ga0068864_100236991 | 3300005618 | Unclassified | 1689 |
| 197 | Ga0068864_100269008 | 3300005618 | Bacteria | 1587 |
| 198 | Ga0068864_100294509 | 3300005618 | Bacteria | 1518 |
| 199 | Ga0068866_10001808 | 3300005718 | Bacteria | 8996 |
| 200 | Ga0068866_10007827 | 3300005718 | Bacteria | 4484 |
| 201 | Ga0068861_100015521 | 3300005719 | Bacteria | 5369 |
| 202 | Ga0068861_100021042 | 3300005719 | Bacteria | 4685 |
| 203 | Ga0068861_100052309 | 3300005719 | Bacteria | 3103 |
| 204 | Ga0068861_100376280 | 3300005719 | Bacteria | 1253 |
| 205 | Ga0068851_10001944 | 3300005834 | Bacteria | 9081 |
| 206 | Ga0068870_10025568 | 3300005840 | Bacteria | 2932 |
| 207 | Ga0068870_10026488 | 3300005840 | Bacteria | 2891 |
| 208 | Ga0068863_100006594 | 3300005841 | Bacteria | 11390 |
| 209 | Ga0068863_100038012 | 3300005841 | Bacteria | 4580 |
| 210 | Ga0068863_100062800 | 3300005841 | Bacteria | 3513 |
| 211 | Ga0068863_100207417 | 3300005841 | Unclassified | 1886 |
| 212 | Ga0068863_100254211 | 3300005841 | Bacteria | 1698 |
| 213 | Ga0068858_100068863 | 3300005842 | Bacteria | 3280 |
| 214 | Ga0068858_100109131 | 3300005842 | Bacteria | 2583 |
| 215 | Ga0068858_100128868 | 3300005842 | Bacteria | 2371 |
| 216 | Ga0068860_100021045 | 3300005843 | Bacteria | 6319 |
| 217 | Ga0068860_100031040 | 3300005843 | Bacteria | 5137 |
| 218 | Ga0068860_100071551 | 3300005843 | Bacteria | 3295 |
| 219 | Ga0068860_100093848 | 3300005843 | Bacteria | 2860 |
| 220 | Ga0068860_100108952 | 3300005843 | Bacteria | 2647 |
| 221 | Ga0068860_100136675 | 3300005843 | Bacteria | 2354 |
| 222 | Ga0068860_100495905 | 3300005843 | Bacteria | 1219 |
| 223 | Ga0068862_100004475 | 3300005844 | Bacteria | 11776 |
| 224 | Ga0068862_100078498 | 3300005844 | Bacteria | 2860 |
| 225 | Ga0068862_100195249 | 3300005844 | Bacteria | 1823 |
| 226 | Ga0068862_100494740 | 3300005844 | Bacteria | 1160 |
| 227 | Ga0081539_10000600 | 3300005985 | Bacteria | 73358 |
| 228 | Ga0081539_10001228 | 3300005985 | Bacteria | 45804 |
| 229 | Ga0081539_10001856 | 3300005985 | Bacteria | 33258 |
| 230 | Ga0081539_10004100 | 3300005985 | Bacteria | 16628 |
| 231 | Ga0081539_10038335 | 3300005985 | Bacteria | 2841 |
| 232 | Ga0070715_10000057 | 3300006163 | Bacteria | 40962 |
| 233 | Ga0097621_100003003 | 3300006237 | Bacteria | 11587 |
| 234 | Ga0097621_100019873 | 3300006237 | Bacteria | 5166 |
| 235 | Ga0097621_100028707 | 3300006237 | Bacteria | 4387 |
| 236 | Ga0097621_100039228 | 3300006237 | Bacteria | 3803 |
| 237 | Ga0068871_100022053 | 3300006358 | Bacteria | 4906 |
| 238 | Ga0068871_100053723 | 3300006358 | Bacteria | 3266 |
| 239 | Ga0068871_100175095 | 3300006358 | Bacteria | 1841 |
| 240 | Ga0075428_100132361 | 3300006844 | Bacteria | 2712 |
| 241 | Ga0075428_100715947 | 3300006844 | Bacteria | 1066 |
| 242 | Ga0075430_100078262 | 3300006846 | Bacteria | 2772 |
| 243 | Ga0075431_100023531 | 3300006847 | Bacteria | 6304 |
| 244 | Ga0075431_100039034 | 3300006847 | Bacteria | 4891 |
| 245 | Ga0075431_100080531 | 3300006847 | Bacteria | 3362 |
| 246 | Ga0075433_10039081 | 3300006852 | Bacteria | 4101 |
| 247 | Ga0075433_10061280 | 3300006852 | Unclassified | 3296 |
| 248 | Ga0075433_10080955 | 3300006852 | Bacteria | 2863 |
| 249 | Ga0075433_10135899 | 3300006852 | Bacteria | 2185 |
| 250 | Ga0075433_10178512 | 3300006852 | Bacteria | 1889 |
| 251 | Ga0075433_10216731 | 3300006852 | Unclassified | 1701 |
| 252 | Ga0075433_10424549 | 3300006852 | Bacteria | 1172 |
| 253 | Ga0075434_100083014 | 3300006871 | Bacteria | 3202 |
| 254 | Ga0075434_100147203 | 3300006871 | Bacteria | 2375 |
| 255 | Ga0075434_100153906 | 3300006871 | Bacteria | 2319 |
| 256 | Ga0075434_100207304 | 3300006871 | Bacteria | 1981 |
| 257 | Ga0075434_100224168 | 3300006871 | Bacteria | 1899 |
| 258 | Ga0075429_100018127 | 3300006880 | Bacteria | 6092 |
| 259 | Ga0075429_100046039 | 3300006880 | Bacteria | 3796 |
| 260 | Ga0075429_100069147 | 3300006880 | Unclassified | 3074 |
| 261 | Ga0075429_100440229 | 3300006880 | Bacteria | 1142 |
| 262 | Ga0068865_100022500 | 3300006881 | Bacteria | 4113 |
| 263 | Ga0075436_100080668 | 3300006914 | Bacteria | 2255 |
| 264 | Ga0097620_100046515 | 3300006931 | Bacteria | 4357 |
| 265 | Ga0097620_100054618 | 3300006931 | Bacteria | 4018 |
| 266 | Ga0097620_100056942 | 3300006931 | Bacteria | 3937 |
| 267 | Ga0097620_100131036 | 3300006931 | Bacteria | 2579 |
| 268 | Ga0097620_100141955 | 3300006931 | Bacteria | 2475 |
| 269 | Ga0097620_100250248 | 3300006931 | Bacteria | 1862 |
| 270 | Ga0097620_100374937 | 3300006931 | Bacteria | 1518 |
| 271 | Ga0075435_100000553 | 3300007076 | Bacteria | 22972 |
| 272 | Ga0075435_100023232 | 3300007076 | Bacteria | 4792 |
| 273 | Ga0105240_10490529 | 3300009093 | Unclassified | 1368 |
| 274 | Ga0111539_10005784 | 3300009094 | Bacteria | 15980 |
| 275 | Ga0111539_10017280 | 3300009094 | Bacteria | 8927 |
| 276 | Ga0111539_10067238 | 3300009094 | Bacteria | 4232 |
| 277 | Ga0111539_10891048 | 3300009094 | Unclassified | 1035 |
| 278 | Ga0105245_10124994 | 3300009098 | Unclassified | 2407 |
| 279 | Ga0105245_10405976 | 3300009098 | Bacteria | 1363 |
| 280 | Ga0105247_10025552 | 3300009101 | Bacteria | 3564 |
| 281 | Ga0105247_10409831 | 3300009101 | Bacteria | 968 |
| 282 | Ga0114129_10013019 | 3300009147 | Bacteria | 11848 |
| 283 | Ga0114129_10024304 | 3300009147 | Bacteria | 8585 |
| 284 | Ga0114129_10024802 | 3300009147 | Bacteria | 8501 |
| 285 | Ga0114129_10047028 | 3300009147 | Bacteria | 6064 |
| 286 | Ga0114129_10071520 | 3300009147 | Bacteria | 4837 |
| 287 | Ga0114129_10073823 | 3300009147 | Bacteria | 4752 |
| 288 | Ga0114129_10180967 | 3300009147 | Bacteria | 2868 |
| 289 | Ga0114129_10284968 | 3300009147 | Bacteria | 2206 |
| 290 | Ga0114129_10567058 | 3300009147 | Bacteria | 1475 |
| 291 | Ga0105243_10033416 | 3300009148 | Bacteria | 3978 |
| 292 | Ga0105243_10066674 | 3300009148 | Unclassified | 2895 |
| 293 | Ga0105243_10078790 | 3300009148 | Unclassified | 2684 |
| 294 | Ga0105243_10103682 | 3300009148 | Unclassified | 2366 |
| 295 | Ga0105243_10184181 | 3300009148 | Bacteria | 1818 |
| 296 | Ga0105243_10225729 | 3300009148 | Bacteria | 1658 |
| 297 | Ga0105243_10299556 | 3300009148 | Unclassified | 1457 |
| 298 | Ga0105243_10479679 | 3300009148 | Bacteria | 1173 |
| 299 | Ga0105241_10016414 | 3300009174 | Bacteria | 5431 |
| 300 | Ga0105241_10037956 | 3300009174 | Bacteria | 3632 |
| 301 | Ga0105241_10110305 | 3300009174 | Bacteria | 2201 |
| 302 | Ga0105241_10339647 | 3300009174 | Bacteria | 1301 |
| 303 | Ga0105242_10007397 | 3300009176 | Bacteria | 8456 |
| 304 | Ga0105242_10024809 | 3300009176 | Bacteria | 4738 |
| 305 | Ga0105242_10026829 | 3300009176 | Bacteria | 4568 |
| 306 | Ga0105242_10230479 | 3300009176 | Bacteria | 1660 |
| 307 | Ga0105242_10240253 | 3300009176 | Bacteria | 1628 |
| 308 | Ga0105242_10263285 | 3300009176 | Bacteria | 1559 |
| 309 | Ga0105242_10265527 | 3300009176 | Unclassified | 1552 |
| 310 | Ga0105242_10574028 | 3300009176 | Bacteria | 1085 |
| 311 | Ga0105248_10017920 | 3300009177 | Bacteria | 7814 |
| 312 | Ga0105248_10123035 | 3300009177 | Bacteria | 2927 |
| 313 | Ga0105248_10137132 | 3300009177 | Bacteria | 2760 |
| 314 | Ga0105248_10157796 | 3300009177 | Bacteria | 2560 |
| 315 | Ga0105248_10316002 | 3300009177 | Bacteria | 1759 |
| 316 | Ga0105248_10419163 | 3300009177 | Bacteria | 1508 |
| 317 | Ga0105248_10546137 | 3300009177 | Unclassified | 1307 |
| 318 | Ga0105248_10812894 | 3300009177 | Bacteria | 1055 |
| 319 | Ga0105237_10016717 | 3300009545 | Bacteria | 7617 |
| 320 | Ga0105237_10080002 | 3300009545 | Bacteria | 3258 |
| 321 | Ga0105237_10781423 | 3300009545 | Unclassified | 961 |
| 322 | Ga0105238_10175196 | 3300009551 | Bacteria | 2122 |
| 323 | Ga0105249_10000052 | 3300009553 | Bacteria | 168047 |
| 324 | Ga0105249_10027767 | 3300009553 | Bacteria | 5107 |
| 325 | Ga0105249_10070975 | 3300009553 | Bacteria | 3217 |
| 326 | Ga0105249_10078821 | 3300009553 | Unclassified | 3057 |
| 327 | Ga0105249_10236061 | 3300009553 | Bacteria | 1806 |
| 328 | Ga0105249_10482831 | 3300009553 | Unclassified | 1282 |
| 329 | Ga0105239_10273726 | 3300010375 | Unclassified | 1899 |
| 330 | Ga0105246_10097123 | 3300011119 | Bacteria | 2137 |
| 331 | Ga0105246_10191353 | 3300011119 | Unclassified | 1584 |
| 332 | Ga0157373_10002635 | 3300013100 | Bacteria | 13612 |
| 333 | Ga0157373_10017404 | 3300013100 | Bacteria | 5236 |
| 334 | Ga0157373_10033182 | 3300013100 | Bacteria | 3715 |
| 335 | Ga0157373_10136235 | 3300013100 | Bacteria | 1726 |
| 336 | Ga0157371_10188643 | 3300013102 | Bacteria | 1476 |
| 337 | Ga0157374_10035834 | 3300013296 | Bacteria | 4541 |
| 338 | Ga0157378_10002174 | 3300013297 | Bacteria | 17393 |
| 339 | Ga0157378_10010686 | 3300013297 | Bacteria | 8024 |
| 340 | Ga0157378_10010769 | 3300013297 | Bacteria | 7994 |
| 341 | Ga0157378_10022019 | 3300013297 | Bacteria | 5607 |
| 342 | Ga0157378_10083411 | 3300013297 | Bacteria | 2892 |
| 343 | Ga0157378_10166914 | 3300013297 | Unclassified | 2062 |
| 344 | Ga0157378_10660554 | 3300013297 | Bacteria | 1062 |
| 345 | Ga0163162_10000001 | 3300013306 | Bacteria | 751833 |
| 346 | Ga0163162_10009830 | 3300013306 | Bacteria | 9305 |
| 347 | Ga0163162_10014408 | 3300013306 | Bacteria | 7727 |
| 348 | Ga0163162_10086422 | 3300013306 | Bacteria | 3214 |
| 349 | Ga0163162_10131619 | 3300013306 | Unclassified | 2610 |
| 350 | Ga0163162_10368941 | 3300013306 | Bacteria | 1569 |
| 351 | Ga0163162_10396276 | 3300013306 | Bacteria | 1513 |
| 352 | Ga0163162_11191058 | 3300013306 | Bacteria | 864 |
| 353 | Ga0157372_10009277 | 3300013307 | Bacteria | 10464 |
| 354 | Ga0157372_10063147 | 3300013307 | Bacteria | 4152 |
| 355 | Ga0157372_10447392 | 3300013307 | Unclassified | 1506 |
| 356 | Ga0157375_10052660 | 3300013308 | Bacteria | 4002 |
| 357 | Ga0157375_10081135 | 3300013308 | Bacteria | 3283 |
| 358 | Ga0157375_10116537 | 3300013308 | Bacteria | 2776 |
| 359 | Ga0157375_10496469 | 3300013308 | Bacteria | 1385 |
| 360 | Ga0163163_10025292 | 3300014325 | Bacteria | 5660 |
| 361 | Ga0163163_10025371 | 3300014325 | Bacteria | 5651 |
| 362 | Ga0163163_10041058 | 3300014325 | Bacteria | 4522 |
| 363 | Ga0163163_10072233 | 3300014325 | Bacteria | 3440 |
| 364 | Ga0163163_10185055 | 3300014325 | Bacteria | 2131 |
| 365 | Ga0163163_10192555 | 3300014325 | Bacteria | 2087 |
| 366 | Ga0163163_10243779 | 3300014325 | Bacteria | 1847 |
| 367 | Ga0163163_10971396 | 3300014325 | Bacteria | 913 |
| 368 | Ga0157380_10001297 | 3300014326 | Bacteria | 16250 |
| 369 | Ga0157380_10002482 | 3300014326 | Bacteria | 12434 |
| 370 | Ga0157380_10010906 | 3300014326 | Bacteria | 6553 |
| 371 | Ga0157380_10024015 | 3300014326 | Bacteria | 4608 |
| 372 | Ga0157380_10067960 | 3300014326 | Bacteria | 2871 |
| 373 | Ga0157380_10078016 | 3300014326 | Bacteria | 2701 |
| 374 | Ga0157380_10100088 | 3300014326 | Bacteria | 2412 |
| 375 | Ga0157377_10175391 | 3300014745 | Bacteria | 1344 |
| 376 | Ga0163161_10071194 | 3300017792 | Bacteria | 2544 |
| 377 | Ga0213876_10000011 | 3300021384 | Bacteria | 414473 |
| 378 | Ga0213876_10000205 | 3300021384 | Bacteria | 59996 |
| 379 | Ga0207656_10003633 | 3300025321 | Bacteria | 5327 |
| 380 | Ga0207653_10002464 | 3300025885 | Bacteria | 5882 |
| 381 | Ga0207642_10131643 | 3300025899 | Unclassified | 1306 |
| 382 | Ga0207710_10228377 | 3300025900 | Bacteria | 926 |
| 383 | Ga0207688_10157244 | 3300025901 | Bacteria | 1345 |
| 384 | Ga0207647_10003641 | 3300025904 | Bacteria | 11526 |
| 385 | Ga0207685_10000024 | 3300025905 | Bacteria | 113741 |
| 386 | Ga0207645_10087010 | 3300025907 | Bacteria | 2008 |
| 387 | Ga0207645_10203468 | 3300025907 | Bacteria | 1303 |
| 388 | Ga0207643_10001960 | 3300025908 | Bacteria | 11372 |
| 389 | Ga0207643_10011980 | 3300025908 | Bacteria | 4682 |
| 390 | Ga0207643_10024585 | 3300025908 | Bacteria | 3324 |
| 391 | Ga0207643_10051295 | 3300025908 | Bacteria | 2342 |
| 392 | Ga0207684_10000023 | 3300025910 | Bacteria | 334838 |
| 393 | Ga0207684_10009372 | 3300025910 | Bacteria | 8650 |
| 394 | Ga0207684_10040181 | 3300025910 | Bacteria | 3966 |
| 395 | Ga0207684_10112017 | 3300025910 | Unclassified | 2336 |
| 396 | Ga0207684_10384147 | 3300025910 | Unclassified | 1207 |
| 397 | Ga0207684_10386919 | 3300025910 | Bacteria | 1203 |
| 398 | Ga0207707_10000072 | 3300025912 | Bacteria | 102454 |
| 399 | Ga0207707_10013088 | 3300025912 | Bacteria | 7228 |
| 400 | Ga0207707_10055112 | 3300025912 | Bacteria | 3459 |
| 401 | Ga0207707_10198850 | 3300025912 | Unclassified | 1748 |
| 402 | Ga0207671_10002078 | 3300025914 | Bacteria | 21911 |
| 403 | Ga0207660_10001509 | 3300025917 | Bacteria | 15666 |
| 404 | Ga0207660_10196020 | 3300025917 | Bacteria | 1575 |
| 405 | Ga0207660_10393862 | 3300025917 | Bacteria | 1115 |
| 406 | Ga0207662_10001260 | 3300025918 | Bacteria | 12160 |
| 407 | Ga0207662_10004086 | 3300025918 | Bacteria | 7626 |
| 408 | Ga0207662_10036633 | 3300025918 | Bacteria | 2868 |
| 409 | Ga0207662_10067481 | 3300025918 | Bacteria | 2157 |
| 410 | Ga0207662_10251654 | 3300025918 | Bacteria | 1160 |
| 411 | Ga0207657_10094477 | 3300025919 | Bacteria | 2490 |
| 412 | Ga0207649_10216652 | 3300025920 | Bacteria | 1361 |
| 413 | Ga0207652_10000083 | 3300025921 | Bacteria | 101957 |
| 414 | Ga0207652_10049232 | 3300025921 | Bacteria | 3607 |
| 415 | Ga0207646_10000988 | 3300025922 | Bacteria | 36539 |
| 416 | Ga0207646_10099734 | 3300025922 | Unclassified | 2603 |
| 417 | Ga0207646_10108839 | 3300025922 | Unclassified | 2487 |
| 418 | Ga0207646_10170630 | 3300025922 | Bacteria | 1964 |
| 419 | Ga0207646_10255758 | 3300025922 | Unclassified | 1583 |
| 420 | Ga0207681_10019404 | 3300025923 | Bacteria | 4295 |
| 421 | Ga0207681_10098818 | 3300025923 | Bacteria | 2100 |
| 422 | Ga0207681_10226592 | 3300025923 | Bacteria | 1449 |
| 423 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 424 | Ga0207650_10001812 | 3300025925 | Bacteria | 15115 |
| 425 | Ga0207650_10126577 | 3300025925 | Bacteria | 1995 |
| 426 | Ga0207650_10284894 | 3300025925 | Bacteria | 1346 |
| 427 | Ga0207650_10607979 | 3300025925 | Bacteria | 920 |
| 428 | Ga0207659_10029772 | 3300025926 | Bacteria | 3724 |
| 429 | Ga0207659_10095039 | 3300025926 | Bacteria | 2235 |
| 430 | Ga0207659_10149891 | 3300025926 | Bacteria | 1820 |
| 431 | Ga0207687_10171883 | 3300025927 | Bacteria | 1672 |
| 432 | Ga0207687_10224305 | 3300025927 | Bacteria | 1481 |
| 433 | Ga0207687_10349563 | 3300025927 | Unclassified | 1204 |
| 434 | Ga0207644_10074505 | 3300025931 | Bacteria | 2491 |
| 435 | Ga0207690_10008850 | 3300025932 | Bacteria | 5974 |
| 436 | Ga0207690_10172881 | 3300025932 | Bacteria | 1620 |
| 437 | Ga0207706_10187128 | 3300025933 | Bacteria | 1818 |
| 438 | Ga0207706_10196613 | 3300025933 | Bacteria | 1769 |
| 439 | Ga0207686_10000320 | 3300025934 | Bacteria | 34504 |
| 440 | Ga0207709_10050976 | 3300025935 | Bacteria | 2534 |
| 441 | Ga0207709_10080494 | 3300025935 | Bacteria | 2098 |
| 442 | Ga0207709_10260534 | 3300025935 | Unclassified | 1271 |
| 443 | Ga0207670_10000533 | 3300025936 | Bacteria | 20906 |
| 444 | Ga0207670_10019486 | 3300025936 | Bacteria | 4146 |
| 445 | Ga0207670_10168431 | 3300025936 | Bacteria | 1640 |
| 446 | Ga0207670_10228310 | 3300025936 | Bacteria | 1428 |
| 447 | Ga0207670_10390644 | 3300025936 | Bacteria | 1110 |
| 448 | Ga0207665_10000297 | 3300025939 | Bacteria | 34362 |
| 449 | Ga0207691_10032858 | 3300025940 | Bacteria | 4835 |
| 450 | Ga0207691_10437135 | 3300025940 | Bacteria | 1114 |
| 451 | Ga0207711_10001579 | 3300025941 | Bacteria | 21034 |
| 452 | Ga0207711_10030135 | 3300025941 | Bacteria | 4576 |
| 453 | Ga0207711_10171890 | 3300025941 | Unclassified | 1966 |
| 454 | Ga0207711_10324513 | 3300025941 | Bacteria | 1423 |
| 455 | Ga0207689_10000667 | 3300025942 | Bacteria | 32744 |
| 456 | Ga0207689_10028956 | 3300025942 | Bacteria | 4630 |
| 457 | Ga0207689_10030940 | 3300025942 | Bacteria | 4459 |
| 458 | Ga0207689_10068685 | 3300025942 | Unclassified | 2912 |
| 459 | Ga0207689_10142966 | 3300025942 | Bacteria | 1971 |
| 460 | Ga0207689_10153758 | 3300025942 | Unclassified | 1896 |
| 461 | Ga0207689_10257062 | 3300025942 | Bacteria | 1445 |
| 462 | Ga0207679_10124446 | 3300025945 | Bacteria | 2058 |
| 463 | Ga0207679_10491790 | 3300025945 | Bacteria | 1094 |
| 464 | Ga0207667_10143720 | 3300025949 | Bacteria | 2456 |
| 465 | Ga0207651_10001197 | 3300025960 | Bacteria | 11613 |
| 466 | Ga0207651_10182498 | 3300025960 | Unclassified | 1666 |
| 467 | Ga0207712_10000062 | 3300025961 | Bacteria | 135638 |
| 468 | Ga0207712_10006513 | 3300025961 | Bacteria | 7366 |
| 469 | Ga0207712_10031895 | 3300025961 | Unclassified | 3552 |
| 470 | Ga0207712_10352380 | 3300025961 | Unclassified | 1224 |
| 471 | Ga0207712_10436096 | 3300025961 | Unclassified | 1108 |
| 472 | Ga0207668_10002372 | 3300025972 | Bacteria | 11003 |
| 473 | Ga0207640_10079534 | 3300025981 | Bacteria | 2235 |
| 474 | Ga0207640_10133958 | 3300025981 | Bacteria | 1795 |
| 475 | Ga0207640_10141465 | 3300025981 | Bacteria | 1754 |
| 476 | Ga0207640_10323359 | 3300025981 | Unclassified | 1229 |
| 477 | Ga0207640_10349310 | 3300025981 | Unclassified | 1188 |
| 478 | Ga0207658_10033902 | 3300025986 | Bacteria | 3645 |
| 479 | Ga0207677_10102055 | 3300026023 | Bacteria | 2114 |
| 480 | Ga0207677_10153953 | 3300026023 | Unclassified | 1778 |
| 481 | Ga0207677_10246858 | 3300026023 | Bacteria | 1447 |
| 482 | Ga0207703_10025488 | 3300026035 | Bacteria | 4651 |
| 483 | Ga0207703_10471266 | 3300026035 | Bacteria | 1175 |
| 484 | Ga0207639_10037227 | 3300026041 | Bacteria | 3612 |
| 485 | Ga0207639_10095496 | 3300026041 | Bacteria | 2389 |
| 486 | Ga0207708_10003087 | 3300026075 | Bacteria | 12263 |
| 487 | Ga0207708_10003423 | 3300026075 | Bacteria | 11688 |
| 488 | Ga0207708_10018167 | 3300026075 | Bacteria | 5293 |
| 489 | Ga0207708_10049076 | 3300026075 | Bacteria | 3214 |
| 490 | Ga0207708_10179336 | 3300026075 | Bacteria | 1681 |
| 491 | Ga0207708_10185215 | 3300026075 | Bacteria | 1654 |
| 492 | Ga0207708_10328170 | 3300026075 | Bacteria | 1250 |
| 493 | Ga0207702_10413526 | 3300026078 | Bacteria | 1303 |
| 494 | Ga0207641_10048368 | 3300026088 | Bacteria | 3589 |
| 495 | Ga0207641_10094629 | 3300026088 | Bacteria | 2620 |
| 496 | Ga0207641_10227708 | 3300026088 | Bacteria | 1731 |
| 497 | Ga0207641_10311822 | 3300026088 | Bacteria | 1489 |
| 498 | Ga0207648_10051326 | 3300026089 | Bacteria | 3604 |
| 499 | Ga0207648_10097905 | 3300026089 | Bacteria | 2568 |
| 500 | Ga0207648_10156575 | 3300026089 | Bacteria | 2011 |
| 501 | Ga0207648_10232385 | 3300026089 | Unclassified | 1640 |
| 502 | Ga0207676_10003857 | 3300026095 | Bacteria | 10588 |
| 503 | Ga0207676_10182477 | 3300026095 | Bacteria | 1839 |
| 504 | Ga0207676_10554246 | 3300026095 | Bacteria | 1098 |
| 505 | Ga0207676_10639160 | 3300026095 | Unclassified | 1026 |
| 506 | Ga0207674_10000077 | 3300026116 | Bacteria | 104302 |
| 507 | Ga0207674_10027665 | 3300026116 | Bacteria | 5994 |
| 508 | Ga0207674_10222941 | 3300026116 | Bacteria | 1834 |
| 509 | Ga0207674_10322328 | 3300026116 | Bacteria | 1494 |
| 510 | Ga0207674_10460435 | 3300026116 | Bacteria | 1229 |
| 511 | Ga0207674_10563079 | 3300026116 | Bacteria | 1101 |
| 512 | Ga0207674_10625258 | 3300026116 | Unclassified | 1040 |
| 513 | Ga0207675_100026967 | 3300026118 | Bacteria | 5348 |
| 514 | Ga0207675_100045697 | 3300026118 | Bacteria | 4091 |
| 515 | Ga0207675_100059296 | 3300026118 | Unclassified | 3571 |
| 516 | Ga0207675_100085162 | 3300026118 | Bacteria | 2966 |
| 517 | Ga0207675_100108525 | 3300026118 | Bacteria | 2618 |
| 518 | Ga0207675_100139401 | 3300026118 | Bacteria | 2303 |
| 519 | Ga0207675_100214924 | 3300026118 | Bacteria | 1851 |
| 520 | Ga0207675_100265036 | 3300026118 | Bacteria | 1666 |
| 521 | Ga0207675_100654540 | 3300026118 | Unclassified | 1057 |
| 522 | Ga0207675_100906487 | 3300026118 | Unclassified | 898 |
| 523 | Ga0207683_10029817 | 3300026121 | Bacteria | 4724 |
| 524 | Ga0207683_10050284 | 3300026121 | Bacteria | 3651 |
| 525 | Ga0207683_10455563 | 3300026121 | Bacteria | 1179 |
| 526 | Ga0207698_10056181 | 3300026142 | Bacteria | 3038 |
| 527 | Ga0207698_10401894 | 3300026142 | Bacteria | 1309 |
| 528 | Ga0268266_10083041 | 3300028379 | Bacteria | 2796 |
| 529 | Ga0268265_10013648 | 3300028380 | Bacteria | 5526 |
| 530 | Ga0268265_10031265 | 3300028380 | Bacteria | 3843 |
| 531 | Ga0268265_10293513 | 3300028380 | Bacteria | 1460 |
| 532 | Ga0268265_10363045 | 3300028380 | Bacteria | 1326 |
| 533 | Ga0268265_10447803 | 3300028380 | Bacteria | 1205 |
| 534 | Ga0268265_10471721 | 3300028380 | Unclassified | 1177 |
| 535 | Ga0268265_10548796 | 3300028380 | Bacteria | 1097 |
| 536 | Ga0268264_10045940 | 3300028381 | Bacteria | 3627 |
| 537 | Ga0268264_10094454 | 3300028381 | Bacteria | 2585 |
| 538 | Ga0268264_10153363 | 3300028381 | Bacteria | 2068 |
| 539 | Ga0268264_10153869 | 3300028381 | Bacteria | 2065 |
| 540 | Ga0268264_10157056 | 3300028381 | Bacteria | 2045 |
| 541 | Ga0268264_10414670 | 3300028381 | Bacteria | 1297 |
| 542 | Ga0268264_10442603 | 3300028381 | Bacteria | 1257 |
| 543 | Ga0268264_10443776 | 3300028381 | Bacteria | 1256 |
| 544 | Ga0307513_10015443 | 3300031456 | Bacteria | 9256 |
| 545 | Ga0307513_10070074 | 3300031456 | Bacteria | 3667 |
| 546 | Ga0307513_10407276 | 3300031456 | Unclassified | 1093 |
| 547 | Ga0307408_100042662 | 3300031548 | Bacteria | 3224 |
| 548 | Ga0307408_100049555 | 3300031548 | Bacteria | 3017 |
| 549 | Ga0307408_100301813 | 3300031548 | Bacteria | 1342 |
| 550 | Ga0307405_10010333 | 3300031731 | Bacteria | 4829 |
| 551 | Ga0307405_10050791 | 3300031731 | Bacteria | 2570 |
| 552 | Ga0307405_10163999 | 3300031731 | Bacteria | 1577 |
| 553 | Ga0307405_10220926 | 3300031731 | Bacteria | 1390 |
| 554 | Ga0307410_10108724 | 3300031852 | Bacteria | 2003 |
| 555 | Ga0307410_10359325 | 3300031852 | Bacteria | 1166 |
| 556 | Ga0307406_10017630 | 3300031901 | Bacteria | 4160 |
| 557 | Ga0307406_10036533 | 3300031901 | Unclassified | 3028 |
| 558 | Ga0307406_10099911 | 3300031901 | Bacteria | 1974 |
| 559 | Ga0307409_100084446 | 3300031995 | Bacteria | 2578 |
| 560 | Ga0307409_100364598 | 3300031995 | Bacteria | 1368 |
| 561 | Ga0307416_100014278 | 3300032002 | Bacteria | 5434 |
| 562 | Ga0307416_100150727 | 3300032002 | Bacteria | 2132 |
| 563 | Ga0307416_100271996 | 3300032002 | Bacteria | 1664 |
| 564 | Ga0307416_100553229 | 3300032002 | Unclassified | 1224 |
| 565 | Ga0307414_10078497 | 3300032004 | Bacteria | 2407 |
| 566 | Ga0307411_10418214 | 3300032005 | Bacteria | 1113 |
| 567 | Ga0307411_10513765 | 3300032005 | Bacteria | 1015 |
| 568 | Ga0307415_100022212 | 3300032126 | Bacteria | 3911 |
| 569 | Ga0307415_100037339 | 3300032126 | Bacteria | 3192 |
| 570 | Ga0307415_100140541 | 3300032126 | Bacteria | 1843 |
| 571 | Ga0307415_100432512 | 3300032126 | Unclassified | 1133 |
| 572 | Ga0307415_100573258 | 3300032126 | Bacteria | 1000 |
| 573 | Ga0307415_100610364 | 3300032126 | Bacteria | 972 |
| 574 | Ga0307415_100615930 | 3300032126 | Bacteria | 968 |
| 575 | Ga0373951_0000768 | 3300035091 | Bacteria | 8795 |
| 576 | Ga0373943_0162698 | 3300035170 | Bacteria | 1216 |
| 577 | Ga0373942_0032598 | 3300035207 | Bacteria | 1384 |
| 578 | Ga0373937_0095390 | 3300036401 | Bacteria | 2758 |
| 579 | Ga0373925_0206468 | 3300037068 | Bacteria | 1564 |
| 580 | Ga0395900_0220912 | 3300037418 | Bacteria | 1910 |
| 581 | Ga0395900_0283157 | 3300037418 | Bacteria | 1649 |
| 582 | Ga0395900_0308985 | 3300037418 | Bacteria | 1565 |
| 583 | Ga0395900_0363976 | 3300037418 | Bacteria | 1417 |
| 584 | Ga0395900_0876585 | 3300037418 | Unclassified | 822 |
| 585 | Ga0395898_0039969 | 3300037466 | Bacteria | 4641 |
| 586 | Ga0395898_0552172 | 3300037466 | Bacteria | 1094 |
| 587 | Ga0395905_0009575 | 3300037471 | Bacteria | 9459 |
| 588 | Ga0395905_0144279 | 3300037471 | Bacteria | 2240 |
| 589 | Ga0395901_0142272 | 3300038443 | Bacteria | 2521 |
| 590 | Ga0395901_0145645 | 3300038443 | Bacteria | 2490 |
| 591 | Ga0395901_0467537 | 3300038443 | Unclassified | 1288 |
| 592 | Ga0242420_016540 | 3300038996 | Unclassified | 1285 |
| 593 | Ga0436365_0141476 | 3300039437 | Bacteria | 76344 |
| 594 | Ga0436365_0815906 | 3300039437 | Bacteria | 101407 |
| 595 | Ga0436365_1466764 | 3300039437 | Bacteria | 3202 |
| 596 | Ga0436362_0292211 | 3300039453 | Bacteria | 1384 |
| 597 | Ga0439448_0018857 | 3300042005 | Bacteria | 2119 |
| 598 | Ga0451576_0149798 | 3300045051 | Bacteria | 2433 |
| 599 | Ga0451576_0276417 | 3300045051 | Bacteria | 1756 |
| 600 | Ga0495664_0220945 | 3300046477 | Unclassified | 1147 |
| 601 | Ga0495584_0151544 | 3300046491 | Bacteria | 1178 |
| 602 | Ga0495610_0079371 | 3300046512 | Bacteria | 1511 |
| 603 | Ga0495630_0309091 | 3300046517 | Bacteria | 1208 |
| 604 | Ga0495632_0004878 | 3300046519 | Bacteria | 8997 |
| 605 | Ga0495643_0035171 | 3300046522 | Bacteria | 2760 |
| 606 | Ga0495663_0000941 | 3300046525 | Bacteria | 9701 |
| 607 | Ga0495621_0002052 | 3300046539 | Bacteria | 5328 |
| 608 | Ga0495656_0161408 | 3300046615 | Bacteria | 1090 |
| 609 | Ga0495668_0001666 | 3300046616 | Bacteria | 20671 |
| 610 | Ga0495668_0314221 | 3300046616 | Bacteria | 859 |
| 611 | Ga0495636_0039488 | 3300047318 | Bacteria | 1955 |
| 612 | Ga0495672_0019032 | 3300047320 | Bacteria | 4540 |
| 613 | Ga0495684_0222900 | 3300047471 | Bacteria | 1382 |
| 614 | Ga0496102_0078100 | 3300048905 | Unclassified | 3047 |
| 615 | Ga0496104_0066645 | 3300048907 | Bacteria | 3419 |
| 616 | Ga0496104_0089274 | 3300048907 | Bacteria | 2945 |
| 617 | Ga0496104_0251798 | 3300048907 | Bacteria | 1679 |
| 618 | Ga0496104_0315850 | 3300048907 | Bacteria | 1475 |
| 619 | Ga0496106_0064399 | 3300048909 | Bacteria | 2789 |
| 620 | Ga0496106_0102882 | 3300048909 | Bacteria | 2216 |
| 621 | Ga0496107_0175725 | 3300048910 | Bacteria | 1590 |
| 622 | Ga0496108_0044798 | 3300048911 | Bacteria | 3694 |
| 623 | Ga0496109_0211562 | 3300048912 | Bacteria | 1824 |
| 624 | Ga0496112_0106364 | 3300048915 | Bacteria | 2776 |
| 625 | Ga0496112_0125123 | 3300048915 | Bacteria | 2542 |
| 626 | Ga0496112_0171639 | 3300048915 | Bacteria | 2134 |
| 627 | Ga0496112_0665435 | 3300048915 | Bacteria | 970 |
| 628 | Ga0501291_001835 | 3300049514 | Bacteria | 2485 |
| 629 | Ga0501292_003256 | 3300049515 | Bacteria | 2161 |
| 630 | Ga0501296_002588 | 3300049519 | Bacteria | 1902 |
| 631 | Ga0501298_000628 | 3300049521 | Bacteria | 4858 |
| 632 | Ga0501298_002419 | 3300049521 | Unclassified | 2821 |
| 633 | Ga0501298_008607 | 3300049521 | Bacteria | 1718 |
| 634 | Ga0501299_003286 | 3300049522 | Unclassified | 2329 |
| 635 | Ga0501300_008325 | 3300049523 | Bacteria | 1519 |
| 636 | Ga0501038_0008718 | 3300049574 | Bacteria | 9306 |
| 637 | Ga0501071_0393967 | 3300049587 | Bacteria | 1057 |
| 638 | Ga0501198_001215 | 3300049649 | Bacteria | 3320 |
| 639 | Ga0501202_002092 | 3300049652 | Bacteria | 3313 |
| 640 | Ga0501206_006302 | 3300049653 | Bacteria | 1540 |
| 641 | Ga0501217_001684 | 3300049661 | Bacteria | 4205 |
| 642 | Ga0501217_021751 | 3300049661 | Unclassified | 1516 |
| 643 | Ga0501223_006644 | 3300049663 | Bacteria | 2386 |
| 644 | Ga0501223_019234 | 3300049663 | Bacteria | 1342 |
| 645 | Ga0501223_021985 | 3300049663 | Unclassified | 1247 |
| 646 | Ga0501224_004786 | 3300049664 | Bacteria | 1931 |
| 647 | Ga0501224_008426 | 3300049664 | Bacteria | 1504 |
| 648 | Ga0501227_007444 | 3300049665 | Bacteria | 2344 |
| 649 | Ga0501227_016551 | 3300049665 | Bacteria | 1657 |
| 650 | Ga0501228_004038 | 3300049666 | Bacteria | 1241 |
| 651 | Ga0501230_007792 | 3300049667 | Bacteria | 1600 |
| 652 | Ga0501233_026703 | 3300049668 | Unclassified | 1277 |
| 653 | Ga0501235_021292 | 3300049669 | Bacteria | 1441 |
| 654 | Ga0501235_048975 | 3300049669 | Bacteria | 976 |
| 655 | Ga0501240_019923 | 3300049673 | Bacteria | 1000 |
| 656 | Ga0501247_010392 | 3300049677 | Bacteria | 1109 |
| 657 | Ga0501252_009007 | 3300049682 | Bacteria | 1157 |
| 658 | Ga0501256_000710 | 3300049685 | Bacteria | 2233 |
| 659 | Ga0501257_004859 | 3300049686 | Bacteria | 2943 |
| 660 | Ga0501259_001350 | 3300049688 | Bacteria | 4113 |
| 661 | Ga0501225_0002845 | 3300049705 | Bacteria | 5311 |
| 662 | Ga0501225_0019310 | 3300049705 | Bacteria | 1887 |
| 663 | Ga0501225_0021006 | 3300049705 | Bacteria | 1804 |
| 664 | Ga0501234_000566 | 3300049707 | Bacteria | 5648 |
| 665 | Ga0501079_0159312 | 3300049741 | Bacteria | 1760 |
| 666 | Ga0501263_012675 | 3300049760 | Bacteria | 1060 |
| 667 | Ga0501268_005901 | 3300049765 | Bacteria | 1776 |
| 668 | Ga0501270_009447 | 3300049767 | Unclassified | 1260 |
| 669 | Ga0501273_002268 | 3300049770 | Bacteria | 1943 |
| 670 | Ga0501045_0287810 | 3300049824 | Bacteria | 1223 |
| 671 | Ga0501226_000729 | 3300049853 | Bacteria | 4463 |
| 672 | nmdc:mga05p37_150563_c1 | 3300050507 | Bacteria | 2846 |
| 673 | nmdc:mga05p37_20630_c1 | 3300050507 | Bacteria | 7971 |
| 674 | nmdc:mga05p37_239230_c1 | 3300050507 | Bacteria | 2184 |
| 675 | nmdc:mga05p37_89185_c1 | 3300050507 | Bacteria | 3800 |
| 676 | nmdc:mga09592_459883_c1 | 3300050508 | Bacteria | 1097 |
| 677 | nmdc:mga09592_46916_c1 | 3300050508 | Bacteria | 3640 |
| 678 | nmdc:mga09592_47223_c1 | 3300050508 | Bacteria | 3628 |
| 679 | nmdc:mga09592_68998_c1 | 3300050508 | Bacteria | 2999 |
| 680 | nmdc:mga0qj67_18189_c1 | 3300050509 | Bacteria | 5354 |
| 681 | nmdc:mga0qj67_23281_c1 | 3300050509 | Bacteria | 4763 |
| 682 | nmdc:mga0qj67_371813_c1 | 3300050509 | Unclassified | 1154 |
| 683 | nmdc:mga06r32_327640_c1 | 3300050510 | Unclassified | 1517 |
| 684 | nmdc:mga08y16_117115_c1 | 3300050511 | Bacteria | 2773 |
| 685 | nmdc:mga08y16_46322_c1 | 3300050511 | Bacteria | 4552 |
| 686 | nmdc:mga08y16_61428_c1 | 3300050511 | Bacteria | 3924 |
| 687 | nmdc:mga0rr50_486582_c1 | 3300050513 | Bacteria | 1048 |
| 688 | nmdc:mga08x19_160775_c1 | 3300050514 | Bacteria | 1525 |
| 689 | nmdc:mga08x19_29_c1 | 3300050514 | Bacteria | 214647 |
| 690 | nmdc:mga0a205_13699_c1 | 3300050515 | Bacteria | 7556 |
| 691 | nmdc:mga0a205_26431_c1 | 3300050515 | Bacteria | 5535 |
| 692 | nmdc:mga0a205_44656_c1 | 3300050515 | Bacteria | 3962 |
| 693 | nmdc:mga0a205_80497_c1 | 3300050515 | Bacteria | 3147 |
| 694 | nmdc:mga0a205_91993_c2 | 3300050515 | Bacteria | 2022 |
| 695 | Ga0500577_0000980 | 3300053142 | Bacteria | 7354 |
| 696 | Ga0530510_0014864 | 3300061734 | Bacteria | 5497 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0876585 | Ga0395900_0876585_63_779 | 232 |
| 2 | 3300005546 | Ga0070696_100126835 | Ga0070696_1001268352 | 240 |
| 3 | 3300009147 | Ga0114129_10284968 | Ga0114129_102849682 | 241 |
| 4 | 3300050507 | nmdc:mga05p37_239230_c1 | nmdc:mga05p37_239230_c1_778_1503 | 241 |
| 5 | 3300046491 | Ga0495584_0151544 | Ga0495584_0151544_391_1119 | 242 |
| 6 | 3300046512 | Ga0495610_0079371 | Ga0495610_0079371_126_854 | 242 |
| 7 | 3300046525 | Ga0495663_0000941 | Ga0495663_0000941_8456_9184 | 242 |
| 8 | 3300046616 | Ga0495668_0314221 | Ga0495668_0314221_119_847 | 242 |
| 9 | 3300000549 | LJQas_1000152 | LJQas_10001525 | 243 |
| 10 | 3300009094 | Ga0111539_10005784 | Ga0111539_1000578412 | 246 |
| 11 | 3300009553 | Ga0105249_10236061 | Ga0105249_102360612 | 246 |
| 12 | 3300028380 | Ga0268265_10548796 | Ga0268265_105487962 | 251 |
| 13 | 3300049523 | Ga0501300_008325 | Ga0501300_008325_630_1406 | 252 |
| 14 | 3300005334 | Ga0068869_100136228 | Ga0068869_1001362282 | 253 |
| 15 | 3300005617 | Ga0068859_100131032 | Ga0068859_1001310322 | 253 |
| 16 | 3300005840 | Ga0068870_10026488 | Ga0068870_100264882 | 253 |
| 17 | 3300006931 | Ga0097620_100131036 | Ga0097620_1001310362 | 253 |
| 18 | 3300009174 | Ga0105241_10339647 | Ga0105241_103396471 | 253 |
| 19 | 3300013100 | Ga0157373_10002635 | Ga0157373_100026359 | 253 |
| 20 | 3300013102 | Ga0157371_10188643 | Ga0157371_101886432 | 253 |
| 21 | 3300025908 | Ga0207643_10011980 | Ga0207643_100119803 | 253 |
| 22 | 3300025942 | Ga0207689_10257062 | Ga0207689_102570622 | 253 |
| 23 | 3300026095 | Ga0207676_10182477 | Ga0207676_101824771 | 253 |
| 24 | 3300031548 | Ga0307408_100049555 | Ga0307408_1000495552 | 253 |
| 25 | 3300032002 | Ga0307416_100271996 | Ga0307416_1002719962 | 253 |
| 26 | 3300032005 | Ga0307411_10418214 | Ga0307411_104182141 | 253 |
| 27 | 3300035091 | Ga0373951_0000768 | Ga0373951_0000768_3506_4312 | 254 |
| 28 | 3300005616 | Ga0068852_100262835 | Ga0068852_1002628352 | 255 |
| 29 | 3300005844 | Ga0068862_100195249 | Ga0068862_1001952491 | 255 |
| 30 | 3300006847 | Ga0075431_100080531 | Ga0075431_1000805312 | 255 |
| 31 | 3300006880 | Ga0075429_100069147 | Ga0075429_1000691472 | 255 |
| 32 | 3300026142 | Ga0207698_10401894 | Ga0207698_104018942 | 255 |
| 33 | 3300037418 | Ga0395900_0363976 | Ga0395900_0363976_308_1120 | 255 |
| 34 | 3300037466 | Ga0395898_0039969 | Ga0395898_0039969_2800_3612 | 255 |
| 35 | 3300038443 | Ga0395901_0142272 | Ga0395901_0142272_553_1368 | 255 |
| 36 | 3300038443 | Ga0395901_0145645 | Ga0395901_0145645_1384_2196 | 255 |
| 37 | 3300050508 | nmdc:mga09592_47223_c1 | nmdc:mga09592_47223_c1_302_1108 | 255 |
| 38 | 3300050509 | nmdc:mga0qj67_371813_c1 | nmdc:mga0qj67_371813_c1_205_1011 | 255 |
| 39 | 3300005293 | Ga0065715_10113893 | Ga0065715_101138932 | 256 |
| 40 | 3300009147 | Ga0114129_10024802 | Ga0114129_100248023 | 256 |
| 41 | 3300025925 | Ga0207650_10607979 | Ga0207650_106079791 | 256 |
| 42 | 3300050507 | nmdc:mga05p37_20630_c1 | nmdc:mga05p37_20630_c1_6217_7026 | 256 |
| 43 | 3300050515 | nmdc:mga0a205_91993_c2 | nmdc:mga0a205_91993_c2_553_1362 | 256 |
| 44 | 3300005564 | Ga0070664_100480325 | Ga0070664_1004803251 | 257 |
| 45 | 3300005843 | Ga0068860_100093848 | Ga0068860_1000938483 | 257 |
| 46 | 3300006358 | Ga0068871_100053723 | Ga0068871_1000537233 | 257 |
| 47 | 3300006846 | Ga0075430_100078262 | Ga0075430_1000782622 | 257 |
| 48 | 3300006847 | Ga0075431_100039034 | Ga0075431_1000390344 | 257 |
| 49 | 3300009148 | Ga0105243_10184181 | Ga0105243_101841812 | 257 |
| 50 | 3300009174 | Ga0105241_10037956 | Ga0105241_100379562 | 257 |
| 51 | 3300009176 | Ga0105242_10574028 | Ga0105242_105740282 | 257 |
| 52 | 3300013308 | Ga0157375_10496469 | Ga0157375_104964692 | 257 |
| 53 | 3300014325 | Ga0163163_10971396 | Ga0163163_109713961 | 257 |
| 54 | 3300026116 | Ga0207674_10222941 | Ga0207674_102229412 | 257 |
| 55 | 3300026116 | Ga0207674_10563079 | Ga0207674_105630791 | 257 |
| 56 | 3300046522 | Ga0495643_0035171 | Ga0495643_0035171_1265_2071 | 257 |
| 57 | 3300050509 | nmdc:mga0qj67_23281_c1 | nmdc:mga0qj67_23281_c1_652_1458 | 257 |
| 58 | 3300050510 | nmdc:mga06r32_327640_c1 | nmdc:mga06r32_327640_c1_624_1430 | 257 |
| 59 | 3300032126 | Ga0307415_100573258 | Ga0307415_1005732581 | 258 |
| 60 | 3300046477 | Ga0495664_0220945 | Ga0495664_0220945_32_814 | 258 |
| 61 | 3300049653 | Ga0501206_006302 | Ga0501206_006302_590_1396 | 258 |
| 62 | 3300049663 | Ga0501223_006644 | Ga0501223_006644_1321_2127 | 258 |
| 63 | 3300049664 | Ga0501224_004786 | Ga0501224_004786_408_1214 | 258 |
| 64 | 3300049665 | Ga0501227_016551 | Ga0501227_016551_432_1238 | 258 |
| 65 | 3300049669 | Ga0501235_048975 | Ga0501235_048975_105_911 | 258 |
| 66 | 3300049760 | Ga0501263_012675 | Ga0501263_012675_13_819 | 258 |
| 67 | 3300049770 | Ga0501273_002268 | Ga0501273_002268_978_1784 | 258 |
| 68 | 3300005295 | Ga0065707_10001542 | Ga0065707_100015423 | 259 |
| 69 | 3300005564 | Ga0070664_100377590 | Ga0070664_1003775902 | 260 |
| 70 | 3300035207 | Ga0373942_0032598 | Ga0373942_0032598_388_1191 | 261 |
| 71 | 3300005536 | Ga0070697_100081828 | Ga0070697_1000818283 | 262 |
| 72 | 3300025910 | Ga0207684_10000023 | Ga0207684_10000023253 | 263 |
| 73 | 3300005343 | Ga0070687_100177392 | Ga0070687_1001773921 | 264 |
| 74 | 3300009147 | Ga0114129_10071520 | Ga0114129_100715203 | 264 |
| 75 | 3300025927 | Ga0207687_10349563 | Ga0207687_103495631 | 264 |
| 76 | 3300006871 | Ga0075434_100083014 | Ga0075434_1000830142 | 265 |
| 77 | 3300009551 | Ga0105238_10175196 | Ga0105238_101751963 | 265 |
| 78 | 3300014325 | Ga0163163_10243779 | Ga0163163_102437791 | 265 |
| 79 | 3300025918 | Ga0207662_10067481 | Ga0207662_100674813 | 265 |
| 80 | 3300005288 | Ga0065714_10002185 | Ga0065714_1000218577 | 266 |
| 81 | 3300005290 | Ga0065712_10067734 | Ga0065712_1006773484 | 266 |
| 82 | 3300005547 | Ga0070693_100209163 | Ga0070693_1002091632 | 266 |
| 83 | 3300005618 | Ga0068864_100047566 | Ga0068864_1000475663 | 266 |
| 84 | 3300007076 | Ga0075435_100023232 | Ga0075435_1000232323 | 266 |
| 85 | 3300009148 | Ga0105243_10479679 | Ga0105243_104796792 | 266 |
| 86 | 3300009177 | Ga0105248_10419163 | Ga0105248_104191632 | 266 |
| 87 | 3300014325 | Ga0163163_10025371 | Ga0163163_100253714 | 266 |
| 88 | 3300026023 | Ga0207677_10102055 | Ga0207677_101020552 | 266 |
| 89 | 3300031852 | Ga0307410_10359325 | Ga0307410_103593251 | 266 |
| 90 | 3300048909 | Ga0496106_0064399 | Ga0496106_0064399_1116_1970 | 266 |
| 91 | 3300002459 | JGI24751J29686_10000057 | JGI24751J29686_100000577 | 267 |
| 92 | 3300002459 | JGI24751J29686_10000130 | JGI24751J29686_1000013010 | 267 |
| 93 | 3300005290 | Ga0065712_10000847 | Ga0065712_100008473 | 267 |
| 94 | 3300005331 | Ga0070670_100003910 | Ga0070670_1000039107 | 267 |
| 95 | 3300005440 | Ga0070705_100154454 | Ga0070705_1001544541 | 267 |
| 96 | 3300005441 | Ga0070700_100000160 | Ga0070700_10000016028 | 267 |
| 97 | 3300005445 | Ga0070708_100013632 | Ga0070708_1000136326 | 267 |
| 98 | 3300005467 | Ga0070706_100028182 | Ga0070706_1000281823 | 267 |
| 99 | 3300005471 | Ga0070698_100104510 | Ga0070698_1001045103 | 267 |
| 100 | 3300005518 | Ga0070699_100041849 | Ga0070699_1000418492 | 267 |
| 101 | 3300005549 | Ga0070704_100015680 | Ga0070704_1000156803 | 267 |
| 102 | 3300005617 | Ga0068859_100054620 | Ga0068859_1000546202 | 267 |
| 103 | 3300006931 | Ga0097620_100054618 | Ga0097620_1000546183 | 267 |
| 104 | 3300009101 | Ga0105247_10025552 | Ga0105247_100255521 | 267 |
| 105 | 3300009101 | Ga0105247_10409831 | Ga0105247_104098312 | 267 |
| 106 | 3300009177 | Ga0105248_10017920 | Ga0105248_100179205 | 267 |
| 107 | 3300009177 | Ga0105248_10137132 | Ga0105248_101371323 | 267 |
| 108 | 3300013306 | Ga0163162_10086422 | Ga0163162_100864223 | 267 |
| 109 | 3300013306 | Ga0163162_11191058 | Ga0163162_111910581 | 267 |
| 110 | 3300014325 | Ga0163163_10072233 | Ga0163163_100722333 | 267 |
| 111 | 3300025900 | Ga0207710_10228377 | Ga0207710_102283771 | 267 |
| 112 | 3300025901 | Ga0207688_10157244 | Ga0207688_101572442 | 267 |
| 113 | 3300025904 | Ga0207647_10003641 | Ga0207647_100036414 | 267 |
| 114 | 3300025910 | Ga0207684_10040181 | Ga0207684_100401813 | 267 |
| 115 | 3300025941 | Ga0207711_10001579 | Ga0207711_1000157910 | 267 |
| 116 | 3300025961 | Ga0207712_10006513 | Ga0207712_100065133 | 267 |
| 117 | 3300026041 | Ga0207639_10095496 | Ga0207639_100954961 | 267 |
| 118 | 3300026075 | Ga0207708_10003087 | Ga0207708_100030878 | 267 |
| 119 | 3300026088 | Ga0207641_10094629 | Ga0207641_100946293 | 267 |
| 120 | 3300026088 | Ga0207641_10227708 | Ga0207641_102277082 | 267 |
| 121 | 3300026088 | Ga0207641_10311822 | Ga0207641_103118221 | 267 |
| 122 | 3300026118 | Ga0207675_100045697 | Ga0207675_1000456972 | 267 |
| 123 | 3300026118 | Ga0207675_100108525 | Ga0207675_1001085252 | 267 |
| 124 | 3300028380 | Ga0268265_10363045 | Ga0268265_103630452 | 267 |
| 125 | 3300028380 | Ga0268265_10471721 | Ga0268265_104717211 | 267 |
| 126 | 3300048915 | Ga0496112_0171639 | Ga0496112_0171639_1067_1870 | 267 |
| 127 | 3300005290 | Ga0065712_10098147 | Ga0065712_100981472 | 268 |
| 128 | 3300005293 | Ga0065715_10096492 | Ga0065715_100964922 | 268 |
| 129 | 3300005337 | Ga0070682_100137555 | Ga0070682_1001375552 | 268 |
| 130 | 3300005339 | Ga0070660_100013587 | Ga0070660_1000135872 | 268 |
| 131 | 3300005366 | Ga0070659_100003892 | Ga0070659_1000038924 | 268 |
| 132 | 3300005445 | Ga0070708_100050401 | Ga0070708_1000504013 | 268 |
| 133 | 3300005458 | Ga0070681_10017184 | Ga0070681_100171843 | 268 |
| 134 | 3300005467 | Ga0070706_100080148 | Ga0070706_1000801483 | 268 |
| 135 | 3300005530 | Ga0070679_100007512 | Ga0070679_1000075127 | 268 |
| 136 | 3300005539 | Ga0068853_100044902 | Ga0068853_1000449022 | 268 |
| 137 | 3300005539 | Ga0068853_100047085 | Ga0068853_1000470851 | 268 |
| 138 | 3300005545 | Ga0070695_100023604 | Ga0070695_1000236043 | 268 |
| 139 | 3300005564 | Ga0070664_100048673 | Ga0070664_1000486731 | 268 |
| 140 | 3300005577 | Ga0068857_100005840 | Ga0068857_1000058406 | 268 |
| 141 | 3300005842 | Ga0068858_100068863 | Ga0068858_1000688634 | 268 |
| 142 | 3300005843 | Ga0068860_100071551 | Ga0068860_1000715512 | 268 |
| 143 | 3300005843 | Ga0068860_100108952 | Ga0068860_1001089523 | 268 |
| 144 | 3300006237 | Ga0097621_100003003 | Ga0097621_1000030034 | 268 |
| 145 | 3300006358 | Ga0068871_100022053 | Ga0068871_1000220532 | 268 |
| 146 | 3300006847 | Ga0075431_100023531 | Ga0075431_1000235314 | 268 |
| 147 | 3300006852 | Ga0075433_10039081 | Ga0075433_100390812 | 268 |
| 148 | 3300006852 | Ga0075433_10216731 | Ga0075433_102167312 | 268 |
| 149 | 3300006880 | Ga0075429_100018127 | Ga0075429_1000181273 | 268 |
| 150 | 3300009147 | Ga0114129_10047028 | Ga0114129_100470283 | 268 |
| 151 | 3300009147 | Ga0114129_10073823 | Ga0114129_100738234 | 268 |
| 152 | 3300009177 | Ga0105248_10123035 | Ga0105248_101230352 | 268 |
| 153 | 3300009545 | Ga0105237_10781423 | Ga0105237_107814231 | 268 |
| 154 | 3300013100 | Ga0157373_10017404 | Ga0157373_100174043 | 268 |
| 155 | 3300013100 | Ga0157373_10033182 | Ga0157373_100331822 | 268 |
| 156 | 3300013100 | Ga0157373_10136235 | Ga0157373_101362351 | 268 |
| 157 | 3300013306 | Ga0163162_10009830 | Ga0163162_100098304 | 268 |
| 158 | 3300013307 | Ga0157372_10063147 | Ga0157372_100631472 | 268 |
| 159 | 3300013308 | Ga0157375_10052660 | Ga0157375_100526603 | 268 |
| 160 | 3300014325 | Ga0163163_10025292 | Ga0163163_100252924 | 268 |
| 161 | 3300014325 | Ga0163163_10192555 | Ga0163163_101925552 | 268 |
| 162 | 3300014745 | Ga0157377_10175391 | Ga0157377_101753912 | 268 |
| 163 | 3300025910 | Ga0207684_10386919 | Ga0207684_103869192 | 268 |
| 164 | 3300025912 | Ga0207707_10013088 | Ga0207707_100130886 | 268 |
| 165 | 3300025919 | Ga0207657_10094477 | Ga0207657_100944772 | 268 |
| 166 | 3300025920 | Ga0207649_10216652 | Ga0207649_102166522 | 268 |
| 167 | 3300025921 | Ga0207652_10049232 | Ga0207652_100492324 | 268 |
| 168 | 3300025932 | Ga0207690_10008850 | Ga0207690_100088503 | 268 |
| 169 | 3300025933 | Ga0207706_10196613 | Ga0207706_101966132 | 268 |
| 170 | 3300026041 | Ga0207639_10037227 | Ga0207639_100372274 | 268 |
| 171 | 3300026075 | Ga0207708_10018167 | Ga0207708_100181674 | 268 |
| 172 | 3300026116 | Ga0207674_10000077 | Ga0207674_1000007779 | 268 |
| 173 | 3300028381 | Ga0268264_10157056 | Ga0268264_101570562 | 268 |
| 174 | 3300028381 | Ga0268264_10442603 | Ga0268264_104426032 | 268 |
| 175 | 3300031548 | Ga0307408_100042662 | Ga0307408_1000426621 | 268 |
| 176 | 3300050507 | nmdc:mga05p37_150563_c1 | nmdc:mga05p37_150563_c1_986_1837 | 268 |
| 177 | 3300050507 | nmdc:mga05p37_89185_c1 | nmdc:mga05p37_89185_c1_1468_2274 | 268 |
| 178 | 3300050508 | nmdc:mga09592_46916_c1 | nmdc:mga09592_46916_c1_1308_2114 | 268 |
| 179 | 3300050509 | nmdc:mga0qj67_18189_c1 | nmdc:mga0qj67_18189_c1_3793_4599 | 268 |
| 180 | 3300050511 | nmdc:mga08y16_46322_c1 | nmdc:mga08y16_46322_c1_2590_3399 | 268 |
| 181 | 3300050515 | nmdc:mga0a205_26431_c1 | nmdc:mga0a205_26431_c1_205_1056 | 268 |
| 182 | 3300000531 | CNBas_1000927 | CNBas_10009272 | 269 |
| 183 | 3300005289 | Ga0065704_10011272 | Ga0065704_100112722 | 269 |
| 184 | 3300005295 | Ga0065707_10012783 | Ga0065707_100127833 | 269 |
| 185 | 3300005345 | Ga0070692_10023236 | Ga0070692_100232363 | 269 |
| 186 | 3300005355 | Ga0070671_100004416 | Ga0070671_1000044168 | 269 |
| 187 | 3300005366 | Ga0070659_100190044 | Ga0070659_1001900442 | 269 |
| 188 | 3300005406 | Ga0070703_10001808 | Ga0070703_100018084 | 269 |
| 189 | 3300005440 | Ga0070705_100032271 | Ga0070705_1000322712 | 269 |
| 190 | 3300005444 | Ga0070694_100015044 | Ga0070694_1000150443 | 269 |
| 191 | 3300005518 | Ga0070699_100013751 | Ga0070699_1000137516 | 269 |
| 192 | 3300005539 | Ga0068853_100284293 | Ga0068853_1002842932 | 269 |
| 193 | 3300005545 | Ga0070695_100030959 | Ga0070695_1000309592 | 269 |
| 194 | 3300005549 | Ga0070704_100031199 | Ga0070704_1000311993 | 269 |
| 195 | 3300005615 | Ga0070702_100033352 | Ga0070702_1000333522 | 269 |
| 196 | 3300005617 | Ga0068859_100056942 | Ga0068859_1000569423 | 269 |
| 197 | 3300005618 | Ga0068864_100052779 | Ga0068864_1000527791 | 269 |
| 198 | 3300005618 | Ga0068864_100269008 | Ga0068864_1002690082 | 269 |
| 199 | 3300005834 | Ga0068851_10001944 | Ga0068851_100019443 | 269 |
| 200 | 3300005841 | Ga0068863_100062800 | Ga0068863_1000628002 | 269 |
| 201 | 3300005844 | Ga0068862_100078498 | Ga0068862_1000784982 | 269 |
| 202 | 3300006844 | Ga0075428_100132361 | Ga0075428_1001323612 | 269 |
| 203 | 3300006852 | Ga0075433_10135899 | Ga0075433_101358993 | 269 |
| 204 | 3300006852 | Ga0075433_10178512 | Ga0075433_101785122 | 269 |
| 205 | 3300006852 | Ga0075433_10424549 | Ga0075433_104245492 | 269 |
| 206 | 3300006871 | Ga0075434_100147203 | Ga0075434_1001472033 | 269 |
| 207 | 3300006871 | Ga0075434_100224168 | Ga0075434_1002241682 | 269 |
| 208 | 3300006880 | Ga0075429_100046039 | Ga0075429_1000460393 | 269 |
| 209 | 3300006931 | Ga0097620_100056942 | Ga0097620_1000569423 | 269 |
| 210 | 3300009147 | Ga0114129_10180967 | Ga0114129_101809672 | 269 |
| 211 | 3300009147 | Ga0114129_10567058 | Ga0114129_105670582 | 269 |
| 212 | 3300009177 | Ga0105248_10316002 | Ga0105248_103160022 | 269 |
| 213 | 3300009177 | Ga0105248_10812894 | Ga0105248_108128942 | 269 |
| 214 | 3300009545 | Ga0105237_10016717 | Ga0105237_100167175 | 269 |
| 215 | 3300009545 | Ga0105237_10080002 | Ga0105237_100800022 | 269 |
| 216 | 3300011119 | Ga0105246_10097123 | Ga0105246_100971232 | 269 |
| 217 | 3300013308 | Ga0157375_10116537 | Ga0157375_101165371 | 269 |
| 218 | 3300014325 | Ga0163163_10185055 | Ga0163163_101850552 | 269 |
| 219 | 3300014326 | Ga0157380_10100088 | Ga0157380_101000882 | 269 |
| 220 | 3300025321 | Ga0207656_10003633 | Ga0207656_100036334 | 269 |
| 221 | 3300025885 | Ga0207653_10002464 | Ga0207653_100024645 | 269 |
| 222 | 3300025912 | Ga0207707_10055112 | Ga0207707_100551122 | 269 |
| 223 | 3300025914 | Ga0207671_10002078 | Ga0207671_1000207813 | 269 |
| 224 | 3300025940 | Ga0207691_10437135 | Ga0207691_104371352 | 269 |
| 225 | 3300026075 | Ga0207708_10328170 | Ga0207708_103281702 | 269 |
| 226 | 3300026078 | Ga0207702_10413526 | Ga0207702_104135262 | 269 |
| 227 | 3300026116 | Ga0207674_10322328 | Ga0207674_103223281 | 269 |
| 228 | 3300031731 | Ga0307405_10010333 | Ga0307405_100103333 | 269 |
| 229 | 3300031901 | Ga0307406_10017630 | Ga0307406_100176303 | 269 |
| 230 | 3300031995 | Ga0307409_100364598 | Ga0307409_1003645981 | 269 |
| 231 | 3300032005 | Ga0307411_10513765 | Ga0307411_105137652 | 269 |
| 232 | 3300042005 | Ga0439448_0018857 | Ga0439448_0018857_717_1526 | 269 |
| 233 | 3300045051 | Ga0451576_0149798 | Ga0451576_0149798_97_906 | 269 |
| 234 | 3300048909 | Ga0496106_0102882 | Ga0496106_0102882_1352_2161 | 269 |
| 235 | 3300048910 | Ga0496107_0175725 | Ga0496107_0175725_65_874 | 269 |
| 236 | 3300048911 | Ga0496108_0044798 | Ga0496108_0044798_929_1738 | 269 |
| 237 | 3300048912 | Ga0496109_0211562 | Ga0496109_0211562_24_833 | 269 |
| 238 | 3300048915 | Ga0496112_0125123 | Ga0496112_0125123_1666_2475 | 269 |
| 239 | 3300049521 | Ga0501298_008607 | Ga0501298_008607_49_858 | 269 |
| 240 | 3300049587 | Ga0501071_0393967 | Ga0501071_0393967_25_837 | 269 |
| 241 | 3300049649 | Ga0501198_001215 | Ga0501198_001215_1817_2626 | 269 |
| 242 | 3300049652 | Ga0501202_002092 | Ga0501202_002092_797_1606 | 269 |
| 243 | 3300049661 | Ga0501217_001684 | Ga0501217_001684_866_1675 | 269 |
| 244 | 3300049664 | Ga0501224_008426 | Ga0501224_008426_447_1256 | 269 |
| 245 | 3300049665 | Ga0501227_007444 | Ga0501227_007444_1477_2286 | 269 |
| 246 | 3300049667 | Ga0501230_007792 | Ga0501230_007792_644_1453 | 269 |
| 247 | 3300049682 | Ga0501252_009007 | Ga0501252_009007_107_916 | 269 |
| 248 | 3300049685 | Ga0501256_000710 | Ga0501256_000710_526_1335 | 269 |
| 249 | 3300049686 | Ga0501257_004859 | Ga0501257_004859_1587_2396 | 269 |
| 250 | 3300049688 | Ga0501259_001350 | Ga0501259_001350_2330_3139 | 269 |
| 251 | 3300049705 | Ga0501225_0002845 | Ga0501225_0002845_1913_2722 | 269 |
| 252 | 3300049741 | Ga0501079_0159312 | Ga0501079_0159312_489_1301 | 269 |
| 253 | 3300049765 | Ga0501268_005901 | Ga0501268_005901_580_1389 | 269 |
| 254 | 3300049853 | Ga0501226_000729 | Ga0501226_000729_1795_2604 | 269 |
| 255 | 3300050508 | nmdc:mga09592_68998_c1 | nmdc:mga09592_68998_c1_655_1509 | 269 |
| 256 | 3300050515 | nmdc:mga0a205_44656_c1 | nmdc:mga0a205_44656_c1_295_1104 | 269 |
| 257 | 3300005330 | Ga0070690_100242248 | Ga0070690_1002422482 | 270 |
| 258 | 3300005334 | Ga0068869_100054607 | Ga0068869_1000546073 | 270 |
| 259 | 3300005353 | Ga0070669_100037609 | Ga0070669_1000376093 | 270 |
| 260 | 3300005441 | Ga0070700_100031802 | Ga0070700_1000318021 | 270 |
| 261 | 3300005456 | Ga0070678_100478441 | Ga0070678_1004784412 | 270 |
| 262 | 3300005457 | Ga0070662_100107868 | Ga0070662_1001078683 | 270 |
| 263 | 3300005467 | Ga0070706_100048895 | Ga0070706_1000488953 | 270 |
| 264 | 3300005615 | Ga0070702_100034498 | Ga0070702_1000344982 | 270 |
| 265 | 3300005843 | Ga0068860_100136675 | Ga0068860_1001366752 | 270 |
| 266 | 3300006237 | Ga0097621_100019873 | Ga0097621_1000198733 | 270 |
| 267 | 3300013306 | Ga0163162_10368941 | Ga0163162_103689412 | 270 |
| 268 | 3300013308 | Ga0157375_10081135 | Ga0157375_100811352 | 270 |
| 269 | 3300014326 | Ga0157380_10024015 | Ga0157380_100240153 | 270 |
| 270 | 3300025925 | Ga0207650_10126577 | Ga0207650_101265773 | 270 |
| 271 | 3300025935 | Ga0207709_10050976 | Ga0207709_100509762 | 270 |
| 272 | 3300025981 | Ga0207640_10079534 | Ga0207640_100795343 | 270 |
| 273 | 3300026121 | Ga0207683_10455563 | Ga0207683_104555632 | 270 |
| 274 | 3300028380 | Ga0268265_10447803 | Ga0268265_104478032 | 270 |
| 275 | 3300028381 | Ga0268264_10153363 | Ga0268264_101533632 | 270 |
| 276 | 3300050515 | nmdc:mga0a205_80497_c1 | nmdc:mga0a205_80497_c1_1899_2711 | 270 |
| 277 | 3300031456 | Ga0307513_10070074 | Ga0307513_100700743 | 271 |
| 278 | 3300032126 | Ga0307415_100610364 | Ga0307415_1006103642 | 271 |
| 279 | 3300005518 | Ga0070699_100140666 | Ga0070699_1001406661 | 272 |
| 280 | 3300005536 | Ga0070697_100072275 | Ga0070697_1000722753 | 272 |
| 281 | 3300005985 | Ga0081539_10001228 | Ga0081539_100012283 | 272 |
| 282 | 3300013297 | Ga0157378_10083411 | Ga0157378_100834113 | 272 |
| 283 | 3300021384 | Ga0213876_10000011 | Ga0213876_10000011299 | 272 |
| 284 | 3300021384 | Ga0213876_10000205 | Ga0213876_1000020520 | 272 |
| 285 | 3300037418 | Ga0395900_0220912 | Ga0395900_0220912_284_1144 | 272 |
| 286 | 3300039437 | Ga0436365_0141476 | Ga0436365_0141476_26123_26965 | 272 |
| 287 | 3300039437 | Ga0436365_0815906 | Ga0436365_0815906_75455_76372 | 273 |
| 288 | 3300031901 | Ga0307406_10099911 | Ga0307406_100999111 | 274 |
| 289 | 3300032126 | Ga0307415_100037339 | Ga0307415_1000373395 | 274 |
| 290 | 3300009148 | Ga0105243_10225729 | Ga0105243_102257292 | 275 |
| 291 | 3300025942 | Ga0207689_10153758 | Ga0207689_101537582 | 275 |
| 292 | 3300048907 | Ga0496104_0315850 | Ga0496104_0315850_46_894 | 275 |
| 293 | 3300005467 | Ga0070706_100001130 | Ga0070706_1000011303 | 276 |
| 294 | 3300037418 | Ga0395900_0283157 | Ga0395900_0283157_163_1020 | 276 |
| 295 | 3300037418 | Ga0395900_0308985 | Ga0395900_0308985_255_1109 | 276 |
| 296 | 3300037471 | Ga0395905_0009575 | Ga0395905_0009575_7429_8283 | 276 |
| 297 | 3300037471 | Ga0395905_0144279 | Ga0395905_0144279_1211_2068 | 276 |
| 298 | 3300046615 | Ga0495656_0161408 | Ga0495656_0161408_19_849 | 276 |
| 299 | 3300005354 | Ga0070675_100091621 | Ga0070675_1000916212 | 277 |
| 300 | 3300005618 | Ga0068864_100059848 | Ga0068864_1000598482 | 277 |
| 301 | 3300005844 | Ga0068862_100494740 | Ga0068862_1004947402 | 277 |
| 302 | 3300014326 | Ga0157380_10002482 | Ga0157380_100024827 | 277 |
| 303 | 3300025907 | Ga0207645_10087010 | Ga0207645_100870101 | 277 |
| 304 | 3300025908 | Ga0207643_10051295 | Ga0207643_100512953 | 277 |
| 305 | 3300025926 | Ga0207659_10095039 | Ga0207659_100950392 | 277 |
| 306 | 3300025936 | Ga0207670_10019486 | Ga0207670_100194866 | 277 |
| 307 | 3300026118 | Ga0207675_100906487 | Ga0207675_1009064871 | 277 |
| 308 | 3300026121 | Ga0207683_10050284 | Ga0207683_100502842 | 277 |
| 309 | 3300031731 | Ga0307405_10050791 | Ga0307405_100507912 | 277 |
| 310 | 3300031901 | Ga0307406_10036533 | Ga0307406_100365333 | 277 |
| 311 | 3300032002 | Ga0307416_100150727 | Ga0307416_1001507272 | 277 |
| 312 | 3300032126 | Ga0307415_100615930 | Ga0307415_1006159301 | 277 |
| 313 | 3300035170 | Ga0373943_0162698 | Ga0373943_0162698_275_1114 | 277 |
| 314 | 3300046616 | Ga0495668_0001666 | Ga0495668_0001666_12145_12984 | 277 |
| 315 | 3300005293 | Ga0065715_10090473 | Ga0065715_100904735 | 278 |
| 316 | 3300005343 | Ga0070687_100000435 | Ga0070687_10000043511 | 278 |
| 317 | 3300005347 | Ga0070668_100434318 | Ga0070668_1004343182 | 278 |
| 318 | 3300005353 | Ga0070669_100243791 | Ga0070669_1002437912 | 278 |
| 319 | 3300005364 | Ga0070673_100468022 | Ga0070673_1004680221 | 278 |
| 320 | 3300005457 | Ga0070662_100355101 | Ga0070662_1003551011 | 278 |
| 321 | 3300005536 | Ga0070697_100000207 | Ga0070697_10000020719 | 278 |
| 322 | 3300005544 | Ga0070686_100001725 | Ga0070686_1000017258 | 278 |
| 323 | 3300005545 | Ga0070695_100111263 | Ga0070695_1001112632 | 278 |
| 324 | 3300005843 | Ga0068860_100495905 | Ga0068860_1004959051 | 278 |
| 325 | 3300009098 | Ga0105245_10124994 | Ga0105245_101249943 | 278 |
| 326 | 3300013297 | Ga0157378_10010769 | Ga0157378_100107696 | 278 |
| 327 | 3300017792 | Ga0163161_10071194 | Ga0163161_100711944 | 278 |
| 328 | 3300025918 | Ga0207662_10001260 | Ga0207662_100012608 | 278 |
| 329 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001622 | 278 |
| 330 | 3300026118 | Ga0207675_100059296 | Ga0207675_1000592962 | 278 |
| 331 | 3300028381 | Ga0268264_10414670 | Ga0268264_104146702 | 278 |
| 332 | 3300005364 | Ga0070673_100001519 | Ga0070673_1000015199 | 279 |
| 333 | 3300005536 | Ga0070697_100052105 | Ga0070697_1000521052 | 279 |
| 334 | 3300005578 | Ga0068854_100124448 | Ga0068854_1001244482 | 279 |
| 335 | 3300005718 | Ga0068866_10001808 | Ga0068866_100018086 | 279 |
| 336 | 3300005842 | Ga0068858_100109131 | Ga0068858_1001091312 | 279 |
| 337 | 3300009176 | Ga0105242_10007397 | Ga0105242_100073978 | 279 |
| 338 | 3300009176 | Ga0105242_10230479 | Ga0105242_102304792 | 279 |
| 339 | 3300013306 | Ga0163162_10131619 | Ga0163162_101316193 | 279 |
| 340 | 3300025899 | Ga0207642_10131643 | Ga0207642_101316432 | 279 |
| 341 | 3300025918 | Ga0207662_10036633 | Ga0207662_100366333 | 279 |
| 342 | 3300025934 | Ga0207686_10000320 | Ga0207686_1000032021 | 279 |
| 343 | 3300025960 | Ga0207651_10001197 | Ga0207651_100011977 | 279 |
| 344 | 3300005293 | Ga0065715_10015244 | Ga0065715_100152442 | 280 |
| 345 | 3300005330 | Ga0070690_100082220 | Ga0070690_1000822203 | 280 |
| 346 | 3300005364 | Ga0070673_100288641 | Ga0070673_1002886412 | 280 |
| 347 | 3300005444 | Ga0070694_100085553 | Ga0070694_1000855531 | 280 |
| 348 | 3300005471 | Ga0070698_100063904 | Ga0070698_1000639041 | 280 |
| 349 | 3300005539 | Ga0068853_100308685 | Ga0068853_1003086852 | 280 |
| 350 | 3300005615 | Ga0070702_100018148 | Ga0070702_1000181482 | 280 |
| 351 | 3300005719 | Ga0068861_100376280 | Ga0068861_1003762802 | 280 |
| 352 | 3300005841 | Ga0068863_100254211 | Ga0068863_1002542112 | 280 |
| 353 | 3300005842 | Ga0068858_100128868 | Ga0068858_1001288682 | 280 |
| 354 | 3300005985 | Ga0081539_10038335 | Ga0081539_100383352 | 280 |
| 355 | 3300006871 | Ga0075434_100207304 | Ga0075434_1002073041 | 280 |
| 356 | 3300006880 | Ga0075429_100440229 | Ga0075429_1004402292 | 280 |
| 357 | 3300009094 | Ga0111539_10017280 | Ga0111539_100172805 | 280 |
| 358 | 3300009147 | Ga0114129_10024304 | Ga0114129_100243047 | 280 |
| 359 | 3300009177 | Ga0105248_10546137 | Ga0105248_105461372 | 280 |
| 360 | 3300025941 | Ga0207711_10030135 | Ga0207711_100301354 | 280 |
| 361 | 3300025941 | Ga0207711_10171890 | Ga0207711_101718902 | 280 |
| 362 | 3300025942 | Ga0207689_10028956 | Ga0207689_100289563 | 280 |
| 363 | 3300026089 | Ga0207648_10097905 | Ga0207648_100979051 | 280 |
| 364 | 3300026095 | Ga0207676_10639160 | Ga0207676_106391601 | 280 |
| 365 | 3300026118 | Ga0207675_100139401 | Ga0207675_1001394011 | 280 |
| 366 | 3300028381 | Ga0268264_10045940 | Ga0268264_100459402 | 280 |
| 367 | 3300037068 | Ga0373925_0206468 | Ga0373925_0206468_494_1345 | 280 |
| 368 | 3300039453 | Ga0436362_0292211 | Ga0436362_0292211_153_1004 | 280 |
| 369 | 3300046517 | Ga0495630_0309091 | Ga0495630_0309091_143_994 | 280 |
| 370 | 3300047471 | Ga0495684_0222900 | Ga0495684_0222900_493_1344 | 280 |
| 371 | 3300050508 | nmdc:mga09592_459883_c1 | nmdc:mga09592_459883_c1_224_1066 | 280 |
| 372 | 3300005347 | Ga0070668_100003879 | Ga0070668_1000038799 | 281 |
| 373 | 3300005467 | Ga0070706_100391253 | Ga0070706_1003912532 | 281 |
| 374 | 3300005471 | Ga0070698_100048160 | Ga0070698_1000481603 | 281 |
| 375 | 3300005536 | Ga0070697_100528478 | Ga0070697_1005284781 | 281 |
| 376 | 3300005544 | Ga0070686_100171123 | Ga0070686_1001711232 | 281 |
| 377 | 3300005546 | Ga0070696_100187691 | Ga0070696_1001876912 | 281 |
| 378 | 3300005549 | Ga0070704_100172597 | Ga0070704_1001725971 | 281 |
| 379 | 3300005617 | Ga0068859_100046516 | Ga0068859_1000465164 | 281 |
| 380 | 3300005719 | Ga0068861_100015521 | Ga0068861_1000155213 | 281 |
| 381 | 3300006931 | Ga0097620_100046515 | Ga0097620_1000465154 | 281 |
| 382 | 3300009174 | Ga0105241_10110305 | Ga0105241_101103052 | 281 |
| 383 | 3300009176 | Ga0105242_10265527 | Ga0105242_102655272 | 281 |
| 384 | 3300009553 | Ga0105249_10000052 | Ga0105249_1000005257 | 281 |
| 385 | 3300013297 | Ga0157378_10022019 | Ga0157378_100220193 | 281 |
| 386 | 3300013306 | Ga0163162_10000001 | Ga0163162_10000001569 | 281 |
| 387 | 3300014326 | Ga0157380_10001297 | Ga0157380_100012977 | 281 |
| 388 | 3300014326 | Ga0157380_10078016 | Ga0157380_100780162 | 281 |
| 389 | 3300025961 | Ga0207712_10000062 | Ga0207712_1000006219 | 281 |
| 390 | 3300025972 | Ga0207668_10002372 | Ga0207668_100023721 | 281 |
| 391 | 3300025981 | Ga0207640_10349310 | Ga0207640_103493102 | 281 |
| 392 | 3300026118 | Ga0207675_100026967 | Ga0207675_1000269673 | 281 |
| 393 | 3300031731 | Ga0307405_10163999 | Ga0307405_101639992 | 281 |
| 394 | 3300031852 | Ga0307410_10108724 | Ga0307410_101087242 | 281 |
| 395 | 3300031995 | Ga0307409_100084446 | Ga0307409_1000844462 | 281 |
| 396 | 3300032004 | Ga0307414_10078497 | Ga0307414_100784972 | 281 |
| 397 | 3300032126 | Ga0307415_100140541 | Ga0307415_1001405412 | 281 |
| 398 | 3300039437 | Ga0436365_1466764 | Ga0436365_1466764_1524_2372 | 281 |
| 399 | 3300046519 | Ga0495632_0004878 | Ga0495632_0004878_2921_3775 | 281 |
| 400 | 3300048915 | Ga0496112_0665435 | Ga0496112_0665435_59_904 | 281 |
| 401 | 3300049519 | Ga0501296_002588 | Ga0501296_002588_799_1644 | 281 |
| 402 | 3300049521 | Ga0501298_002419 | Ga0501298_002419_1491_2336 | 281 |
| 403 | 3300049522 | Ga0501299_003286 | Ga0501299_003286_289_1134 | 281 |
| 404 | 3300049574 | Ga0501038_0008718 | Ga0501038_0008718_4138_4983 | 281 |
| 405 | 3300049663 | Ga0501223_021985 | Ga0501223_021985_307_1152 | 281 |
| 406 | 3300049666 | Ga0501228_004038 | Ga0501228_004038_262_1107 | 281 |
| 407 | 3300049677 | Ga0501247_010392 | Ga0501247_010392_193_1038 | 281 |
| 408 | 3300049705 | Ga0501225_0021006 | Ga0501225_0021006_100_945 | 281 |
| 409 | 3300053142 | Ga0500577_0000980 | Ga0500577_0000980_4555_5406 | 281 |
| 410 | 3300061734 | Ga0530510_0014864 | Ga0530510_0014864_743_1591 | 281 |
| 411 | 3300000532 | CNAas_1001534 | CNAas_10015342 | 282 |
| 412 | 3300003203 | JGI25406J46586_10004357 | JGI25406J46586_100043574 | 282 |
| 413 | 3300003203 | JGI25406J46586_10005331 | JGI25406J46586_100053315 | 282 |
| 414 | 3300003203 | JGI25406J46586_10019649 | JGI25406J46586_100196492 | 282 |
| 415 | 3300003203 | JGI25406J46586_10039854 | JGI25406J46586_100398542 | 282 |
| 416 | 3300005293 | Ga0065715_10134200 | Ga0065715_101342002 | 282 |
| 417 | 3300005331 | Ga0070670_100041661 | Ga0070670_1000416612 | 282 |
| 418 | 3300005340 | Ga0070689_100002248 | Ga0070689_1000022484 | 282 |
| 419 | 3300005440 | Ga0070705_100009694 | Ga0070705_1000096943 | 282 |
| 420 | 3300005440 | Ga0070705_100065004 | Ga0070705_1000650042 | 282 |
| 421 | 3300005458 | Ga0070681_10000997 | Ga0070681_100009973 | 282 |
| 422 | 3300005458 | Ga0070681_10009358 | Ga0070681_100093583 | 282 |
| 423 | 3300005458 | Ga0070681_10093220 | Ga0070681_100932203 | 282 |
| 424 | 3300005467 | Ga0070706_100516577 | Ga0070706_1005165771 | 282 |
| 425 | 3300005468 | Ga0070707_100036706 | Ga0070707_1000367062 | 282 |
| 426 | 3300005471 | Ga0070698_100088025 | Ga0070698_1000880253 | 282 |
| 427 | 3300005530 | Ga0070679_100000972 | Ga0070679_1000009723 | 282 |
| 428 | 3300005536 | Ga0070697_100241064 | Ga0070697_1002410641 | 282 |
| 429 | 3300005545 | Ga0070695_100015718 | Ga0070695_1000157184 | 282 |
| 430 | 3300005545 | Ga0070695_100362717 | Ga0070695_1003627172 | 282 |
| 431 | 3300005547 | Ga0070693_100150699 | Ga0070693_1001506991 | 282 |
| 432 | 3300005547 | Ga0070693_100157540 | Ga0070693_1001575401 | 282 |
| 433 | 3300005549 | Ga0070704_100098691 | Ga0070704_1000986913 | 282 |
| 434 | 3300005564 | Ga0070664_100221220 | Ga0070664_1002212202 | 282 |
| 435 | 3300005617 | Ga0068859_100141953 | Ga0068859_1001419532 | 282 |
| 436 | 3300005617 | Ga0068859_100250243 | Ga0068859_1002502432 | 282 |
| 437 | 3300005617 | Ga0068859_100374917 | Ga0068859_1003749172 | 282 |
| 438 | 3300005840 | Ga0068870_10025568 | Ga0068870_100255682 | 282 |
| 439 | 3300005841 | Ga0068863_100006594 | Ga0068863_1000065947 | 282 |
| 440 | 3300005985 | Ga0081539_10000600 | Ga0081539_1000060041 | 282 |
| 441 | 3300005985 | Ga0081539_10001856 | Ga0081539_100018563 | 282 |
| 442 | 3300005985 | Ga0081539_10004100 | Ga0081539_100041003 | 282 |
| 443 | 3300006852 | Ga0075433_10061280 | Ga0075433_100612803 | 282 |
| 444 | 3300006852 | Ga0075433_10080955 | Ga0075433_100809553 | 282 |
| 445 | 3300006871 | Ga0075434_100153906 | Ga0075434_1001539061 | 282 |
| 446 | 3300006931 | Ga0097620_100141955 | Ga0097620_1001419552 | 282 |
| 447 | 3300006931 | Ga0097620_100250248 | Ga0097620_1002502482 | 282 |
| 448 | 3300006931 | Ga0097620_100374937 | Ga0097620_1003749372 | 282 |
| 449 | 3300009093 | Ga0105240_10490529 | Ga0105240_104905292 | 282 |
| 450 | 3300009553 | Ga0105249_10078821 | Ga0105249_100788213 | 282 |
| 451 | 3300010375 | Ga0105239_10273726 | Ga0105239_102737261 | 282 |
| 452 | 3300013307 | Ga0157372_10009277 | Ga0157372_100092772 | 282 |
| 453 | 3300013307 | Ga0157372_10447392 | Ga0157372_104473922 | 282 |
| 454 | 3300025908 | Ga0207643_10001960 | Ga0207643_100019607 | 282 |
| 455 | 3300025910 | Ga0207684_10112017 | Ga0207684_101120173 | 282 |
| 456 | 3300025912 | Ga0207707_10000072 | Ga0207707_1000007276 | 282 |
| 457 | 3300025912 | Ga0207707_10198850 | Ga0207707_101988502 | 282 |
| 458 | 3300025917 | Ga0207660_10001509 | Ga0207660_1000150913 | 282 |
| 459 | 3300025917 | Ga0207660_10393862 | Ga0207660_103938622 | 282 |
| 460 | 3300025918 | Ga0207662_10251654 | Ga0207662_102516542 | 282 |
| 461 | 3300025921 | Ga0207652_10000083 | Ga0207652_100000833 | 282 |
| 462 | 3300025932 | Ga0207690_10172881 | Ga0207690_101728811 | 282 |
| 463 | 3300025936 | Ga0207670_10000533 | Ga0207670_100005337 | 282 |
| 464 | 3300025936 | Ga0207670_10228310 | Ga0207670_102283101 | 282 |
| 465 | 3300025945 | Ga0207679_10491790 | Ga0207679_104917902 | 282 |
| 466 | 3300025949 | Ga0207667_10143720 | Ga0207667_101437203 | 282 |
| 467 | 3300025961 | Ga0207712_10031895 | Ga0207712_100318954 | 282 |
| 468 | 3300025981 | Ga0207640_10141465 | Ga0207640_101414652 | 282 |
| 469 | 3300026035 | Ga0207703_10471266 | Ga0207703_104712662 | 282 |
| 470 | 3300026088 | Ga0207641_10048368 | Ga0207641_100483682 | 282 |
| 471 | 3300026095 | Ga0207676_10554246 | Ga0207676_105542462 | 282 |
| 472 | 3300026116 | Ga0207674_10027665 | Ga0207674_100276655 | 282 |
| 473 | 3300026116 | Ga0207674_10460435 | Ga0207674_104604351 | 282 |
| 474 | 3300026118 | Ga0207675_100214924 | Ga0207675_1002149242 | 282 |
| 475 | 3300028381 | Ga0268264_10443776 | Ga0268264_104437762 | 282 |
| 476 | 3300031456 | Ga0307513_10015443 | Ga0307513_100154433 | 282 |
| 477 | 3300032002 | Ga0307416_100014278 | Ga0307416_1000142782 | 282 |
| 478 | 3300032126 | Ga0307415_100022212 | Ga0307415_1000222122 | 282 |
| 479 | 3300037466 | Ga0395898_0552172 | Ga0395898_0552172_123_971 | 282 |
| 480 | 3300038996 | Ga0242420_016540 | Ga0242420_016540_349_1200 | 282 |
| 481 | 3300048905 | Ga0496102_0078100 | Ga0496102_0078100_2142_2993 | 282 |
| 482 | 3300048907 | Ga0496104_0066645 | Ga0496104_0066645_1940_2788 | 282 |
| 483 | 3300048915 | Ga0496112_0106364 | Ga0496112_0106364_1640_2488 | 282 |
| 484 | 3300049514 | Ga0501291_001835 | Ga0501291_001835_1293_2144 | 282 |
| 485 | 3300049515 | Ga0501292_003256 | Ga0501292_003256_642_1493 | 282 |
| 486 | 3300049521 | Ga0501298_000628 | Ga0501298_000628_1899_2750 | 282 |
| 487 | 3300049661 | Ga0501217_021751 | Ga0501217_021751_233_1084 | 282 |
| 488 | 3300049663 | Ga0501223_019234 | Ga0501223_019234_383_1231 | 282 |
| 489 | 3300049668 | Ga0501233_026703 | Ga0501233_026703_287_1138 | 282 |
| 490 | 3300049669 | Ga0501235_021292 | Ga0501235_021292_518_1369 | 282 |
| 491 | 3300049673 | Ga0501240_019923 | Ga0501240_019923_48_896 | 282 |
| 492 | 3300049705 | Ga0501225_0019310 | Ga0501225_0019310_847_1695 | 282 |
| 493 | 3300049707 | Ga0501234_000566 | Ga0501234_000566_4746_5597 | 282 |
| 494 | 3300049767 | Ga0501270_009447 | Ga0501270_009447_283_1134 | 282 |
| 495 | 3300050511 | nmdc:mga08y16_117115_c1 | nmdc:mga08y16_117115_c1_361_1209 | 282 |
| 496 | 3300050513 | nmdc:mga0rr50_486582_c1 | nmdc:mga0rr50_486582_c1_124_975 | 282 |
| 497 | 3300050515 | nmdc:mga0a205_13699_c1 | nmdc:mga0a205_13699_c1_1209_2060 | 282 |
| 498 | 3300005335 | Ga0070666_10162921 | Ga0070666_101629212 | 283 |
| 499 | 3300005338 | Ga0068868_100366170 | Ga0068868_1003661702 | 283 |
| 500 | 3300005340 | Ga0070689_100156334 | Ga0070689_1001563342 | 283 |
| 501 | 3300005367 | Ga0070667_100014860 | Ga0070667_1000148605 | 283 |
| 502 | 3300005444 | Ga0070694_100289189 | Ga0070694_1002891891 | 283 |
| 503 | 3300005459 | Ga0068867_100101667 | Ga0068867_1001016672 | 283 |
| 504 | 3300005468 | Ga0070707_100206991 | Ga0070707_1002069913 | 283 |
| 505 | 3300005471 | Ga0070698_100001364 | Ga0070698_1000013648 | 283 |
| 506 | 3300005546 | Ga0070696_100346080 | Ga0070696_1003460801 | 283 |
| 507 | 3300005547 | Ga0070693_100010817 | Ga0070693_1000108172 | 283 |
| 508 | 3300005548 | Ga0070665_100061783 | Ga0070665_1000617832 | 283 |
| 509 | 3300005564 | Ga0070664_100120379 | Ga0070664_1001203792 | 283 |
| 510 | 3300005578 | Ga0068854_100022075 | Ga0068854_1000220754 | 283 |
| 511 | 3300005615 | Ga0070702_100059996 | Ga0070702_1000599962 | 283 |
| 512 | 3300005616 | Ga0068852_100078596 | Ga0068852_1000785963 | 283 |
| 513 | 3300005841 | Ga0068863_100207417 | Ga0068863_1002074172 | 283 |
| 514 | 3300005843 | Ga0068860_100031040 | Ga0068860_1000310404 | 283 |
| 515 | 3300006237 | Ga0097621_100039228 | Ga0097621_1000392283 | 283 |
| 516 | 3300007076 | Ga0075435_100000553 | Ga0075435_10000055319 | 283 |
| 517 | 3300009174 | Ga0105241_10016414 | Ga0105241_100164143 | 283 |
| 518 | 3300009176 | Ga0105242_10026829 | Ga0105242_100268293 | 283 |
| 519 | 3300009553 | Ga0105249_10482831 | Ga0105249_104828312 | 283 |
| 520 | 3300013296 | Ga0157374_10035834 | Ga0157374_100358342 | 283 |
| 521 | 3300013297 | Ga0157378_10002174 | Ga0157378_1000217413 | 283 |
| 522 | 3300014325 | Ga0163163_10041058 | Ga0163163_100410583 | 283 |
| 523 | 3300025922 | Ga0207646_10099734 | Ga0207646_100997342 | 283 |
| 524 | 3300025926 | Ga0207659_10029772 | Ga0207659_100297723 | 283 |
| 525 | 3300025942 | Ga0207689_10030940 | Ga0207689_100309403 | 283 |
| 526 | 3300025942 | Ga0207689_10142966 | Ga0207689_101429663 | 283 |
| 527 | 3300025945 | Ga0207679_10124446 | Ga0207679_101244462 | 283 |
| 528 | 3300025961 | Ga0207712_10436096 | Ga0207712_104360961 | 283 |
| 529 | 3300026035 | Ga0207703_10025488 | Ga0207703_100254884 | 283 |
| 530 | 3300026075 | Ga0207708_10049076 | Ga0207708_100490762 | 283 |
| 531 | 3300026095 | Ga0207676_10003857 | Ga0207676_100038575 | 283 |
| 532 | 3300028379 | Ga0268266_10083041 | Ga0268266_100830412 | 283 |
| 533 | 3300028381 | Ga0268264_10153869 | Ga0268264_101538692 | 283 |
| 534 | 3300031731 | Ga0307405_10220926 | Ga0307405_102209262 | 283 |
| 535 | 3300036401 | Ga0373937_0095390 | Ga0373937_0095390_589_1440 | 283 |
| 536 | 3300048907 | Ga0496104_0089274 | Ga0496104_0089274_829_1680 | 283 |
| 537 | 3300048907 | Ga0496104_0251798 | Ga0496104_0251798_75_926 | 283 |
| 538 | 3300049824 | Ga0501045_0287810 | Ga0501045_0287810_213_1067 | 283 |
| 539 | 3300050514 | nmdc:mga08x19_29_c1 | nmdc:mga08x19_29_c1_6754_7614 | 283 |
| 540 | 3300005330 | Ga0070690_100008632 | Ga0070690_1000086323 | 284 |
| 541 | 3300005334 | Ga0068869_100065121 | Ga0068869_1000651212 | 284 |
| 542 | 3300005340 | Ga0070689_100065268 | Ga0070689_1000652682 | 284 |
| 543 | 3300005353 | Ga0070669_100001639 | Ga0070669_1000016394 | 284 |
| 544 | 3300005353 | Ga0070669_100083393 | Ga0070669_1000833932 | 284 |
| 545 | 3300005354 | Ga0070675_100037129 | Ga0070675_1000371292 | 284 |
| 546 | 3300005355 | Ga0070671_100119617 | Ga0070671_1001196172 | 284 |
| 547 | 3300005364 | Ga0070673_100025218 | Ga0070673_1000252182 | 284 |
| 548 | 3300005440 | Ga0070705_100056941 | Ga0070705_1000569412 | 284 |
| 549 | 3300005441 | Ga0070700_100080305 | Ga0070700_1000803052 | 284 |
| 550 | 3300005444 | Ga0070694_100225091 | Ga0070694_1002250912 | 284 |
| 551 | 3300005445 | Ga0070708_100144676 | Ga0070708_1001446762 | 284 |
| 552 | 3300005456 | Ga0070678_100015951 | Ga0070678_1000159513 | 284 |
| 553 | 3300005459 | Ga0068867_100483280 | Ga0068867_1004832802 | 284 |
| 554 | 3300005467 | Ga0070706_100000500 | Ga0070706_10000050038 | 284 |
| 555 | 3300005468 | Ga0070707_100000313 | Ga0070707_1000003133 | 284 |
| 556 | 3300005468 | Ga0070707_100014326 | Ga0070707_1000143265 | 284 |
| 557 | 3300005468 | Ga0070707_100389247 | Ga0070707_1003892472 | 284 |
| 558 | 3300005468 | Ga0070707_100442466 | Ga0070707_1004424661 | 284 |
| 559 | 3300005471 | Ga0070698_100044321 | Ga0070698_1000443214 | 284 |
| 560 | 3300005471 | Ga0070698_100411449 | Ga0070698_1004114492 | 284 |
| 561 | 3300005518 | Ga0070699_100353059 | Ga0070699_1003530592 | 284 |
| 562 | 3300005518 | Ga0070699_100558187 | Ga0070699_1005581871 | 284 |
| 563 | 3300005536 | Ga0070697_100012185 | Ga0070697_1000121852 | 284 |
| 564 | 3300005536 | Ga0070697_100029814 | Ga0070697_1000298144 | 284 |
| 565 | 3300005543 | Ga0070672_100004840 | Ga0070672_1000048403 | 284 |
| 566 | 3300005546 | Ga0070696_100031815 | Ga0070696_1000318152 | 284 |
| 567 | 3300005549 | Ga0070704_100028073 | Ga0070704_1000280733 | 284 |
| 568 | 3300005549 | Ga0070704_100267098 | Ga0070704_1002670982 | 284 |
| 569 | 3300005564 | Ga0070664_100081681 | Ga0070664_1000816812 | 284 |
| 570 | 3300005615 | Ga0070702_100004186 | Ga0070702_1000041863 | 284 |
| 571 | 3300005616 | Ga0068852_100210342 | Ga0068852_1002103422 | 284 |
| 572 | 3300005718 | Ga0068866_10007827 | Ga0068866_100078274 | 284 |
| 573 | 3300005719 | Ga0068861_100052309 | Ga0068861_1000523092 | 284 |
| 574 | 3300005841 | Ga0068863_100038012 | Ga0068863_1000380123 | 284 |
| 575 | 3300005843 | Ga0068860_100021045 | Ga0068860_1000210452 | 284 |
| 576 | 3300005844 | Ga0068862_100004475 | Ga0068862_1000044757 | 284 |
| 577 | 3300006163 | Ga0070715_10000057 | Ga0070715_100000573 | 284 |
| 578 | 3300006237 | Ga0097621_100028707 | Ga0097621_1000287074 | 284 |
| 579 | 3300006358 | Ga0068871_100175095 | Ga0068871_1001750952 | 284 |
| 580 | 3300006844 | Ga0075428_100715947 | Ga0075428_1007159472 | 284 |
| 581 | 3300006881 | Ga0068865_100022500 | Ga0068865_1000225004 | 284 |
| 582 | 3300006914 | Ga0075436_100080668 | Ga0075436_1000806682 | 284 |
| 583 | 3300009094 | Ga0111539_10067238 | Ga0111539_100672384 | 284 |
| 584 | 3300009094 | Ga0111539_10891048 | Ga0111539_108910481 | 284 |
| 585 | 3300009147 | Ga0114129_10013019 | Ga0114129_100130199 | 284 |
| 586 | 3300009148 | Ga0105243_10033416 | Ga0105243_100334164 | 284 |
| 587 | 3300009148 | Ga0105243_10066674 | Ga0105243_100666743 | 284 |
| 588 | 3300009176 | Ga0105242_10024809 | Ga0105242_100248093 | 284 |
| 589 | 3300009177 | Ga0105248_10157796 | Ga0105248_101577962 | 284 |
| 590 | 3300009553 | Ga0105249_10027767 | Ga0105249_100277673 | 284 |
| 591 | 3300013297 | Ga0157378_10010686 | Ga0157378_100106863 | 284 |
| 592 | 3300014326 | Ga0157380_10010906 | Ga0157380_100109062 | 284 |
| 593 | 3300014326 | Ga0157380_10067960 | Ga0157380_100679602 | 284 |
| 594 | 3300025905 | Ga0207685_10000024 | Ga0207685_1000002470 | 284 |
| 595 | 3300025907 | Ga0207645_10203468 | Ga0207645_102034681 | 284 |
| 596 | 3300025908 | Ga0207643_10024585 | Ga0207643_100245853 | 284 |
| 597 | 3300025910 | Ga0207684_10009372 | Ga0207684_100093721 | 284 |
| 598 | 3300025910 | Ga0207684_10384147 | Ga0207684_103841472 | 284 |
| 599 | 3300025917 | Ga0207660_10196020 | Ga0207660_101960201 | 284 |
| 600 | 3300025918 | Ga0207662_10004086 | Ga0207662_100040865 | 284 |
| 601 | 3300025922 | Ga0207646_10000988 | Ga0207646_1000098829 | 284 |
| 602 | 3300025922 | Ga0207646_10170630 | Ga0207646_101706302 | 284 |
| 603 | 3300025922 | Ga0207646_10255758 | Ga0207646_102557582 | 284 |
| 604 | 3300025923 | Ga0207681_10098818 | Ga0207681_100988181 | 284 |
| 605 | 3300025926 | Ga0207659_10149891 | Ga0207659_101498912 | 284 |
| 606 | 3300025927 | Ga0207687_10171883 | Ga0207687_101718832 | 284 |
| 607 | 3300025931 | Ga0207644_10074505 | Ga0207644_100745052 | 284 |
| 608 | 3300025935 | Ga0207709_10080494 | Ga0207709_100804942 | 284 |
| 609 | 3300025936 | Ga0207670_10390644 | Ga0207670_103906441 | 284 |
| 610 | 3300025939 | Ga0207665_10000297 | Ga0207665_1000029729 | 284 |
| 611 | 3300025940 | Ga0207691_10032858 | Ga0207691_100328583 | 284 |
| 612 | 3300025941 | Ga0207711_10324513 | Ga0207711_103245132 | 284 |
| 613 | 3300025942 | Ga0207689_10000667 | Ga0207689_1000066728 | 284 |
| 614 | 3300025942 | Ga0207689_10068685 | Ga0207689_100686853 | 284 |
| 615 | 3300025981 | Ga0207640_10133958 | Ga0207640_101339581 | 284 |
| 616 | 3300025986 | Ga0207658_10033902 | Ga0207658_100339022 | 284 |
| 617 | 3300026023 | Ga0207677_10246858 | Ga0207677_102468581 | 284 |
| 618 | 3300026075 | Ga0207708_10003423 | Ga0207708_100034238 | 284 |
| 619 | 3300026075 | Ga0207708_10185215 | Ga0207708_101852152 | 284 |
| 620 | 3300026089 | Ga0207648_10051326 | Ga0207648_100513262 | 284 |
| 621 | 3300026089 | Ga0207648_10156575 | Ga0207648_101565752 | 284 |
| 622 | 3300026118 | Ga0207675_100085162 | Ga0207675_1000851622 | 284 |
| 623 | 3300026118 | Ga0207675_100654540 | Ga0207675_1006545401 | 284 |
| 624 | 3300026121 | Ga0207683_10029817 | Ga0207683_100298173 | 284 |
| 625 | 3300026142 | Ga0207698_10056181 | Ga0207698_100561812 | 284 |
| 626 | 3300028380 | Ga0268265_10031265 | Ga0268265_100312654 | 284 |
| 627 | 3300028380 | Ga0268265_10293513 | Ga0268265_102935132 | 284 |
| 628 | 3300028381 | Ga0268264_10094454 | Ga0268264_100944542 | 284 |
| 629 | 3300050511 | nmdc:mga08y16_61428_c1 | nmdc:mga08y16_61428_c1_639_1505 | 284 |
| 630 | 3300050514 | nmdc:mga08x19_160775_c1 | nmdc:mga08x19_160775_c1_148_1011 | 284 |
| 631 | 3300005544 | Ga0070686_100008085 | Ga0070686_1000080852 | 285 |
| 632 | 3300005618 | Ga0068864_100236991 | Ga0068864_1002369912 | 285 |
| 633 | 3300026116 | Ga0207674_10625258 | Ga0207674_106252581 | 285 |
| 634 | 3300031548 | Ga0307408_100301813 | Ga0307408_1003018131 | 285 |
| 635 | 2162886007 | SwRhRL2b_contig_2012073 | SwRhRL2b_0747.00001150 | 286 |
| 636 | 3300005289 | Ga0065704_10085496 | Ga0065704_100854962 | 286 |
| 637 | 3300005293 | Ga0065715_10112922 | Ga0065715_101129222 | 286 |
| 638 | 3300005295 | Ga0065707_10002276 | Ga0065707_100022764 | 286 |
| 639 | 3300005331 | Ga0070670_100001635 | Ga0070670_10000163510 | 286 |
| 640 | 3300005334 | Ga0068869_100015880 | Ga0068869_1000158803 | 286 |
| 641 | 3300005337 | Ga0070682_100000051 | Ga0070682_1000000512 | 286 |
| 642 | 3300005340 | Ga0070689_100032635 | Ga0070689_1000326352 | 286 |
| 643 | 3300005353 | Ga0070669_100028263 | Ga0070669_1000282634 | 286 |
| 644 | 3300005440 | Ga0070705_100059187 | Ga0070705_1000591872 | 286 |
| 645 | 3300005444 | Ga0070694_100003363 | Ga0070694_1000033636 | 286 |
| 646 | 3300005444 | Ga0070694_100090748 | Ga0070694_1000907481 | 286 |
| 647 | 3300005445 | Ga0070708_100024781 | Ga0070708_1000247813 | 286 |
| 648 | 3300005459 | Ga0068867_100392918 | Ga0068867_1003929181 | 286 |
| 649 | 3300005467 | Ga0070706_100001730 | Ga0070706_1000017309 | 286 |
| 650 | 3300005471 | Ga0070698_100054231 | Ga0070698_1000542312 | 286 |
| 651 | 3300005471 | Ga0070698_100303316 | Ga0070698_1003033162 | 286 |
| 652 | 3300005518 | Ga0070699_100060444 | Ga0070699_1000604443 | 286 |
| 653 | 3300005536 | Ga0070697_100000330 | Ga0070697_10000033018 | 286 |
| 654 | 3300005536 | Ga0070697_100036543 | Ga0070697_1000365433 | 286 |
| 655 | 3300005545 | Ga0070695_100139309 | Ga0070695_1001393092 | 286 |
| 656 | 3300005546 | Ga0070696_100018252 | Ga0070696_1000182523 | 286 |
| 657 | 3300005546 | Ga0070696_100122661 | Ga0070696_1001226612 | 286 |
| 658 | 3300005618 | Ga0068864_100294509 | Ga0068864_1002945092 | 286 |
| 659 | 3300005719 | Ga0068861_100021042 | Ga0068861_1000210425 | 286 |
| 660 | 3300009098 | Ga0105245_10405976 | Ga0105245_104059761 | 286 |
| 661 | 3300009148 | Ga0105243_10078790 | Ga0105243_100787903 | 286 |
| 662 | 3300009148 | Ga0105243_10103682 | Ga0105243_101036822 | 286 |
| 663 | 3300009148 | Ga0105243_10299556 | Ga0105243_102995562 | 286 |
| 664 | 3300009176 | Ga0105242_10240253 | Ga0105242_102402532 | 286 |
| 665 | 3300009176 | Ga0105242_10263285 | Ga0105242_102632852 | 286 |
| 666 | 3300009553 | Ga0105249_10070975 | Ga0105249_100709752 | 286 |
| 667 | 3300011119 | Ga0105246_10191353 | Ga0105246_101913532 | 286 |
| 668 | 3300013297 | Ga0157378_10166914 | Ga0157378_101669142 | 286 |
| 669 | 3300013297 | Ga0157378_10660554 | Ga0157378_106605542 | 286 |
| 670 | 3300013306 | Ga0163162_10014408 | Ga0163162_100144088 | 286 |
| 671 | 3300013306 | Ga0163162_10396276 | Ga0163162_103962761 | 286 |
| 672 | 3300025922 | Ga0207646_10108839 | Ga0207646_101088392 | 286 |
| 673 | 3300025923 | Ga0207681_10019404 | Ga0207681_100194042 | 286 |
| 674 | 3300025923 | Ga0207681_10226592 | Ga0207681_102265922 | 286 |
| 675 | 3300025925 | Ga0207650_10001812 | Ga0207650_100018123 | 286 |
| 676 | 3300025925 | Ga0207650_10284894 | Ga0207650_102848941 | 286 |
| 677 | 3300025927 | Ga0207687_10224305 | Ga0207687_102243052 | 286 |
| 678 | 3300025933 | Ga0207706_10187128 | Ga0207706_101871282 | 286 |
| 679 | 3300025935 | Ga0207709_10260534 | Ga0207709_102605342 | 286 |
| 680 | 3300025936 | Ga0207670_10168431 | Ga0207670_101684312 | 286 |
| 681 | 3300025960 | Ga0207651_10182498 | Ga0207651_101824982 | 286 |
| 682 | 3300025961 | Ga0207712_10352380 | Ga0207712_103523802 | 286 |
| 683 | 3300025981 | Ga0207640_10323359 | Ga0207640_103233591 | 286 |
| 684 | 3300026023 | Ga0207677_10153953 | Ga0207677_101539532 | 286 |
| 685 | 3300026075 | Ga0207708_10179336 | Ga0207708_101793362 | 286 |
| 686 | 3300026089 | Ga0207648_10232385 | Ga0207648_102323851 | 286 |
| 687 | 3300026118 | Ga0207675_100265036 | Ga0207675_1002650362 | 286 |
| 688 | 3300028380 | Ga0268265_10013648 | Ga0268265_100136484 | 286 |
| 689 | 3300031456 | Ga0307513_10407276 | Ga0307513_104072761 | 286 |
| 690 | 3300032002 | Ga0307416_100553229 | Ga0307416_1005532291 | 286 |
| 691 | 3300032126 | Ga0307415_100432512 | Ga0307415_1004325121 | 286 |
| 692 | 3300038443 | Ga0395901_0467537 | Ga0395901_0467537_22_882 | 286 |
| 693 | 3300045051 | Ga0451576_0276417 | Ga0451576_0276417_715_1575 | 286 |
| 694 | 3300046539 | Ga0495621_0002052 | Ga0495621_0002052_3908_4768 | 286 |
| 695 | 3300047318 | Ga0495636_0039488 | Ga0495636_0039488_22_882 | 286 |
| 696 | 3300047320 | Ga0495672_0019032 | Ga0495672_0019032_3209_4069 | 286 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar