F475829

General Info

Members Datasets Scaffolds Average Seq Length
696 248 696 276

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100059848|Ga0068864_1000598482
Length 295
Sequence LKSGNAKPTDFTDEYCPAMLLLLPYTEYLRRMIEPRNVADIIFVFLLVYAVLKLLRGTRAAPMAAGIGFLVFLYWLSVKQDLATLEFVLSNGLLYIGIAIIVLFQSEIRQALITFGNRFSVPFTRHHGQFGEGVYDEIILAATTLASTKTGALIVIERNVGLKNVTDGGVQLDAELSYDLLVSIFNTASPLHDGAVVVRRHRIAAASCFLPLTLNPRLSRDLGTRHRAAIGVTEDTDAVAVVVSEETGLISFVQRGDIKRGLDATKLRNAIFEALTGEPKRDREQKHSEEEIASI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
186 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
187 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
206 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
207 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
208 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
209 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
210 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
214 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
215 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
216 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
217 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
218 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
219 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
220 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
221 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
222 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
223 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
224 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
225 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
226 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
227 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
228 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
229 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
230 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
231 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
234 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
235 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
236 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
237 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 2.01
Rhizosphere 96.7
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2012073 2162886007 Bacteria 1996
2 CNBas_1000927 3300000531 Unclassified 1456
3 CNAas_1001534 3300000532 Unclassified 1914
4 LJQas_1000152 3300000549 Bacteria 12218
5 JGI24751J29686_10000057 3300002459 Bacteria 62893
6 JGI24751J29686_10000130 3300002459 Bacteria 37822
7 JGI25406J46586_10004357 3300003203 Bacteria 6604
8 JGI25406J46586_10005331 3300003203 Bacteria 5965
9 JGI25406J46586_10019649 3300003203 Unclassified 2747
10 JGI25406J46586_10039854 3300003203 Unclassified 1671
11 Ga0065714_10002185 3300005288 Bacteria 199213
12 Ga0065704_10011272 3300005289 Bacteria 2290
13 Ga0065704_10085496 3300005289 Unclassified 3200
14 Ga0065712_10000847 3300005290 Bacteria 10173
15 Ga0065712_10067734 3300005290 Bacteria 110577
16 Ga0065712_10098147 3300005290 Bacteria 2128
17 Ga0065715_10015244 3300005293 Bacteria 1704
18 Ga0065715_10090473 3300005293 Bacteria 6949
19 Ga0065715_10096492 3300005293 Bacteria 3869
20 Ga0065715_10112922 3300005293 Bacteria 2483
21 Ga0065715_10113893 3300005293 Bacteria 2471
22 Ga0065715_10134200 3300005293 Bacteria 1959
23 Ga0065707_10001542 3300005295 Bacteria 9328
24 Ga0065707_10002276 3300005295 Unclassified 4777
25 Ga0065707_10012783 3300005295 Bacteria 2752
26 Ga0070690_100008632 3300005330 Bacteria 5876
27 Ga0070690_100082220 3300005330 Bacteria 2108
28 Ga0070690_100242248 3300005330 Unclassified 1272
29 Ga0070670_100001635 3300005331 Bacteria 18122
30 Ga0070670_100003910 3300005331 Bacteria 12427
31 Ga0070670_100041661 3300005331 Bacteria 3946
32 Ga0068869_100015880 3300005334 Bacteria 5064
33 Ga0068869_100054607 3300005334 Bacteria 2909
34 Ga0068869_100065121 3300005334 Bacteria 2682
35 Ga0068869_100136228 3300005334 Bacteria 1892
36 Ga0070666_10162921 3300005335 Unclassified 1559
37 Ga0070682_100000051 3300005337 Bacteria 123476
38 Ga0070682_100137555 3300005337 Bacteria 1661
39 Ga0068868_100366170 3300005338 Bacteria 1238
40 Ga0070660_100013587 3300005339 Bacteria 5847
41 Ga0070689_100002248 3300005340 Bacteria 12540
42 Ga0070689_100032635 3300005340 Bacteria 3962
43 Ga0070689_100065268 3300005340 Bacteria 2834
44 Ga0070689_100156334 3300005340 Bacteria 1841
45 Ga0070687_100000435 3300005343 Bacteria 14150
46 Ga0070687_100177392 3300005343 Bacteria 1273
47 Ga0070692_10023236 3300005345 Bacteria 3036
48 Ga0070668_100003879 3300005347 Bacteria 11042
49 Ga0070668_100434318 3300005347 Bacteria 1126
50 Ga0070669_100001639 3300005353 Bacteria 16214
51 Ga0070669_100028263 3300005353 Bacteria 4039
52 Ga0070669_100037609 3300005353 Bacteria 3511
53 Ga0070669_100083393 3300005353 Bacteria 2383
54 Ga0070669_100243791 3300005353 Bacteria 1429
55 Ga0070675_100037129 3300005354 Bacteria 3967
56 Ga0070675_100091621 3300005354 Bacteria 2547
57 Ga0070671_100004416 3300005355 Bacteria 11119
58 Ga0070671_100119617 3300005355 Bacteria 2216
59 Ga0070673_100001519 3300005364 Bacteria 13657
60 Ga0070673_100025218 3300005364 Bacteria 4372
61 Ga0070673_100288641 3300005364 Bacteria 1441
62 Ga0070673_100468022 3300005364 Bacteria 1136
63 Ga0070659_100003892 3300005366 Bacteria 10636
64 Ga0070659_100190044 3300005366 Bacteria 1687
65 Ga0070667_100014860 3300005367 Bacteria 6432
66 Ga0070703_10001808 3300005406 Bacteria 6321
67 Ga0070705_100009694 3300005440 Bacteria 4796
68 Ga0070705_100032271 3300005440 Bacteria 2908
69 Ga0070705_100056941 3300005440 Bacteria 2304
70 Ga0070705_100059187 3300005440 Unclassified 2267
71 Ga0070705_100065004 3300005440 Unclassified 2182
72 Ga0070705_100154454 3300005440 Bacteria 1526
73 Ga0070700_100000160 3300005441 Bacteria 38863
74 Ga0070700_100031802 3300005441 Bacteria 3166
75 Ga0070700_100080305 3300005441 Bacteria 2104
76 Ga0070694_100003363 3300005444 Bacteria 9581
77 Ga0070694_100015044 3300005444 Bacteria 4850
78 Ga0070694_100085553 3300005444 Bacteria 2202
79 Ga0070694_100090748 3300005444 Unclassified 2143
80 Ga0070694_100225091 3300005444 Bacteria 1409
81 Ga0070694_100289189 3300005444 Unclassified 1252
82 Ga0070708_100013632 3300005445 Bacteria 6664
83 Ga0070708_100024781 3300005445 Bacteria 5123
84 Ga0070708_100050401 3300005445 Bacteria 3686
85 Ga0070708_100144676 3300005445 Bacteria 2207
86 Ga0070678_100015951 3300005456 Bacteria 4788
87 Ga0070678_100478441 3300005456 Bacteria 1095
88 Ga0070662_100107868 3300005457 Bacteria 2117
89 Ga0070662_100355101 3300005457 Bacteria 1202
90 Ga0070681_10000997 3300005458 Bacteria 23962
91 Ga0070681_10009358 3300005458 Bacteria 9640
92 Ga0070681_10017184 3300005458 Bacteria 7233
93 Ga0070681_10093220 3300005458 Bacteria 2960
94 Ga0068867_100101667 3300005459 Bacteria 2196
95 Ga0068867_100392918 3300005459 Bacteria 1168
96 Ga0068867_100483280 3300005459 Bacteria 1062
97 Ga0070706_100000500 3300005467 Bacteria 45929
98 Ga0070706_100001130 3300005467 Bacteria 28845
99 Ga0070706_100001730 3300005467 Bacteria 22614
100 Ga0070706_100028182 3300005467 Bacteria 5169
101 Ga0070706_100048895 3300005467 Bacteria 3903
102 Ga0070706_100080148 3300005467 Bacteria 3023
103 Ga0070706_100391253 3300005467 Bacteria 1294
104 Ga0070706_100516577 3300005467 Unclassified 1111
105 Ga0070707_100000313 3300005468 Bacteria 47522
106 Ga0070707_100014326 3300005468 Bacteria 7434
107 Ga0070707_100036706 3300005468 Bacteria 4677
108 Ga0070707_100206991 3300005468 Unclassified 1912
109 Ga0070707_100389247 3300005468 Bacteria 1354
110 Ga0070707_100442466 3300005468 Unclassified 1260
111 Ga0070698_100001364 3300005471 Bacteria 27181
112 Ga0070698_100044321 3300005471 Bacteria 4556
113 Ga0070698_100048160 3300005471 Bacteria 4356
114 Ga0070698_100054231 3300005471 Bacteria 4071
115 Ga0070698_100063904 3300005471 Bacteria 3710
116 Ga0070698_100088025 3300005471 Bacteria 3091
117 Ga0070698_100104510 3300005471 Bacteria 2802
118 Ga0070698_100303316 3300005471 Bacteria 1528
119 Ga0070698_100411449 3300005471 Bacteria 1286
120 Ga0070699_100013751 3300005518 Bacteria 6962
121 Ga0070699_100041849 3300005518 Bacteria 3964
122 Ga0070699_100060444 3300005518 Unclassified 3283
123 Ga0070699_100140666 3300005518 Bacteria 2131
124 Ga0070699_100353059 3300005518 Bacteria 1325
125 Ga0070699_100558187 3300005518 Unclassified 1043
126 Ga0070679_100000972 3300005530 Bacteria 24934
127 Ga0070679_100007512 3300005530 Bacteria 10193
128 Ga0070697_100000207 3300005536 Bacteria 48241
129 Ga0070697_100000330 3300005536 Bacteria 37281
130 Ga0070697_100012185 3300005536 Bacteria 6735
131 Ga0070697_100029814 3300005536 Bacteria 4378
132 Ga0070697_100036543 3300005536 Bacteria 3968
133 Ga0070697_100052105 3300005536 Bacteria 3326
134 Ga0070697_100072275 3300005536 Bacteria 2830
135 Ga0070697_100081828 3300005536 Bacteria 2661
136 Ga0070697_100241064 3300005536 Bacteria 1544
137 Ga0070697_100528478 3300005536 Bacteria 1033
138 Ga0068853_100044902 3300005539 Bacteria 3783
139 Ga0068853_100047085 3300005539 Bacteria 3700
140 Ga0068853_100284293 3300005539 Bacteria 1525
141 Ga0068853_100308685 3300005539 Bacteria 1464
142 Ga0070672_100004840 3300005543 Bacteria 8848
143 Ga0070686_100001725 3300005544 Bacteria 12222
144 Ga0070686_100008085 3300005544 Bacteria 5877
145 Ga0070686_100171123 3300005544 Bacteria 1536
146 Ga0070695_100015718 3300005545 Bacteria 4573
147 Ga0070695_100023604 3300005545 Bacteria 3783
148 Ga0070695_100030959 3300005545 Bacteria 3334
149 Ga0070695_100111263 3300005545 Bacteria 1859
150 Ga0070695_100139309 3300005545 Bacteria 1680
151 Ga0070695_100362717 3300005545 Unclassified 1089
152 Ga0070696_100018252 3300005546 Bacteria 4740
153 Ga0070696_100031815 3300005546 Bacteria 3618
154 Ga0070696_100122661 3300005546 Unclassified 1882
155 Ga0070696_100126835 3300005546 Bacteria 1852
156 Ga0070696_100187691 3300005546 Bacteria 1537
157 Ga0070696_100346080 3300005546 Unclassified 1150
158 Ga0070693_100010817 3300005547 Bacteria 4579
159 Ga0070693_100150699 3300005547 Unclassified 1473
160 Ga0070693_100157540 3300005547 Bacteria 1443
161 Ga0070693_100209163 3300005547 Bacteria 1272
162 Ga0070665_100061783 3300005548 Bacteria 3756
163 Ga0070704_100015680 3300005549 Bacteria 4768
164 Ga0070704_100028073 3300005549 Bacteria 3739
165 Ga0070704_100031199 3300005549 Bacteria 3582
166 Ga0070704_100098691 3300005549 Unclassified 2195
167 Ga0070704_100172597 3300005549 Bacteria 1721
168 Ga0070704_100267098 3300005549 Unclassified 1412
169 Ga0070664_100048673 3300005564 Bacteria 3582
170 Ga0070664_100081681 3300005564 Unclassified 2786
171 Ga0070664_100120379 3300005564 Bacteria 2298
172 Ga0070664_100221220 3300005564 Unclassified 1694
173 Ga0070664_100377590 3300005564 Bacteria 1293
174 Ga0070664_100480325 3300005564 Unclassified 1143
175 Ga0068857_100005840 3300005577 Bacteria 10511
176 Ga0068854_100022075 3300005578 Bacteria 4329
177 Ga0068854_100124448 3300005578 Unclassified 1962
178 Ga0070702_100004186 3300005615 Bacteria 6563
179 Ga0070702_100018148 3300005615 Bacteria 3644
180 Ga0070702_100033352 3300005615 Bacteria 2831
181 Ga0070702_100034498 3300005615 Bacteria 2789
182 Ga0070702_100059996 3300005615 Unclassified 2210
183 Ga0068852_100078596 3300005616 Bacteria 2919
184 Ga0068852_100210342 3300005616 Bacteria 1845
185 Ga0068852_100262835 3300005616 Bacteria 1658
186 Ga0068859_100046516 3300005617 Bacteria 4357
187 Ga0068859_100054620 3300005617 Bacteria 4018
188 Ga0068859_100056942 3300005617 Bacteria 3937
189 Ga0068859_100131032 3300005617 Bacteria 2579
190 Ga0068859_100141953 3300005617 Bacteria 2475
191 Ga0068859_100250243 3300005617 Bacteria 1862
192 Ga0068859_100374917 3300005617 Bacteria 1518
193 Ga0068864_100047566 3300005618 Bacteria 3685
194 Ga0068864_100052779 3300005618 Bacteria 3505
195 Ga0068864_100059848 3300005618 Bacteria 3296
196 Ga0068864_100236991 3300005618 Unclassified 1689
197 Ga0068864_100269008 3300005618 Bacteria 1587
198 Ga0068864_100294509 3300005618 Bacteria 1518
199 Ga0068866_10001808 3300005718 Bacteria 8996
200 Ga0068866_10007827 3300005718 Bacteria 4484
201 Ga0068861_100015521 3300005719 Bacteria 5369
202 Ga0068861_100021042 3300005719 Bacteria 4685
203 Ga0068861_100052309 3300005719 Bacteria 3103
204 Ga0068861_100376280 3300005719 Bacteria 1253
205 Ga0068851_10001944 3300005834 Bacteria 9081
206 Ga0068870_10025568 3300005840 Bacteria 2932
207 Ga0068870_10026488 3300005840 Bacteria 2891
208 Ga0068863_100006594 3300005841 Bacteria 11390
209 Ga0068863_100038012 3300005841 Bacteria 4580
210 Ga0068863_100062800 3300005841 Bacteria 3513
211 Ga0068863_100207417 3300005841 Unclassified 1886
212 Ga0068863_100254211 3300005841 Bacteria 1698
213 Ga0068858_100068863 3300005842 Bacteria 3280
214 Ga0068858_100109131 3300005842 Bacteria 2583
215 Ga0068858_100128868 3300005842 Bacteria 2371
216 Ga0068860_100021045 3300005843 Bacteria 6319
217 Ga0068860_100031040 3300005843 Bacteria 5137
218 Ga0068860_100071551 3300005843 Bacteria 3295
219 Ga0068860_100093848 3300005843 Bacteria 2860
220 Ga0068860_100108952 3300005843 Bacteria 2647
221 Ga0068860_100136675 3300005843 Bacteria 2354
222 Ga0068860_100495905 3300005843 Bacteria 1219
223 Ga0068862_100004475 3300005844 Bacteria 11776
224 Ga0068862_100078498 3300005844 Bacteria 2860
225 Ga0068862_100195249 3300005844 Bacteria 1823
226 Ga0068862_100494740 3300005844 Bacteria 1160
227 Ga0081539_10000600 3300005985 Bacteria 73358
228 Ga0081539_10001228 3300005985 Bacteria 45804
229 Ga0081539_10001856 3300005985 Bacteria 33258
230 Ga0081539_10004100 3300005985 Bacteria 16628
231 Ga0081539_10038335 3300005985 Bacteria 2841
232 Ga0070715_10000057 3300006163 Bacteria 40962
233 Ga0097621_100003003 3300006237 Bacteria 11587
234 Ga0097621_100019873 3300006237 Bacteria 5166
235 Ga0097621_100028707 3300006237 Bacteria 4387
236 Ga0097621_100039228 3300006237 Bacteria 3803
237 Ga0068871_100022053 3300006358 Bacteria 4906
238 Ga0068871_100053723 3300006358 Bacteria 3266
239 Ga0068871_100175095 3300006358 Bacteria 1841
240 Ga0075428_100132361 3300006844 Bacteria 2712
241 Ga0075428_100715947 3300006844 Bacteria 1066
242 Ga0075430_100078262 3300006846 Bacteria 2772
243 Ga0075431_100023531 3300006847 Bacteria 6304
244 Ga0075431_100039034 3300006847 Bacteria 4891
245 Ga0075431_100080531 3300006847 Bacteria 3362
246 Ga0075433_10039081 3300006852 Bacteria 4101
247 Ga0075433_10061280 3300006852 Unclassified 3296
248 Ga0075433_10080955 3300006852 Bacteria 2863
249 Ga0075433_10135899 3300006852 Bacteria 2185
250 Ga0075433_10178512 3300006852 Bacteria 1889
251 Ga0075433_10216731 3300006852 Unclassified 1701
252 Ga0075433_10424549 3300006852 Bacteria 1172
253 Ga0075434_100083014 3300006871 Bacteria 3202
254 Ga0075434_100147203 3300006871 Bacteria 2375
255 Ga0075434_100153906 3300006871 Bacteria 2319
256 Ga0075434_100207304 3300006871 Bacteria 1981
257 Ga0075434_100224168 3300006871 Bacteria 1899
258 Ga0075429_100018127 3300006880 Bacteria 6092
259 Ga0075429_100046039 3300006880 Bacteria 3796
260 Ga0075429_100069147 3300006880 Unclassified 3074
261 Ga0075429_100440229 3300006880 Bacteria 1142
262 Ga0068865_100022500 3300006881 Bacteria 4113
263 Ga0075436_100080668 3300006914 Bacteria 2255
264 Ga0097620_100046515 3300006931 Bacteria 4357
265 Ga0097620_100054618 3300006931 Bacteria 4018
266 Ga0097620_100056942 3300006931 Bacteria 3937
267 Ga0097620_100131036 3300006931 Bacteria 2579
268 Ga0097620_100141955 3300006931 Bacteria 2475
269 Ga0097620_100250248 3300006931 Bacteria 1862
270 Ga0097620_100374937 3300006931 Bacteria 1518
271 Ga0075435_100000553 3300007076 Bacteria 22972
272 Ga0075435_100023232 3300007076 Bacteria 4792
273 Ga0105240_10490529 3300009093 Unclassified 1368
274 Ga0111539_10005784 3300009094 Bacteria 15980
275 Ga0111539_10017280 3300009094 Bacteria 8927
276 Ga0111539_10067238 3300009094 Bacteria 4232
277 Ga0111539_10891048 3300009094 Unclassified 1035
278 Ga0105245_10124994 3300009098 Unclassified 2407
279 Ga0105245_10405976 3300009098 Bacteria 1363
280 Ga0105247_10025552 3300009101 Bacteria 3564
281 Ga0105247_10409831 3300009101 Bacteria 968
282 Ga0114129_10013019 3300009147 Bacteria 11848
283 Ga0114129_10024304 3300009147 Bacteria 8585
284 Ga0114129_10024802 3300009147 Bacteria 8501
285 Ga0114129_10047028 3300009147 Bacteria 6064
286 Ga0114129_10071520 3300009147 Bacteria 4837
287 Ga0114129_10073823 3300009147 Bacteria 4752
288 Ga0114129_10180967 3300009147 Bacteria 2868
289 Ga0114129_10284968 3300009147 Bacteria 2206
290 Ga0114129_10567058 3300009147 Bacteria 1475
291 Ga0105243_10033416 3300009148 Bacteria 3978
292 Ga0105243_10066674 3300009148 Unclassified 2895
293 Ga0105243_10078790 3300009148 Unclassified 2684
294 Ga0105243_10103682 3300009148 Unclassified 2366
295 Ga0105243_10184181 3300009148 Bacteria 1818
296 Ga0105243_10225729 3300009148 Bacteria 1658
297 Ga0105243_10299556 3300009148 Unclassified 1457
298 Ga0105243_10479679 3300009148 Bacteria 1173
299 Ga0105241_10016414 3300009174 Bacteria 5431
300 Ga0105241_10037956 3300009174 Bacteria 3632
301 Ga0105241_10110305 3300009174 Bacteria 2201
302 Ga0105241_10339647 3300009174 Bacteria 1301
303 Ga0105242_10007397 3300009176 Bacteria 8456
304 Ga0105242_10024809 3300009176 Bacteria 4738
305 Ga0105242_10026829 3300009176 Bacteria 4568
306 Ga0105242_10230479 3300009176 Bacteria 1660
307 Ga0105242_10240253 3300009176 Bacteria 1628
308 Ga0105242_10263285 3300009176 Bacteria 1559
309 Ga0105242_10265527 3300009176 Unclassified 1552
310 Ga0105242_10574028 3300009176 Bacteria 1085
311 Ga0105248_10017920 3300009177 Bacteria 7814
312 Ga0105248_10123035 3300009177 Bacteria 2927
313 Ga0105248_10137132 3300009177 Bacteria 2760
314 Ga0105248_10157796 3300009177 Bacteria 2560
315 Ga0105248_10316002 3300009177 Bacteria 1759
316 Ga0105248_10419163 3300009177 Bacteria 1508
317 Ga0105248_10546137 3300009177 Unclassified 1307
318 Ga0105248_10812894 3300009177 Bacteria 1055
319 Ga0105237_10016717 3300009545 Bacteria 7617
320 Ga0105237_10080002 3300009545 Bacteria 3258
321 Ga0105237_10781423 3300009545 Unclassified 961
322 Ga0105238_10175196 3300009551 Bacteria 2122
323 Ga0105249_10000052 3300009553 Bacteria 168047
324 Ga0105249_10027767 3300009553 Bacteria 5107
325 Ga0105249_10070975 3300009553 Bacteria 3217
326 Ga0105249_10078821 3300009553 Unclassified 3057
327 Ga0105249_10236061 3300009553 Bacteria 1806
328 Ga0105249_10482831 3300009553 Unclassified 1282
329 Ga0105239_10273726 3300010375 Unclassified 1899
330 Ga0105246_10097123 3300011119 Bacteria 2137
331 Ga0105246_10191353 3300011119 Unclassified 1584
332 Ga0157373_10002635 3300013100 Bacteria 13612
333 Ga0157373_10017404 3300013100 Bacteria 5236
334 Ga0157373_10033182 3300013100 Bacteria 3715
335 Ga0157373_10136235 3300013100 Bacteria 1726
336 Ga0157371_10188643 3300013102 Bacteria 1476
337 Ga0157374_10035834 3300013296 Bacteria 4541
338 Ga0157378_10002174 3300013297 Bacteria 17393
339 Ga0157378_10010686 3300013297 Bacteria 8024
340 Ga0157378_10010769 3300013297 Bacteria 7994
341 Ga0157378_10022019 3300013297 Bacteria 5607
342 Ga0157378_10083411 3300013297 Bacteria 2892
343 Ga0157378_10166914 3300013297 Unclassified 2062
344 Ga0157378_10660554 3300013297 Bacteria 1062
345 Ga0163162_10000001 3300013306 Bacteria 751833
346 Ga0163162_10009830 3300013306 Bacteria 9305
347 Ga0163162_10014408 3300013306 Bacteria 7727
348 Ga0163162_10086422 3300013306 Bacteria 3214
349 Ga0163162_10131619 3300013306 Unclassified 2610
350 Ga0163162_10368941 3300013306 Bacteria 1569
351 Ga0163162_10396276 3300013306 Bacteria 1513
352 Ga0163162_11191058 3300013306 Bacteria 864
353 Ga0157372_10009277 3300013307 Bacteria 10464
354 Ga0157372_10063147 3300013307 Bacteria 4152
355 Ga0157372_10447392 3300013307 Unclassified 1506
356 Ga0157375_10052660 3300013308 Bacteria 4002
357 Ga0157375_10081135 3300013308 Bacteria 3283
358 Ga0157375_10116537 3300013308 Bacteria 2776
359 Ga0157375_10496469 3300013308 Bacteria 1385
360 Ga0163163_10025292 3300014325 Bacteria 5660
361 Ga0163163_10025371 3300014325 Bacteria 5651
362 Ga0163163_10041058 3300014325 Bacteria 4522
363 Ga0163163_10072233 3300014325 Bacteria 3440
364 Ga0163163_10185055 3300014325 Bacteria 2131
365 Ga0163163_10192555 3300014325 Bacteria 2087
366 Ga0163163_10243779 3300014325 Bacteria 1847
367 Ga0163163_10971396 3300014325 Bacteria 913
368 Ga0157380_10001297 3300014326 Bacteria 16250
369 Ga0157380_10002482 3300014326 Bacteria 12434
370 Ga0157380_10010906 3300014326 Bacteria 6553
371 Ga0157380_10024015 3300014326 Bacteria 4608
372 Ga0157380_10067960 3300014326 Bacteria 2871
373 Ga0157380_10078016 3300014326 Bacteria 2701
374 Ga0157380_10100088 3300014326 Bacteria 2412
375 Ga0157377_10175391 3300014745 Bacteria 1344
376 Ga0163161_10071194 3300017792 Bacteria 2544
377 Ga0213876_10000011 3300021384 Bacteria 414473
378 Ga0213876_10000205 3300021384 Bacteria 59996
379 Ga0207656_10003633 3300025321 Bacteria 5327
380 Ga0207653_10002464 3300025885 Bacteria 5882
381 Ga0207642_10131643 3300025899 Unclassified 1306
382 Ga0207710_10228377 3300025900 Bacteria 926
383 Ga0207688_10157244 3300025901 Bacteria 1345
384 Ga0207647_10003641 3300025904 Bacteria 11526
385 Ga0207685_10000024 3300025905 Bacteria 113741
386 Ga0207645_10087010 3300025907 Bacteria 2008
387 Ga0207645_10203468 3300025907 Bacteria 1303
388 Ga0207643_10001960 3300025908 Bacteria 11372
389 Ga0207643_10011980 3300025908 Bacteria 4682
390 Ga0207643_10024585 3300025908 Bacteria 3324
391 Ga0207643_10051295 3300025908 Bacteria 2342
392 Ga0207684_10000023 3300025910 Bacteria 334838
393 Ga0207684_10009372 3300025910 Bacteria 8650
394 Ga0207684_10040181 3300025910 Bacteria 3966
395 Ga0207684_10112017 3300025910 Unclassified 2336
396 Ga0207684_10384147 3300025910 Unclassified 1207
397 Ga0207684_10386919 3300025910 Bacteria 1203
398 Ga0207707_10000072 3300025912 Bacteria 102454
399 Ga0207707_10013088 3300025912 Bacteria 7228
400 Ga0207707_10055112 3300025912 Bacteria 3459
401 Ga0207707_10198850 3300025912 Unclassified 1748
402 Ga0207671_10002078 3300025914 Bacteria 21911
403 Ga0207660_10001509 3300025917 Bacteria 15666
404 Ga0207660_10196020 3300025917 Bacteria 1575
405 Ga0207660_10393862 3300025917 Bacteria 1115
406 Ga0207662_10001260 3300025918 Bacteria 12160
407 Ga0207662_10004086 3300025918 Bacteria 7626
408 Ga0207662_10036633 3300025918 Bacteria 2868
409 Ga0207662_10067481 3300025918 Bacteria 2157
410 Ga0207662_10251654 3300025918 Bacteria 1160
411 Ga0207657_10094477 3300025919 Bacteria 2490
412 Ga0207649_10216652 3300025920 Bacteria 1361
413 Ga0207652_10000083 3300025921 Bacteria 101957
414 Ga0207652_10049232 3300025921 Bacteria 3607
415 Ga0207646_10000988 3300025922 Bacteria 36539
416 Ga0207646_10099734 3300025922 Unclassified 2603
417 Ga0207646_10108839 3300025922 Unclassified 2487
418 Ga0207646_10170630 3300025922 Bacteria 1964
419 Ga0207646_10255758 3300025922 Unclassified 1583
420 Ga0207681_10019404 3300025923 Bacteria 4295
421 Ga0207681_10098818 3300025923 Bacteria 2100
422 Ga0207681_10226592 3300025923 Bacteria 1449
423 Ga0207650_10000001 3300025925 Bacteria 1545726
424 Ga0207650_10001812 3300025925 Bacteria 15115
425 Ga0207650_10126577 3300025925 Bacteria 1995
426 Ga0207650_10284894 3300025925 Bacteria 1346
427 Ga0207650_10607979 3300025925 Bacteria 920
428 Ga0207659_10029772 3300025926 Bacteria 3724
429 Ga0207659_10095039 3300025926 Bacteria 2235
430 Ga0207659_10149891 3300025926 Bacteria 1820
431 Ga0207687_10171883 3300025927 Bacteria 1672
432 Ga0207687_10224305 3300025927 Bacteria 1481
433 Ga0207687_10349563 3300025927 Unclassified 1204
434 Ga0207644_10074505 3300025931 Bacteria 2491
435 Ga0207690_10008850 3300025932 Bacteria 5974
436 Ga0207690_10172881 3300025932 Bacteria 1620
437 Ga0207706_10187128 3300025933 Bacteria 1818
438 Ga0207706_10196613 3300025933 Bacteria 1769
439 Ga0207686_10000320 3300025934 Bacteria 34504
440 Ga0207709_10050976 3300025935 Bacteria 2534
441 Ga0207709_10080494 3300025935 Bacteria 2098
442 Ga0207709_10260534 3300025935 Unclassified 1271
443 Ga0207670_10000533 3300025936 Bacteria 20906
444 Ga0207670_10019486 3300025936 Bacteria 4146
445 Ga0207670_10168431 3300025936 Bacteria 1640
446 Ga0207670_10228310 3300025936 Bacteria 1428
447 Ga0207670_10390644 3300025936 Bacteria 1110
448 Ga0207665_10000297 3300025939 Bacteria 34362
449 Ga0207691_10032858 3300025940 Bacteria 4835
450 Ga0207691_10437135 3300025940 Bacteria 1114
451 Ga0207711_10001579 3300025941 Bacteria 21034
452 Ga0207711_10030135 3300025941 Bacteria 4576
453 Ga0207711_10171890 3300025941 Unclassified 1966
454 Ga0207711_10324513 3300025941 Bacteria 1423
455 Ga0207689_10000667 3300025942 Bacteria 32744
456 Ga0207689_10028956 3300025942 Bacteria 4630
457 Ga0207689_10030940 3300025942 Bacteria 4459
458 Ga0207689_10068685 3300025942 Unclassified 2912
459 Ga0207689_10142966 3300025942 Bacteria 1971
460 Ga0207689_10153758 3300025942 Unclassified 1896
461 Ga0207689_10257062 3300025942 Bacteria 1445
462 Ga0207679_10124446 3300025945 Bacteria 2058
463 Ga0207679_10491790 3300025945 Bacteria 1094
464 Ga0207667_10143720 3300025949 Bacteria 2456
465 Ga0207651_10001197 3300025960 Bacteria 11613
466 Ga0207651_10182498 3300025960 Unclassified 1666
467 Ga0207712_10000062 3300025961 Bacteria 135638
468 Ga0207712_10006513 3300025961 Bacteria 7366
469 Ga0207712_10031895 3300025961 Unclassified 3552
470 Ga0207712_10352380 3300025961 Unclassified 1224
471 Ga0207712_10436096 3300025961 Unclassified 1108
472 Ga0207668_10002372 3300025972 Bacteria 11003
473 Ga0207640_10079534 3300025981 Bacteria 2235
474 Ga0207640_10133958 3300025981 Bacteria 1795
475 Ga0207640_10141465 3300025981 Bacteria 1754
476 Ga0207640_10323359 3300025981 Unclassified 1229
477 Ga0207640_10349310 3300025981 Unclassified 1188
478 Ga0207658_10033902 3300025986 Bacteria 3645
479 Ga0207677_10102055 3300026023 Bacteria 2114
480 Ga0207677_10153953 3300026023 Unclassified 1778
481 Ga0207677_10246858 3300026023 Bacteria 1447
482 Ga0207703_10025488 3300026035 Bacteria 4651
483 Ga0207703_10471266 3300026035 Bacteria 1175
484 Ga0207639_10037227 3300026041 Bacteria 3612
485 Ga0207639_10095496 3300026041 Bacteria 2389
486 Ga0207708_10003087 3300026075 Bacteria 12263
487 Ga0207708_10003423 3300026075 Bacteria 11688
488 Ga0207708_10018167 3300026075 Bacteria 5293
489 Ga0207708_10049076 3300026075 Bacteria 3214
490 Ga0207708_10179336 3300026075 Bacteria 1681
491 Ga0207708_10185215 3300026075 Bacteria 1654
492 Ga0207708_10328170 3300026075 Bacteria 1250
493 Ga0207702_10413526 3300026078 Bacteria 1303
494 Ga0207641_10048368 3300026088 Bacteria 3589
495 Ga0207641_10094629 3300026088 Bacteria 2620
496 Ga0207641_10227708 3300026088 Bacteria 1731
497 Ga0207641_10311822 3300026088 Bacteria 1489
498 Ga0207648_10051326 3300026089 Bacteria 3604
499 Ga0207648_10097905 3300026089 Bacteria 2568
500 Ga0207648_10156575 3300026089 Bacteria 2011
501 Ga0207648_10232385 3300026089 Unclassified 1640
502 Ga0207676_10003857 3300026095 Bacteria 10588
503 Ga0207676_10182477 3300026095 Bacteria 1839
504 Ga0207676_10554246 3300026095 Bacteria 1098
505 Ga0207676_10639160 3300026095 Unclassified 1026
506 Ga0207674_10000077 3300026116 Bacteria 104302
507 Ga0207674_10027665 3300026116 Bacteria 5994
508 Ga0207674_10222941 3300026116 Bacteria 1834
509 Ga0207674_10322328 3300026116 Bacteria 1494
510 Ga0207674_10460435 3300026116 Bacteria 1229
511 Ga0207674_10563079 3300026116 Bacteria 1101
512 Ga0207674_10625258 3300026116 Unclassified 1040
513 Ga0207675_100026967 3300026118 Bacteria 5348
514 Ga0207675_100045697 3300026118 Bacteria 4091
515 Ga0207675_100059296 3300026118 Unclassified 3571
516 Ga0207675_100085162 3300026118 Bacteria 2966
517 Ga0207675_100108525 3300026118 Bacteria 2618
518 Ga0207675_100139401 3300026118 Bacteria 2303
519 Ga0207675_100214924 3300026118 Bacteria 1851
520 Ga0207675_100265036 3300026118 Bacteria 1666
521 Ga0207675_100654540 3300026118 Unclassified 1057
522 Ga0207675_100906487 3300026118 Unclassified 898
523 Ga0207683_10029817 3300026121 Bacteria 4724
524 Ga0207683_10050284 3300026121 Bacteria 3651
525 Ga0207683_10455563 3300026121 Bacteria 1179
526 Ga0207698_10056181 3300026142 Bacteria 3038
527 Ga0207698_10401894 3300026142 Bacteria 1309
528 Ga0268266_10083041 3300028379 Bacteria 2796
529 Ga0268265_10013648 3300028380 Bacteria 5526
530 Ga0268265_10031265 3300028380 Bacteria 3843
531 Ga0268265_10293513 3300028380 Bacteria 1460
532 Ga0268265_10363045 3300028380 Bacteria 1326
533 Ga0268265_10447803 3300028380 Bacteria 1205
534 Ga0268265_10471721 3300028380 Unclassified 1177
535 Ga0268265_10548796 3300028380 Bacteria 1097
536 Ga0268264_10045940 3300028381 Bacteria 3627
537 Ga0268264_10094454 3300028381 Bacteria 2585
538 Ga0268264_10153363 3300028381 Bacteria 2068
539 Ga0268264_10153869 3300028381 Bacteria 2065
540 Ga0268264_10157056 3300028381 Bacteria 2045
541 Ga0268264_10414670 3300028381 Bacteria 1297
542 Ga0268264_10442603 3300028381 Bacteria 1257
543 Ga0268264_10443776 3300028381 Bacteria 1256
544 Ga0307513_10015443 3300031456 Bacteria 9256
545 Ga0307513_10070074 3300031456 Bacteria 3667
546 Ga0307513_10407276 3300031456 Unclassified 1093
547 Ga0307408_100042662 3300031548 Bacteria 3224
548 Ga0307408_100049555 3300031548 Bacteria 3017
549 Ga0307408_100301813 3300031548 Bacteria 1342
550 Ga0307405_10010333 3300031731 Bacteria 4829
551 Ga0307405_10050791 3300031731 Bacteria 2570
552 Ga0307405_10163999 3300031731 Bacteria 1577
553 Ga0307405_10220926 3300031731 Bacteria 1390
554 Ga0307410_10108724 3300031852 Bacteria 2003
555 Ga0307410_10359325 3300031852 Bacteria 1166
556 Ga0307406_10017630 3300031901 Bacteria 4160
557 Ga0307406_10036533 3300031901 Unclassified 3028
558 Ga0307406_10099911 3300031901 Bacteria 1974
559 Ga0307409_100084446 3300031995 Bacteria 2578
560 Ga0307409_100364598 3300031995 Bacteria 1368
561 Ga0307416_100014278 3300032002 Bacteria 5434
562 Ga0307416_100150727 3300032002 Bacteria 2132
563 Ga0307416_100271996 3300032002 Bacteria 1664
564 Ga0307416_100553229 3300032002 Unclassified 1224
565 Ga0307414_10078497 3300032004 Bacteria 2407
566 Ga0307411_10418214 3300032005 Bacteria 1113
567 Ga0307411_10513765 3300032005 Bacteria 1015
568 Ga0307415_100022212 3300032126 Bacteria 3911
569 Ga0307415_100037339 3300032126 Bacteria 3192
570 Ga0307415_100140541 3300032126 Bacteria 1843
571 Ga0307415_100432512 3300032126 Unclassified 1133
572 Ga0307415_100573258 3300032126 Bacteria 1000
573 Ga0307415_100610364 3300032126 Bacteria 972
574 Ga0307415_100615930 3300032126 Bacteria 968
575 Ga0373951_0000768 3300035091 Bacteria 8795
576 Ga0373943_0162698 3300035170 Bacteria 1216
577 Ga0373942_0032598 3300035207 Bacteria 1384
578 Ga0373937_0095390 3300036401 Bacteria 2758
579 Ga0373925_0206468 3300037068 Bacteria 1564
580 Ga0395900_0220912 3300037418 Bacteria 1910
581 Ga0395900_0283157 3300037418 Bacteria 1649
582 Ga0395900_0308985 3300037418 Bacteria 1565
583 Ga0395900_0363976 3300037418 Bacteria 1417
584 Ga0395900_0876585 3300037418 Unclassified 822
585 Ga0395898_0039969 3300037466 Bacteria 4641
586 Ga0395898_0552172 3300037466 Bacteria 1094
587 Ga0395905_0009575 3300037471 Bacteria 9459
588 Ga0395905_0144279 3300037471 Bacteria 2240
589 Ga0395901_0142272 3300038443 Bacteria 2521
590 Ga0395901_0145645 3300038443 Bacteria 2490
591 Ga0395901_0467537 3300038443 Unclassified 1288
592 Ga0242420_016540 3300038996 Unclassified 1285
593 Ga0436365_0141476 3300039437 Bacteria 76344
594 Ga0436365_0815906 3300039437 Bacteria 101407
595 Ga0436365_1466764 3300039437 Bacteria 3202
596 Ga0436362_0292211 3300039453 Bacteria 1384
597 Ga0439448_0018857 3300042005 Bacteria 2119
598 Ga0451576_0149798 3300045051 Bacteria 2433
599 Ga0451576_0276417 3300045051 Bacteria 1756
600 Ga0495664_0220945 3300046477 Unclassified 1147
601 Ga0495584_0151544 3300046491 Bacteria 1178
602 Ga0495610_0079371 3300046512 Bacteria 1511
603 Ga0495630_0309091 3300046517 Bacteria 1208
604 Ga0495632_0004878 3300046519 Bacteria 8997
605 Ga0495643_0035171 3300046522 Bacteria 2760
606 Ga0495663_0000941 3300046525 Bacteria 9701
607 Ga0495621_0002052 3300046539 Bacteria 5328
608 Ga0495656_0161408 3300046615 Bacteria 1090
609 Ga0495668_0001666 3300046616 Bacteria 20671
610 Ga0495668_0314221 3300046616 Bacteria 859
611 Ga0495636_0039488 3300047318 Bacteria 1955
612 Ga0495672_0019032 3300047320 Bacteria 4540
613 Ga0495684_0222900 3300047471 Bacteria 1382
614 Ga0496102_0078100 3300048905 Unclassified 3047
615 Ga0496104_0066645 3300048907 Bacteria 3419
616 Ga0496104_0089274 3300048907 Bacteria 2945
617 Ga0496104_0251798 3300048907 Bacteria 1679
618 Ga0496104_0315850 3300048907 Bacteria 1475
619 Ga0496106_0064399 3300048909 Bacteria 2789
620 Ga0496106_0102882 3300048909 Bacteria 2216
621 Ga0496107_0175725 3300048910 Bacteria 1590
622 Ga0496108_0044798 3300048911 Bacteria 3694
623 Ga0496109_0211562 3300048912 Bacteria 1824
624 Ga0496112_0106364 3300048915 Bacteria 2776
625 Ga0496112_0125123 3300048915 Bacteria 2542
626 Ga0496112_0171639 3300048915 Bacteria 2134
627 Ga0496112_0665435 3300048915 Bacteria 970
628 Ga0501291_001835 3300049514 Bacteria 2485
629 Ga0501292_003256 3300049515 Bacteria 2161
630 Ga0501296_002588 3300049519 Bacteria 1902
631 Ga0501298_000628 3300049521 Bacteria 4858
632 Ga0501298_002419 3300049521 Unclassified 2821
633 Ga0501298_008607 3300049521 Bacteria 1718
634 Ga0501299_003286 3300049522 Unclassified 2329
635 Ga0501300_008325 3300049523 Bacteria 1519
636 Ga0501038_0008718 3300049574 Bacteria 9306
637 Ga0501071_0393967 3300049587 Bacteria 1057
638 Ga0501198_001215 3300049649 Bacteria 3320
639 Ga0501202_002092 3300049652 Bacteria 3313
640 Ga0501206_006302 3300049653 Bacteria 1540
641 Ga0501217_001684 3300049661 Bacteria 4205
642 Ga0501217_021751 3300049661 Unclassified 1516
643 Ga0501223_006644 3300049663 Bacteria 2386
644 Ga0501223_019234 3300049663 Bacteria 1342
645 Ga0501223_021985 3300049663 Unclassified 1247
646 Ga0501224_004786 3300049664 Bacteria 1931
647 Ga0501224_008426 3300049664 Bacteria 1504
648 Ga0501227_007444 3300049665 Bacteria 2344
649 Ga0501227_016551 3300049665 Bacteria 1657
650 Ga0501228_004038 3300049666 Bacteria 1241
651 Ga0501230_007792 3300049667 Bacteria 1600
652 Ga0501233_026703 3300049668 Unclassified 1277
653 Ga0501235_021292 3300049669 Bacteria 1441
654 Ga0501235_048975 3300049669 Bacteria 976
655 Ga0501240_019923 3300049673 Bacteria 1000
656 Ga0501247_010392 3300049677 Bacteria 1109
657 Ga0501252_009007 3300049682 Bacteria 1157
658 Ga0501256_000710 3300049685 Bacteria 2233
659 Ga0501257_004859 3300049686 Bacteria 2943
660 Ga0501259_001350 3300049688 Bacteria 4113
661 Ga0501225_0002845 3300049705 Bacteria 5311
662 Ga0501225_0019310 3300049705 Bacteria 1887
663 Ga0501225_0021006 3300049705 Bacteria 1804
664 Ga0501234_000566 3300049707 Bacteria 5648
665 Ga0501079_0159312 3300049741 Bacteria 1760
666 Ga0501263_012675 3300049760 Bacteria 1060
667 Ga0501268_005901 3300049765 Bacteria 1776
668 Ga0501270_009447 3300049767 Unclassified 1260
669 Ga0501273_002268 3300049770 Bacteria 1943
670 Ga0501045_0287810 3300049824 Bacteria 1223
671 Ga0501226_000729 3300049853 Bacteria 4463
672 nmdc:mga05p37_150563_c1 3300050507 Bacteria 2846
673 nmdc:mga05p37_20630_c1 3300050507 Bacteria 7971
674 nmdc:mga05p37_239230_c1 3300050507 Bacteria 2184
675 nmdc:mga05p37_89185_c1 3300050507 Bacteria 3800
676 nmdc:mga09592_459883_c1 3300050508 Bacteria 1097
677 nmdc:mga09592_46916_c1 3300050508 Bacteria 3640
678 nmdc:mga09592_47223_c1 3300050508 Bacteria 3628
679 nmdc:mga09592_68998_c1 3300050508 Bacteria 2999
680 nmdc:mga0qj67_18189_c1 3300050509 Bacteria 5354
681 nmdc:mga0qj67_23281_c1 3300050509 Bacteria 4763
682 nmdc:mga0qj67_371813_c1 3300050509 Unclassified 1154
683 nmdc:mga06r32_327640_c1 3300050510 Unclassified 1517
684 nmdc:mga08y16_117115_c1 3300050511 Bacteria 2773
685 nmdc:mga08y16_46322_c1 3300050511 Bacteria 4552
686 nmdc:mga08y16_61428_c1 3300050511 Bacteria 3924
687 nmdc:mga0rr50_486582_c1 3300050513 Bacteria 1048
688 nmdc:mga08x19_160775_c1 3300050514 Bacteria 1525
689 nmdc:mga08x19_29_c1 3300050514 Bacteria 214647
690 nmdc:mga0a205_13699_c1 3300050515 Bacteria 7556
691 nmdc:mga0a205_26431_c1 3300050515 Bacteria 5535
692 nmdc:mga0a205_44656_c1 3300050515 Bacteria 3962
693 nmdc:mga0a205_80497_c1 3300050515 Bacteria 3147
694 nmdc:mga0a205_91993_c2 3300050515 Bacteria 2022
695 Ga0500577_0000980 3300053142 Bacteria 7354
696 Ga0530510_0014864 3300061734 Bacteria 5497

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0876585 Ga0395900_0876585_63_779 232
2 3300005546 Ga0070696_100126835 Ga0070696_1001268352 240
3 3300009147 Ga0114129_10284968 Ga0114129_102849682 241
4 3300050507 nmdc:mga05p37_239230_c1 nmdc:mga05p37_239230_c1_778_1503 241
5 3300046491 Ga0495584_0151544 Ga0495584_0151544_391_1119 242
6 3300046512 Ga0495610_0079371 Ga0495610_0079371_126_854 242
7 3300046525 Ga0495663_0000941 Ga0495663_0000941_8456_9184 242
8 3300046616 Ga0495668_0314221 Ga0495668_0314221_119_847 242
9 3300000549 LJQas_1000152 LJQas_10001525 243
10 3300009094 Ga0111539_10005784 Ga0111539_1000578412 246
11 3300009553 Ga0105249_10236061 Ga0105249_102360612 246
12 3300028380 Ga0268265_10548796 Ga0268265_105487962 251
13 3300049523 Ga0501300_008325 Ga0501300_008325_630_1406 252
14 3300005334 Ga0068869_100136228 Ga0068869_1001362282 253
15 3300005617 Ga0068859_100131032 Ga0068859_1001310322 253
16 3300005840 Ga0068870_10026488 Ga0068870_100264882 253
17 3300006931 Ga0097620_100131036 Ga0097620_1001310362 253
18 3300009174 Ga0105241_10339647 Ga0105241_103396471 253
19 3300013100 Ga0157373_10002635 Ga0157373_100026359 253
20 3300013102 Ga0157371_10188643 Ga0157371_101886432 253
21 3300025908 Ga0207643_10011980 Ga0207643_100119803 253
22 3300025942 Ga0207689_10257062 Ga0207689_102570622 253
23 3300026095 Ga0207676_10182477 Ga0207676_101824771 253
24 3300031548 Ga0307408_100049555 Ga0307408_1000495552 253
25 3300032002 Ga0307416_100271996 Ga0307416_1002719962 253
26 3300032005 Ga0307411_10418214 Ga0307411_104182141 253
27 3300035091 Ga0373951_0000768 Ga0373951_0000768_3506_4312 254
28 3300005616 Ga0068852_100262835 Ga0068852_1002628352 255
29 3300005844 Ga0068862_100195249 Ga0068862_1001952491 255
30 3300006847 Ga0075431_100080531 Ga0075431_1000805312 255
31 3300006880 Ga0075429_100069147 Ga0075429_1000691472 255
32 3300026142 Ga0207698_10401894 Ga0207698_104018942 255
33 3300037418 Ga0395900_0363976 Ga0395900_0363976_308_1120 255
34 3300037466 Ga0395898_0039969 Ga0395898_0039969_2800_3612 255
35 3300038443 Ga0395901_0142272 Ga0395901_0142272_553_1368 255
36 3300038443 Ga0395901_0145645 Ga0395901_0145645_1384_2196 255
37 3300050508 nmdc:mga09592_47223_c1 nmdc:mga09592_47223_c1_302_1108 255
38 3300050509 nmdc:mga0qj67_371813_c1 nmdc:mga0qj67_371813_c1_205_1011 255
39 3300005293 Ga0065715_10113893 Ga0065715_101138932 256
40 3300009147 Ga0114129_10024802 Ga0114129_100248023 256
41 3300025925 Ga0207650_10607979 Ga0207650_106079791 256
42 3300050507 nmdc:mga05p37_20630_c1 nmdc:mga05p37_20630_c1_6217_7026 256
43 3300050515 nmdc:mga0a205_91993_c2 nmdc:mga0a205_91993_c2_553_1362 256
44 3300005564 Ga0070664_100480325 Ga0070664_1004803251 257
45 3300005843 Ga0068860_100093848 Ga0068860_1000938483 257
46 3300006358 Ga0068871_100053723 Ga0068871_1000537233 257
47 3300006846 Ga0075430_100078262 Ga0075430_1000782622 257
48 3300006847 Ga0075431_100039034 Ga0075431_1000390344 257
49 3300009148 Ga0105243_10184181 Ga0105243_101841812 257
50 3300009174 Ga0105241_10037956 Ga0105241_100379562 257
51 3300009176 Ga0105242_10574028 Ga0105242_105740282 257
52 3300013308 Ga0157375_10496469 Ga0157375_104964692 257
53 3300014325 Ga0163163_10971396 Ga0163163_109713961 257
54 3300026116 Ga0207674_10222941 Ga0207674_102229412 257
55 3300026116 Ga0207674_10563079 Ga0207674_105630791 257
56 3300046522 Ga0495643_0035171 Ga0495643_0035171_1265_2071 257
57 3300050509 nmdc:mga0qj67_23281_c1 nmdc:mga0qj67_23281_c1_652_1458 257
58 3300050510 nmdc:mga06r32_327640_c1 nmdc:mga06r32_327640_c1_624_1430 257
59 3300032126 Ga0307415_100573258 Ga0307415_1005732581 258
60 3300046477 Ga0495664_0220945 Ga0495664_0220945_32_814 258
61 3300049653 Ga0501206_006302 Ga0501206_006302_590_1396 258
62 3300049663 Ga0501223_006644 Ga0501223_006644_1321_2127 258
63 3300049664 Ga0501224_004786 Ga0501224_004786_408_1214 258
64 3300049665 Ga0501227_016551 Ga0501227_016551_432_1238 258
65 3300049669 Ga0501235_048975 Ga0501235_048975_105_911 258
66 3300049760 Ga0501263_012675 Ga0501263_012675_13_819 258
67 3300049770 Ga0501273_002268 Ga0501273_002268_978_1784 258
68 3300005295 Ga0065707_10001542 Ga0065707_100015423 259
69 3300005564 Ga0070664_100377590 Ga0070664_1003775902 260
70 3300035207 Ga0373942_0032598 Ga0373942_0032598_388_1191 261
71 3300005536 Ga0070697_100081828 Ga0070697_1000818283 262
72 3300025910 Ga0207684_10000023 Ga0207684_10000023253 263
73 3300005343 Ga0070687_100177392 Ga0070687_1001773921 264
74 3300009147 Ga0114129_10071520 Ga0114129_100715203 264
75 3300025927 Ga0207687_10349563 Ga0207687_103495631 264
76 3300006871 Ga0075434_100083014 Ga0075434_1000830142 265
77 3300009551 Ga0105238_10175196 Ga0105238_101751963 265
78 3300014325 Ga0163163_10243779 Ga0163163_102437791 265
79 3300025918 Ga0207662_10067481 Ga0207662_100674813 265
80 3300005288 Ga0065714_10002185 Ga0065714_1000218577 266
81 3300005290 Ga0065712_10067734 Ga0065712_1006773484 266
82 3300005547 Ga0070693_100209163 Ga0070693_1002091632 266
83 3300005618 Ga0068864_100047566 Ga0068864_1000475663 266
84 3300007076 Ga0075435_100023232 Ga0075435_1000232323 266
85 3300009148 Ga0105243_10479679 Ga0105243_104796792 266
86 3300009177 Ga0105248_10419163 Ga0105248_104191632 266
87 3300014325 Ga0163163_10025371 Ga0163163_100253714 266
88 3300026023 Ga0207677_10102055 Ga0207677_101020552 266
89 3300031852 Ga0307410_10359325 Ga0307410_103593251 266
90 3300048909 Ga0496106_0064399 Ga0496106_0064399_1116_1970 266
91 3300002459 JGI24751J29686_10000057 JGI24751J29686_100000577 267
92 3300002459 JGI24751J29686_10000130 JGI24751J29686_1000013010 267
93 3300005290 Ga0065712_10000847 Ga0065712_100008473 267
94 3300005331 Ga0070670_100003910 Ga0070670_1000039107 267
95 3300005440 Ga0070705_100154454 Ga0070705_1001544541 267
96 3300005441 Ga0070700_100000160 Ga0070700_10000016028 267
97 3300005445 Ga0070708_100013632 Ga0070708_1000136326 267
98 3300005467 Ga0070706_100028182 Ga0070706_1000281823 267
99 3300005471 Ga0070698_100104510 Ga0070698_1001045103 267
100 3300005518 Ga0070699_100041849 Ga0070699_1000418492 267
101 3300005549 Ga0070704_100015680 Ga0070704_1000156803 267
102 3300005617 Ga0068859_100054620 Ga0068859_1000546202 267
103 3300006931 Ga0097620_100054618 Ga0097620_1000546183 267
104 3300009101 Ga0105247_10025552 Ga0105247_100255521 267
105 3300009101 Ga0105247_10409831 Ga0105247_104098312 267
106 3300009177 Ga0105248_10017920 Ga0105248_100179205 267
107 3300009177 Ga0105248_10137132 Ga0105248_101371323 267
108 3300013306 Ga0163162_10086422 Ga0163162_100864223 267
109 3300013306 Ga0163162_11191058 Ga0163162_111910581 267
110 3300014325 Ga0163163_10072233 Ga0163163_100722333 267
111 3300025900 Ga0207710_10228377 Ga0207710_102283771 267
112 3300025901 Ga0207688_10157244 Ga0207688_101572442 267
113 3300025904 Ga0207647_10003641 Ga0207647_100036414 267
114 3300025910 Ga0207684_10040181 Ga0207684_100401813 267
115 3300025941 Ga0207711_10001579 Ga0207711_1000157910 267
116 3300025961 Ga0207712_10006513 Ga0207712_100065133 267
117 3300026041 Ga0207639_10095496 Ga0207639_100954961 267
118 3300026075 Ga0207708_10003087 Ga0207708_100030878 267
119 3300026088 Ga0207641_10094629 Ga0207641_100946293 267
120 3300026088 Ga0207641_10227708 Ga0207641_102277082 267
121 3300026088 Ga0207641_10311822 Ga0207641_103118221 267
122 3300026118 Ga0207675_100045697 Ga0207675_1000456972 267
123 3300026118 Ga0207675_100108525 Ga0207675_1001085252 267
124 3300028380 Ga0268265_10363045 Ga0268265_103630452 267
125 3300028380 Ga0268265_10471721 Ga0268265_104717211 267
126 3300048915 Ga0496112_0171639 Ga0496112_0171639_1067_1870 267
127 3300005290 Ga0065712_10098147 Ga0065712_100981472 268
128 3300005293 Ga0065715_10096492 Ga0065715_100964922 268
129 3300005337 Ga0070682_100137555 Ga0070682_1001375552 268
130 3300005339 Ga0070660_100013587 Ga0070660_1000135872 268
131 3300005366 Ga0070659_100003892 Ga0070659_1000038924 268
132 3300005445 Ga0070708_100050401 Ga0070708_1000504013 268
133 3300005458 Ga0070681_10017184 Ga0070681_100171843 268
134 3300005467 Ga0070706_100080148 Ga0070706_1000801483 268
135 3300005530 Ga0070679_100007512 Ga0070679_1000075127 268
136 3300005539 Ga0068853_100044902 Ga0068853_1000449022 268
137 3300005539 Ga0068853_100047085 Ga0068853_1000470851 268
138 3300005545 Ga0070695_100023604 Ga0070695_1000236043 268
139 3300005564 Ga0070664_100048673 Ga0070664_1000486731 268
140 3300005577 Ga0068857_100005840 Ga0068857_1000058406 268
141 3300005842 Ga0068858_100068863 Ga0068858_1000688634 268
142 3300005843 Ga0068860_100071551 Ga0068860_1000715512 268
143 3300005843 Ga0068860_100108952 Ga0068860_1001089523 268
144 3300006237 Ga0097621_100003003 Ga0097621_1000030034 268
145 3300006358 Ga0068871_100022053 Ga0068871_1000220532 268
146 3300006847 Ga0075431_100023531 Ga0075431_1000235314 268
147 3300006852 Ga0075433_10039081 Ga0075433_100390812 268
148 3300006852 Ga0075433_10216731 Ga0075433_102167312 268
149 3300006880 Ga0075429_100018127 Ga0075429_1000181273 268
150 3300009147 Ga0114129_10047028 Ga0114129_100470283 268
151 3300009147 Ga0114129_10073823 Ga0114129_100738234 268
152 3300009177 Ga0105248_10123035 Ga0105248_101230352 268
153 3300009545 Ga0105237_10781423 Ga0105237_107814231 268
154 3300013100 Ga0157373_10017404 Ga0157373_100174043 268
155 3300013100 Ga0157373_10033182 Ga0157373_100331822 268
156 3300013100 Ga0157373_10136235 Ga0157373_101362351 268
157 3300013306 Ga0163162_10009830 Ga0163162_100098304 268
158 3300013307 Ga0157372_10063147 Ga0157372_100631472 268
159 3300013308 Ga0157375_10052660 Ga0157375_100526603 268
160 3300014325 Ga0163163_10025292 Ga0163163_100252924 268
161 3300014325 Ga0163163_10192555 Ga0163163_101925552 268
162 3300014745 Ga0157377_10175391 Ga0157377_101753912 268
163 3300025910 Ga0207684_10386919 Ga0207684_103869192 268
164 3300025912 Ga0207707_10013088 Ga0207707_100130886 268
165 3300025919 Ga0207657_10094477 Ga0207657_100944772 268
166 3300025920 Ga0207649_10216652 Ga0207649_102166522 268
167 3300025921 Ga0207652_10049232 Ga0207652_100492324 268
168 3300025932 Ga0207690_10008850 Ga0207690_100088503 268
169 3300025933 Ga0207706_10196613 Ga0207706_101966132 268
170 3300026041 Ga0207639_10037227 Ga0207639_100372274 268
171 3300026075 Ga0207708_10018167 Ga0207708_100181674 268
172 3300026116 Ga0207674_10000077 Ga0207674_1000007779 268
173 3300028381 Ga0268264_10157056 Ga0268264_101570562 268
174 3300028381 Ga0268264_10442603 Ga0268264_104426032 268
175 3300031548 Ga0307408_100042662 Ga0307408_1000426621 268
176 3300050507 nmdc:mga05p37_150563_c1 nmdc:mga05p37_150563_c1_986_1837 268
177 3300050507 nmdc:mga05p37_89185_c1 nmdc:mga05p37_89185_c1_1468_2274 268
178 3300050508 nmdc:mga09592_46916_c1 nmdc:mga09592_46916_c1_1308_2114 268
179 3300050509 nmdc:mga0qj67_18189_c1 nmdc:mga0qj67_18189_c1_3793_4599 268
180 3300050511 nmdc:mga08y16_46322_c1 nmdc:mga08y16_46322_c1_2590_3399 268
181 3300050515 nmdc:mga0a205_26431_c1 nmdc:mga0a205_26431_c1_205_1056 268
182 3300000531 CNBas_1000927 CNBas_10009272 269
183 3300005289 Ga0065704_10011272 Ga0065704_100112722 269
184 3300005295 Ga0065707_10012783 Ga0065707_100127833 269
185 3300005345 Ga0070692_10023236 Ga0070692_100232363 269
186 3300005355 Ga0070671_100004416 Ga0070671_1000044168 269
187 3300005366 Ga0070659_100190044 Ga0070659_1001900442 269
188 3300005406 Ga0070703_10001808 Ga0070703_100018084 269
189 3300005440 Ga0070705_100032271 Ga0070705_1000322712 269
190 3300005444 Ga0070694_100015044 Ga0070694_1000150443 269
191 3300005518 Ga0070699_100013751 Ga0070699_1000137516 269
192 3300005539 Ga0068853_100284293 Ga0068853_1002842932 269
193 3300005545 Ga0070695_100030959 Ga0070695_1000309592 269
194 3300005549 Ga0070704_100031199 Ga0070704_1000311993 269
195 3300005615 Ga0070702_100033352 Ga0070702_1000333522 269
196 3300005617 Ga0068859_100056942 Ga0068859_1000569423 269
197 3300005618 Ga0068864_100052779 Ga0068864_1000527791 269
198 3300005618 Ga0068864_100269008 Ga0068864_1002690082 269
199 3300005834 Ga0068851_10001944 Ga0068851_100019443 269
200 3300005841 Ga0068863_100062800 Ga0068863_1000628002 269
201 3300005844 Ga0068862_100078498 Ga0068862_1000784982 269
202 3300006844 Ga0075428_100132361 Ga0075428_1001323612 269
203 3300006852 Ga0075433_10135899 Ga0075433_101358993 269
204 3300006852 Ga0075433_10178512 Ga0075433_101785122 269
205 3300006852 Ga0075433_10424549 Ga0075433_104245492 269
206 3300006871 Ga0075434_100147203 Ga0075434_1001472033 269
207 3300006871 Ga0075434_100224168 Ga0075434_1002241682 269
208 3300006880 Ga0075429_100046039 Ga0075429_1000460393 269
209 3300006931 Ga0097620_100056942 Ga0097620_1000569423 269
210 3300009147 Ga0114129_10180967 Ga0114129_101809672 269
211 3300009147 Ga0114129_10567058 Ga0114129_105670582 269
212 3300009177 Ga0105248_10316002 Ga0105248_103160022 269
213 3300009177 Ga0105248_10812894 Ga0105248_108128942 269
214 3300009545 Ga0105237_10016717 Ga0105237_100167175 269
215 3300009545 Ga0105237_10080002 Ga0105237_100800022 269
216 3300011119 Ga0105246_10097123 Ga0105246_100971232 269
217 3300013308 Ga0157375_10116537 Ga0157375_101165371 269
218 3300014325 Ga0163163_10185055 Ga0163163_101850552 269
219 3300014326 Ga0157380_10100088 Ga0157380_101000882 269
220 3300025321 Ga0207656_10003633 Ga0207656_100036334 269
221 3300025885 Ga0207653_10002464 Ga0207653_100024645 269
222 3300025912 Ga0207707_10055112 Ga0207707_100551122 269
223 3300025914 Ga0207671_10002078 Ga0207671_1000207813 269
224 3300025940 Ga0207691_10437135 Ga0207691_104371352 269
225 3300026075 Ga0207708_10328170 Ga0207708_103281702 269
226 3300026078 Ga0207702_10413526 Ga0207702_104135262 269
227 3300026116 Ga0207674_10322328 Ga0207674_103223281 269
228 3300031731 Ga0307405_10010333 Ga0307405_100103333 269
229 3300031901 Ga0307406_10017630 Ga0307406_100176303 269
230 3300031995 Ga0307409_100364598 Ga0307409_1003645981 269
231 3300032005 Ga0307411_10513765 Ga0307411_105137652 269
232 3300042005 Ga0439448_0018857 Ga0439448_0018857_717_1526 269
233 3300045051 Ga0451576_0149798 Ga0451576_0149798_97_906 269
234 3300048909 Ga0496106_0102882 Ga0496106_0102882_1352_2161 269
235 3300048910 Ga0496107_0175725 Ga0496107_0175725_65_874 269
236 3300048911 Ga0496108_0044798 Ga0496108_0044798_929_1738 269
237 3300048912 Ga0496109_0211562 Ga0496109_0211562_24_833 269
238 3300048915 Ga0496112_0125123 Ga0496112_0125123_1666_2475 269
239 3300049521 Ga0501298_008607 Ga0501298_008607_49_858 269
240 3300049587 Ga0501071_0393967 Ga0501071_0393967_25_837 269
241 3300049649 Ga0501198_001215 Ga0501198_001215_1817_2626 269
242 3300049652 Ga0501202_002092 Ga0501202_002092_797_1606 269
243 3300049661 Ga0501217_001684 Ga0501217_001684_866_1675 269
244 3300049664 Ga0501224_008426 Ga0501224_008426_447_1256 269
245 3300049665 Ga0501227_007444 Ga0501227_007444_1477_2286 269
246 3300049667 Ga0501230_007792 Ga0501230_007792_644_1453 269
247 3300049682 Ga0501252_009007 Ga0501252_009007_107_916 269
248 3300049685 Ga0501256_000710 Ga0501256_000710_526_1335 269
249 3300049686 Ga0501257_004859 Ga0501257_004859_1587_2396 269
250 3300049688 Ga0501259_001350 Ga0501259_001350_2330_3139 269
251 3300049705 Ga0501225_0002845 Ga0501225_0002845_1913_2722 269
252 3300049741 Ga0501079_0159312 Ga0501079_0159312_489_1301 269
253 3300049765 Ga0501268_005901 Ga0501268_005901_580_1389 269
254 3300049853 Ga0501226_000729 Ga0501226_000729_1795_2604 269
255 3300050508 nmdc:mga09592_68998_c1 nmdc:mga09592_68998_c1_655_1509 269
256 3300050515 nmdc:mga0a205_44656_c1 nmdc:mga0a205_44656_c1_295_1104 269
257 3300005330 Ga0070690_100242248 Ga0070690_1002422482 270
258 3300005334 Ga0068869_100054607 Ga0068869_1000546073 270
259 3300005353 Ga0070669_100037609 Ga0070669_1000376093 270
260 3300005441 Ga0070700_100031802 Ga0070700_1000318021 270
261 3300005456 Ga0070678_100478441 Ga0070678_1004784412 270
262 3300005457 Ga0070662_100107868 Ga0070662_1001078683 270
263 3300005467 Ga0070706_100048895 Ga0070706_1000488953 270
264 3300005615 Ga0070702_100034498 Ga0070702_1000344982 270
265 3300005843 Ga0068860_100136675 Ga0068860_1001366752 270
266 3300006237 Ga0097621_100019873 Ga0097621_1000198733 270
267 3300013306 Ga0163162_10368941 Ga0163162_103689412 270
268 3300013308 Ga0157375_10081135 Ga0157375_100811352 270
269 3300014326 Ga0157380_10024015 Ga0157380_100240153 270
270 3300025925 Ga0207650_10126577 Ga0207650_101265773 270
271 3300025935 Ga0207709_10050976 Ga0207709_100509762 270
272 3300025981 Ga0207640_10079534 Ga0207640_100795343 270
273 3300026121 Ga0207683_10455563 Ga0207683_104555632 270
274 3300028380 Ga0268265_10447803 Ga0268265_104478032 270
275 3300028381 Ga0268264_10153363 Ga0268264_101533632 270
276 3300050515 nmdc:mga0a205_80497_c1 nmdc:mga0a205_80497_c1_1899_2711 270
277 3300031456 Ga0307513_10070074 Ga0307513_100700743 271
278 3300032126 Ga0307415_100610364 Ga0307415_1006103642 271
279 3300005518 Ga0070699_100140666 Ga0070699_1001406661 272
280 3300005536 Ga0070697_100072275 Ga0070697_1000722753 272
281 3300005985 Ga0081539_10001228 Ga0081539_100012283 272
282 3300013297 Ga0157378_10083411 Ga0157378_100834113 272
283 3300021384 Ga0213876_10000011 Ga0213876_10000011299 272
284 3300021384 Ga0213876_10000205 Ga0213876_1000020520 272
285 3300037418 Ga0395900_0220912 Ga0395900_0220912_284_1144 272
286 3300039437 Ga0436365_0141476 Ga0436365_0141476_26123_26965 272
287 3300039437 Ga0436365_0815906 Ga0436365_0815906_75455_76372 273
288 3300031901 Ga0307406_10099911 Ga0307406_100999111 274
289 3300032126 Ga0307415_100037339 Ga0307415_1000373395 274
290 3300009148 Ga0105243_10225729 Ga0105243_102257292 275
291 3300025942 Ga0207689_10153758 Ga0207689_101537582 275
292 3300048907 Ga0496104_0315850 Ga0496104_0315850_46_894 275
293 3300005467 Ga0070706_100001130 Ga0070706_1000011303 276
294 3300037418 Ga0395900_0283157 Ga0395900_0283157_163_1020 276
295 3300037418 Ga0395900_0308985 Ga0395900_0308985_255_1109 276
296 3300037471 Ga0395905_0009575 Ga0395905_0009575_7429_8283 276
297 3300037471 Ga0395905_0144279 Ga0395905_0144279_1211_2068 276
298 3300046615 Ga0495656_0161408 Ga0495656_0161408_19_849 276
299 3300005354 Ga0070675_100091621 Ga0070675_1000916212 277
300 3300005618 Ga0068864_100059848 Ga0068864_1000598482 277
301 3300005844 Ga0068862_100494740 Ga0068862_1004947402 277
302 3300014326 Ga0157380_10002482 Ga0157380_100024827 277
303 3300025907 Ga0207645_10087010 Ga0207645_100870101 277
304 3300025908 Ga0207643_10051295 Ga0207643_100512953 277
305 3300025926 Ga0207659_10095039 Ga0207659_100950392 277
306 3300025936 Ga0207670_10019486 Ga0207670_100194866 277
307 3300026118 Ga0207675_100906487 Ga0207675_1009064871 277
308 3300026121 Ga0207683_10050284 Ga0207683_100502842 277
309 3300031731 Ga0307405_10050791 Ga0307405_100507912 277
310 3300031901 Ga0307406_10036533 Ga0307406_100365333 277
311 3300032002 Ga0307416_100150727 Ga0307416_1001507272 277
312 3300032126 Ga0307415_100615930 Ga0307415_1006159301 277
313 3300035170 Ga0373943_0162698 Ga0373943_0162698_275_1114 277
314 3300046616 Ga0495668_0001666 Ga0495668_0001666_12145_12984 277
315 3300005293 Ga0065715_10090473 Ga0065715_100904735 278
316 3300005343 Ga0070687_100000435 Ga0070687_10000043511 278
317 3300005347 Ga0070668_100434318 Ga0070668_1004343182 278
318 3300005353 Ga0070669_100243791 Ga0070669_1002437912 278
319 3300005364 Ga0070673_100468022 Ga0070673_1004680221 278
320 3300005457 Ga0070662_100355101 Ga0070662_1003551011 278
321 3300005536 Ga0070697_100000207 Ga0070697_10000020719 278
322 3300005544 Ga0070686_100001725 Ga0070686_1000017258 278
323 3300005545 Ga0070695_100111263 Ga0070695_1001112632 278
324 3300005843 Ga0068860_100495905 Ga0068860_1004959051 278
325 3300009098 Ga0105245_10124994 Ga0105245_101249943 278
326 3300013297 Ga0157378_10010769 Ga0157378_100107696 278
327 3300017792 Ga0163161_10071194 Ga0163161_100711944 278
328 3300025918 Ga0207662_10001260 Ga0207662_100012608 278
329 3300025925 Ga0207650_10000001 Ga0207650_10000001622 278
330 3300026118 Ga0207675_100059296 Ga0207675_1000592962 278
331 3300028381 Ga0268264_10414670 Ga0268264_104146702 278
332 3300005364 Ga0070673_100001519 Ga0070673_1000015199 279
333 3300005536 Ga0070697_100052105 Ga0070697_1000521052 279
334 3300005578 Ga0068854_100124448 Ga0068854_1001244482 279
335 3300005718 Ga0068866_10001808 Ga0068866_100018086 279
336 3300005842 Ga0068858_100109131 Ga0068858_1001091312 279
337 3300009176 Ga0105242_10007397 Ga0105242_100073978 279
338 3300009176 Ga0105242_10230479 Ga0105242_102304792 279
339 3300013306 Ga0163162_10131619 Ga0163162_101316193 279
340 3300025899 Ga0207642_10131643 Ga0207642_101316432 279
341 3300025918 Ga0207662_10036633 Ga0207662_100366333 279
342 3300025934 Ga0207686_10000320 Ga0207686_1000032021 279
343 3300025960 Ga0207651_10001197 Ga0207651_100011977 279
344 3300005293 Ga0065715_10015244 Ga0065715_100152442 280
345 3300005330 Ga0070690_100082220 Ga0070690_1000822203 280
346 3300005364 Ga0070673_100288641 Ga0070673_1002886412 280
347 3300005444 Ga0070694_100085553 Ga0070694_1000855531 280
348 3300005471 Ga0070698_100063904 Ga0070698_1000639041 280
349 3300005539 Ga0068853_100308685 Ga0068853_1003086852 280
350 3300005615 Ga0070702_100018148 Ga0070702_1000181482 280
351 3300005719 Ga0068861_100376280 Ga0068861_1003762802 280
352 3300005841 Ga0068863_100254211 Ga0068863_1002542112 280
353 3300005842 Ga0068858_100128868 Ga0068858_1001288682 280
354 3300005985 Ga0081539_10038335 Ga0081539_100383352 280
355 3300006871 Ga0075434_100207304 Ga0075434_1002073041 280
356 3300006880 Ga0075429_100440229 Ga0075429_1004402292 280
357 3300009094 Ga0111539_10017280 Ga0111539_100172805 280
358 3300009147 Ga0114129_10024304 Ga0114129_100243047 280
359 3300009177 Ga0105248_10546137 Ga0105248_105461372 280
360 3300025941 Ga0207711_10030135 Ga0207711_100301354 280
361 3300025941 Ga0207711_10171890 Ga0207711_101718902 280
362 3300025942 Ga0207689_10028956 Ga0207689_100289563 280
363 3300026089 Ga0207648_10097905 Ga0207648_100979051 280
364 3300026095 Ga0207676_10639160 Ga0207676_106391601 280
365 3300026118 Ga0207675_100139401 Ga0207675_1001394011 280
366 3300028381 Ga0268264_10045940 Ga0268264_100459402 280
367 3300037068 Ga0373925_0206468 Ga0373925_0206468_494_1345 280
368 3300039453 Ga0436362_0292211 Ga0436362_0292211_153_1004 280
369 3300046517 Ga0495630_0309091 Ga0495630_0309091_143_994 280
370 3300047471 Ga0495684_0222900 Ga0495684_0222900_493_1344 280
371 3300050508 nmdc:mga09592_459883_c1 nmdc:mga09592_459883_c1_224_1066 280
372 3300005347 Ga0070668_100003879 Ga0070668_1000038799 281
373 3300005467 Ga0070706_100391253 Ga0070706_1003912532 281
374 3300005471 Ga0070698_100048160 Ga0070698_1000481603 281
375 3300005536 Ga0070697_100528478 Ga0070697_1005284781 281
376 3300005544 Ga0070686_100171123 Ga0070686_1001711232 281
377 3300005546 Ga0070696_100187691 Ga0070696_1001876912 281
378 3300005549 Ga0070704_100172597 Ga0070704_1001725971 281
379 3300005617 Ga0068859_100046516 Ga0068859_1000465164 281
380 3300005719 Ga0068861_100015521 Ga0068861_1000155213 281
381 3300006931 Ga0097620_100046515 Ga0097620_1000465154 281
382 3300009174 Ga0105241_10110305 Ga0105241_101103052 281
383 3300009176 Ga0105242_10265527 Ga0105242_102655272 281
384 3300009553 Ga0105249_10000052 Ga0105249_1000005257 281
385 3300013297 Ga0157378_10022019 Ga0157378_100220193 281
386 3300013306 Ga0163162_10000001 Ga0163162_10000001569 281
387 3300014326 Ga0157380_10001297 Ga0157380_100012977 281
388 3300014326 Ga0157380_10078016 Ga0157380_100780162 281
389 3300025961 Ga0207712_10000062 Ga0207712_1000006219 281
390 3300025972 Ga0207668_10002372 Ga0207668_100023721 281
391 3300025981 Ga0207640_10349310 Ga0207640_103493102 281
392 3300026118 Ga0207675_100026967 Ga0207675_1000269673 281
393 3300031731 Ga0307405_10163999 Ga0307405_101639992 281
394 3300031852 Ga0307410_10108724 Ga0307410_101087242 281
395 3300031995 Ga0307409_100084446 Ga0307409_1000844462 281
396 3300032004 Ga0307414_10078497 Ga0307414_100784972 281
397 3300032126 Ga0307415_100140541 Ga0307415_1001405412 281
398 3300039437 Ga0436365_1466764 Ga0436365_1466764_1524_2372 281
399 3300046519 Ga0495632_0004878 Ga0495632_0004878_2921_3775 281
400 3300048915 Ga0496112_0665435 Ga0496112_0665435_59_904 281
401 3300049519 Ga0501296_002588 Ga0501296_002588_799_1644 281
402 3300049521 Ga0501298_002419 Ga0501298_002419_1491_2336 281
403 3300049522 Ga0501299_003286 Ga0501299_003286_289_1134 281
404 3300049574 Ga0501038_0008718 Ga0501038_0008718_4138_4983 281
405 3300049663 Ga0501223_021985 Ga0501223_021985_307_1152 281
406 3300049666 Ga0501228_004038 Ga0501228_004038_262_1107 281
407 3300049677 Ga0501247_010392 Ga0501247_010392_193_1038 281
408 3300049705 Ga0501225_0021006 Ga0501225_0021006_100_945 281
409 3300053142 Ga0500577_0000980 Ga0500577_0000980_4555_5406 281
410 3300061734 Ga0530510_0014864 Ga0530510_0014864_743_1591 281
411 3300000532 CNAas_1001534 CNAas_10015342 282
412 3300003203 JGI25406J46586_10004357 JGI25406J46586_100043574 282
413 3300003203 JGI25406J46586_10005331 JGI25406J46586_100053315 282
414 3300003203 JGI25406J46586_10019649 JGI25406J46586_100196492 282
415 3300003203 JGI25406J46586_10039854 JGI25406J46586_100398542 282
416 3300005293 Ga0065715_10134200 Ga0065715_101342002 282
417 3300005331 Ga0070670_100041661 Ga0070670_1000416612 282
418 3300005340 Ga0070689_100002248 Ga0070689_1000022484 282
419 3300005440 Ga0070705_100009694 Ga0070705_1000096943 282
420 3300005440 Ga0070705_100065004 Ga0070705_1000650042 282
421 3300005458 Ga0070681_10000997 Ga0070681_100009973 282
422 3300005458 Ga0070681_10009358 Ga0070681_100093583 282
423 3300005458 Ga0070681_10093220 Ga0070681_100932203 282
424 3300005467 Ga0070706_100516577 Ga0070706_1005165771 282
425 3300005468 Ga0070707_100036706 Ga0070707_1000367062 282
426 3300005471 Ga0070698_100088025 Ga0070698_1000880253 282
427 3300005530 Ga0070679_100000972 Ga0070679_1000009723 282
428 3300005536 Ga0070697_100241064 Ga0070697_1002410641 282
429 3300005545 Ga0070695_100015718 Ga0070695_1000157184 282
430 3300005545 Ga0070695_100362717 Ga0070695_1003627172 282
431 3300005547 Ga0070693_100150699 Ga0070693_1001506991 282
432 3300005547 Ga0070693_100157540 Ga0070693_1001575401 282
433 3300005549 Ga0070704_100098691 Ga0070704_1000986913 282
434 3300005564 Ga0070664_100221220 Ga0070664_1002212202 282
435 3300005617 Ga0068859_100141953 Ga0068859_1001419532 282
436 3300005617 Ga0068859_100250243 Ga0068859_1002502432 282
437 3300005617 Ga0068859_100374917 Ga0068859_1003749172 282
438 3300005840 Ga0068870_10025568 Ga0068870_100255682 282
439 3300005841 Ga0068863_100006594 Ga0068863_1000065947 282
440 3300005985 Ga0081539_10000600 Ga0081539_1000060041 282
441 3300005985 Ga0081539_10001856 Ga0081539_100018563 282
442 3300005985 Ga0081539_10004100 Ga0081539_100041003 282
443 3300006852 Ga0075433_10061280 Ga0075433_100612803 282
444 3300006852 Ga0075433_10080955 Ga0075433_100809553 282
445 3300006871 Ga0075434_100153906 Ga0075434_1001539061 282
446 3300006931 Ga0097620_100141955 Ga0097620_1001419552 282
447 3300006931 Ga0097620_100250248 Ga0097620_1002502482 282
448 3300006931 Ga0097620_100374937 Ga0097620_1003749372 282
449 3300009093 Ga0105240_10490529 Ga0105240_104905292 282
450 3300009553 Ga0105249_10078821 Ga0105249_100788213 282
451 3300010375 Ga0105239_10273726 Ga0105239_102737261 282
452 3300013307 Ga0157372_10009277 Ga0157372_100092772 282
453 3300013307 Ga0157372_10447392 Ga0157372_104473922 282
454 3300025908 Ga0207643_10001960 Ga0207643_100019607 282
455 3300025910 Ga0207684_10112017 Ga0207684_101120173 282
456 3300025912 Ga0207707_10000072 Ga0207707_1000007276 282
457 3300025912 Ga0207707_10198850 Ga0207707_101988502 282
458 3300025917 Ga0207660_10001509 Ga0207660_1000150913 282
459 3300025917 Ga0207660_10393862 Ga0207660_103938622 282
460 3300025918 Ga0207662_10251654 Ga0207662_102516542 282
461 3300025921 Ga0207652_10000083 Ga0207652_100000833 282
462 3300025932 Ga0207690_10172881 Ga0207690_101728811 282
463 3300025936 Ga0207670_10000533 Ga0207670_100005337 282
464 3300025936 Ga0207670_10228310 Ga0207670_102283101 282
465 3300025945 Ga0207679_10491790 Ga0207679_104917902 282
466 3300025949 Ga0207667_10143720 Ga0207667_101437203 282
467 3300025961 Ga0207712_10031895 Ga0207712_100318954 282
468 3300025981 Ga0207640_10141465 Ga0207640_101414652 282
469 3300026035 Ga0207703_10471266 Ga0207703_104712662 282
470 3300026088 Ga0207641_10048368 Ga0207641_100483682 282
471 3300026095 Ga0207676_10554246 Ga0207676_105542462 282
472 3300026116 Ga0207674_10027665 Ga0207674_100276655 282
473 3300026116 Ga0207674_10460435 Ga0207674_104604351 282
474 3300026118 Ga0207675_100214924 Ga0207675_1002149242 282
475 3300028381 Ga0268264_10443776 Ga0268264_104437762 282
476 3300031456 Ga0307513_10015443 Ga0307513_100154433 282
477 3300032002 Ga0307416_100014278 Ga0307416_1000142782 282
478 3300032126 Ga0307415_100022212 Ga0307415_1000222122 282
479 3300037466 Ga0395898_0552172 Ga0395898_0552172_123_971 282
480 3300038996 Ga0242420_016540 Ga0242420_016540_349_1200 282
481 3300048905 Ga0496102_0078100 Ga0496102_0078100_2142_2993 282
482 3300048907 Ga0496104_0066645 Ga0496104_0066645_1940_2788 282
483 3300048915 Ga0496112_0106364 Ga0496112_0106364_1640_2488 282
484 3300049514 Ga0501291_001835 Ga0501291_001835_1293_2144 282
485 3300049515 Ga0501292_003256 Ga0501292_003256_642_1493 282
486 3300049521 Ga0501298_000628 Ga0501298_000628_1899_2750 282
487 3300049661 Ga0501217_021751 Ga0501217_021751_233_1084 282
488 3300049663 Ga0501223_019234 Ga0501223_019234_383_1231 282
489 3300049668 Ga0501233_026703 Ga0501233_026703_287_1138 282
490 3300049669 Ga0501235_021292 Ga0501235_021292_518_1369 282
491 3300049673 Ga0501240_019923 Ga0501240_019923_48_896 282
492 3300049705 Ga0501225_0019310 Ga0501225_0019310_847_1695 282
493 3300049707 Ga0501234_000566 Ga0501234_000566_4746_5597 282
494 3300049767 Ga0501270_009447 Ga0501270_009447_283_1134 282
495 3300050511 nmdc:mga08y16_117115_c1 nmdc:mga08y16_117115_c1_361_1209 282
496 3300050513 nmdc:mga0rr50_486582_c1 nmdc:mga0rr50_486582_c1_124_975 282
497 3300050515 nmdc:mga0a205_13699_c1 nmdc:mga0a205_13699_c1_1209_2060 282
498 3300005335 Ga0070666_10162921 Ga0070666_101629212 283
499 3300005338 Ga0068868_100366170 Ga0068868_1003661702 283
500 3300005340 Ga0070689_100156334 Ga0070689_1001563342 283
501 3300005367 Ga0070667_100014860 Ga0070667_1000148605 283
502 3300005444 Ga0070694_100289189 Ga0070694_1002891891 283
503 3300005459 Ga0068867_100101667 Ga0068867_1001016672 283
504 3300005468 Ga0070707_100206991 Ga0070707_1002069913 283
505 3300005471 Ga0070698_100001364 Ga0070698_1000013648 283
506 3300005546 Ga0070696_100346080 Ga0070696_1003460801 283
507 3300005547 Ga0070693_100010817 Ga0070693_1000108172 283
508 3300005548 Ga0070665_100061783 Ga0070665_1000617832 283
509 3300005564 Ga0070664_100120379 Ga0070664_1001203792 283
510 3300005578 Ga0068854_100022075 Ga0068854_1000220754 283
511 3300005615 Ga0070702_100059996 Ga0070702_1000599962 283
512 3300005616 Ga0068852_100078596 Ga0068852_1000785963 283
513 3300005841 Ga0068863_100207417 Ga0068863_1002074172 283
514 3300005843 Ga0068860_100031040 Ga0068860_1000310404 283
515 3300006237 Ga0097621_100039228 Ga0097621_1000392283 283
516 3300007076 Ga0075435_100000553 Ga0075435_10000055319 283
517 3300009174 Ga0105241_10016414 Ga0105241_100164143 283
518 3300009176 Ga0105242_10026829 Ga0105242_100268293 283
519 3300009553 Ga0105249_10482831 Ga0105249_104828312 283
520 3300013296 Ga0157374_10035834 Ga0157374_100358342 283
521 3300013297 Ga0157378_10002174 Ga0157378_1000217413 283
522 3300014325 Ga0163163_10041058 Ga0163163_100410583 283
523 3300025922 Ga0207646_10099734 Ga0207646_100997342 283
524 3300025926 Ga0207659_10029772 Ga0207659_100297723 283
525 3300025942 Ga0207689_10030940 Ga0207689_100309403 283
526 3300025942 Ga0207689_10142966 Ga0207689_101429663 283
527 3300025945 Ga0207679_10124446 Ga0207679_101244462 283
528 3300025961 Ga0207712_10436096 Ga0207712_104360961 283
529 3300026035 Ga0207703_10025488 Ga0207703_100254884 283
530 3300026075 Ga0207708_10049076 Ga0207708_100490762 283
531 3300026095 Ga0207676_10003857 Ga0207676_100038575 283
532 3300028379 Ga0268266_10083041 Ga0268266_100830412 283
533 3300028381 Ga0268264_10153869 Ga0268264_101538692 283
534 3300031731 Ga0307405_10220926 Ga0307405_102209262 283
535 3300036401 Ga0373937_0095390 Ga0373937_0095390_589_1440 283
536 3300048907 Ga0496104_0089274 Ga0496104_0089274_829_1680 283
537 3300048907 Ga0496104_0251798 Ga0496104_0251798_75_926 283
538 3300049824 Ga0501045_0287810 Ga0501045_0287810_213_1067 283
539 3300050514 nmdc:mga08x19_29_c1 nmdc:mga08x19_29_c1_6754_7614 283
540 3300005330 Ga0070690_100008632 Ga0070690_1000086323 284
541 3300005334 Ga0068869_100065121 Ga0068869_1000651212 284
542 3300005340 Ga0070689_100065268 Ga0070689_1000652682 284
543 3300005353 Ga0070669_100001639 Ga0070669_1000016394 284
544 3300005353 Ga0070669_100083393 Ga0070669_1000833932 284
545 3300005354 Ga0070675_100037129 Ga0070675_1000371292 284
546 3300005355 Ga0070671_100119617 Ga0070671_1001196172 284
547 3300005364 Ga0070673_100025218 Ga0070673_1000252182 284
548 3300005440 Ga0070705_100056941 Ga0070705_1000569412 284
549 3300005441 Ga0070700_100080305 Ga0070700_1000803052 284
550 3300005444 Ga0070694_100225091 Ga0070694_1002250912 284
551 3300005445 Ga0070708_100144676 Ga0070708_1001446762 284
552 3300005456 Ga0070678_100015951 Ga0070678_1000159513 284
553 3300005459 Ga0068867_100483280 Ga0068867_1004832802 284
554 3300005467 Ga0070706_100000500 Ga0070706_10000050038 284
555 3300005468 Ga0070707_100000313 Ga0070707_1000003133 284
556 3300005468 Ga0070707_100014326 Ga0070707_1000143265 284
557 3300005468 Ga0070707_100389247 Ga0070707_1003892472 284
558 3300005468 Ga0070707_100442466 Ga0070707_1004424661 284
559 3300005471 Ga0070698_100044321 Ga0070698_1000443214 284
560 3300005471 Ga0070698_100411449 Ga0070698_1004114492 284
561 3300005518 Ga0070699_100353059 Ga0070699_1003530592 284
562 3300005518 Ga0070699_100558187 Ga0070699_1005581871 284
563 3300005536 Ga0070697_100012185 Ga0070697_1000121852 284
564 3300005536 Ga0070697_100029814 Ga0070697_1000298144 284
565 3300005543 Ga0070672_100004840 Ga0070672_1000048403 284
566 3300005546 Ga0070696_100031815 Ga0070696_1000318152 284
567 3300005549 Ga0070704_100028073 Ga0070704_1000280733 284
568 3300005549 Ga0070704_100267098 Ga0070704_1002670982 284
569 3300005564 Ga0070664_100081681 Ga0070664_1000816812 284
570 3300005615 Ga0070702_100004186 Ga0070702_1000041863 284
571 3300005616 Ga0068852_100210342 Ga0068852_1002103422 284
572 3300005718 Ga0068866_10007827 Ga0068866_100078274 284
573 3300005719 Ga0068861_100052309 Ga0068861_1000523092 284
574 3300005841 Ga0068863_100038012 Ga0068863_1000380123 284
575 3300005843 Ga0068860_100021045 Ga0068860_1000210452 284
576 3300005844 Ga0068862_100004475 Ga0068862_1000044757 284
577 3300006163 Ga0070715_10000057 Ga0070715_100000573 284
578 3300006237 Ga0097621_100028707 Ga0097621_1000287074 284
579 3300006358 Ga0068871_100175095 Ga0068871_1001750952 284
580 3300006844 Ga0075428_100715947 Ga0075428_1007159472 284
581 3300006881 Ga0068865_100022500 Ga0068865_1000225004 284
582 3300006914 Ga0075436_100080668 Ga0075436_1000806682 284
583 3300009094 Ga0111539_10067238 Ga0111539_100672384 284
584 3300009094 Ga0111539_10891048 Ga0111539_108910481 284
585 3300009147 Ga0114129_10013019 Ga0114129_100130199 284
586 3300009148 Ga0105243_10033416 Ga0105243_100334164 284
587 3300009148 Ga0105243_10066674 Ga0105243_100666743 284
588 3300009176 Ga0105242_10024809 Ga0105242_100248093 284
589 3300009177 Ga0105248_10157796 Ga0105248_101577962 284
590 3300009553 Ga0105249_10027767 Ga0105249_100277673 284
591 3300013297 Ga0157378_10010686 Ga0157378_100106863 284
592 3300014326 Ga0157380_10010906 Ga0157380_100109062 284
593 3300014326 Ga0157380_10067960 Ga0157380_100679602 284
594 3300025905 Ga0207685_10000024 Ga0207685_1000002470 284
595 3300025907 Ga0207645_10203468 Ga0207645_102034681 284
596 3300025908 Ga0207643_10024585 Ga0207643_100245853 284
597 3300025910 Ga0207684_10009372 Ga0207684_100093721 284
598 3300025910 Ga0207684_10384147 Ga0207684_103841472 284
599 3300025917 Ga0207660_10196020 Ga0207660_101960201 284
600 3300025918 Ga0207662_10004086 Ga0207662_100040865 284
601 3300025922 Ga0207646_10000988 Ga0207646_1000098829 284
602 3300025922 Ga0207646_10170630 Ga0207646_101706302 284
603 3300025922 Ga0207646_10255758 Ga0207646_102557582 284
604 3300025923 Ga0207681_10098818 Ga0207681_100988181 284
605 3300025926 Ga0207659_10149891 Ga0207659_101498912 284
606 3300025927 Ga0207687_10171883 Ga0207687_101718832 284
607 3300025931 Ga0207644_10074505 Ga0207644_100745052 284
608 3300025935 Ga0207709_10080494 Ga0207709_100804942 284
609 3300025936 Ga0207670_10390644 Ga0207670_103906441 284
610 3300025939 Ga0207665_10000297 Ga0207665_1000029729 284
611 3300025940 Ga0207691_10032858 Ga0207691_100328583 284
612 3300025941 Ga0207711_10324513 Ga0207711_103245132 284
613 3300025942 Ga0207689_10000667 Ga0207689_1000066728 284
614 3300025942 Ga0207689_10068685 Ga0207689_100686853 284
615 3300025981 Ga0207640_10133958 Ga0207640_101339581 284
616 3300025986 Ga0207658_10033902 Ga0207658_100339022 284
617 3300026023 Ga0207677_10246858 Ga0207677_102468581 284
618 3300026075 Ga0207708_10003423 Ga0207708_100034238 284
619 3300026075 Ga0207708_10185215 Ga0207708_101852152 284
620 3300026089 Ga0207648_10051326 Ga0207648_100513262 284
621 3300026089 Ga0207648_10156575 Ga0207648_101565752 284
622 3300026118 Ga0207675_100085162 Ga0207675_1000851622 284
623 3300026118 Ga0207675_100654540 Ga0207675_1006545401 284
624 3300026121 Ga0207683_10029817 Ga0207683_100298173 284
625 3300026142 Ga0207698_10056181 Ga0207698_100561812 284
626 3300028380 Ga0268265_10031265 Ga0268265_100312654 284
627 3300028380 Ga0268265_10293513 Ga0268265_102935132 284
628 3300028381 Ga0268264_10094454 Ga0268264_100944542 284
629 3300050511 nmdc:mga08y16_61428_c1 nmdc:mga08y16_61428_c1_639_1505 284
630 3300050514 nmdc:mga08x19_160775_c1 nmdc:mga08x19_160775_c1_148_1011 284
631 3300005544 Ga0070686_100008085 Ga0070686_1000080852 285
632 3300005618 Ga0068864_100236991 Ga0068864_1002369912 285
633 3300026116 Ga0207674_10625258 Ga0207674_106252581 285
634 3300031548 Ga0307408_100301813 Ga0307408_1003018131 285
635 2162886007 SwRhRL2b_contig_2012073 SwRhRL2b_0747.00001150 286
636 3300005289 Ga0065704_10085496 Ga0065704_100854962 286
637 3300005293 Ga0065715_10112922 Ga0065715_101129222 286
638 3300005295 Ga0065707_10002276 Ga0065707_100022764 286
639 3300005331 Ga0070670_100001635 Ga0070670_10000163510 286
640 3300005334 Ga0068869_100015880 Ga0068869_1000158803 286
641 3300005337 Ga0070682_100000051 Ga0070682_1000000512 286
642 3300005340 Ga0070689_100032635 Ga0070689_1000326352 286
643 3300005353 Ga0070669_100028263 Ga0070669_1000282634 286
644 3300005440 Ga0070705_100059187 Ga0070705_1000591872 286
645 3300005444 Ga0070694_100003363 Ga0070694_1000033636 286
646 3300005444 Ga0070694_100090748 Ga0070694_1000907481 286
647 3300005445 Ga0070708_100024781 Ga0070708_1000247813 286
648 3300005459 Ga0068867_100392918 Ga0068867_1003929181 286
649 3300005467 Ga0070706_100001730 Ga0070706_1000017309 286
650 3300005471 Ga0070698_100054231 Ga0070698_1000542312 286
651 3300005471 Ga0070698_100303316 Ga0070698_1003033162 286
652 3300005518 Ga0070699_100060444 Ga0070699_1000604443 286
653 3300005536 Ga0070697_100000330 Ga0070697_10000033018 286
654 3300005536 Ga0070697_100036543 Ga0070697_1000365433 286
655 3300005545 Ga0070695_100139309 Ga0070695_1001393092 286
656 3300005546 Ga0070696_100018252 Ga0070696_1000182523 286
657 3300005546 Ga0070696_100122661 Ga0070696_1001226612 286
658 3300005618 Ga0068864_100294509 Ga0068864_1002945092 286
659 3300005719 Ga0068861_100021042 Ga0068861_1000210425 286
660 3300009098 Ga0105245_10405976 Ga0105245_104059761 286
661 3300009148 Ga0105243_10078790 Ga0105243_100787903 286
662 3300009148 Ga0105243_10103682 Ga0105243_101036822 286
663 3300009148 Ga0105243_10299556 Ga0105243_102995562 286
664 3300009176 Ga0105242_10240253 Ga0105242_102402532 286
665 3300009176 Ga0105242_10263285 Ga0105242_102632852 286
666 3300009553 Ga0105249_10070975 Ga0105249_100709752 286
667 3300011119 Ga0105246_10191353 Ga0105246_101913532 286
668 3300013297 Ga0157378_10166914 Ga0157378_101669142 286
669 3300013297 Ga0157378_10660554 Ga0157378_106605542 286
670 3300013306 Ga0163162_10014408 Ga0163162_100144088 286
671 3300013306 Ga0163162_10396276 Ga0163162_103962761 286
672 3300025922 Ga0207646_10108839 Ga0207646_101088392 286
673 3300025923 Ga0207681_10019404 Ga0207681_100194042 286
674 3300025923 Ga0207681_10226592 Ga0207681_102265922 286
675 3300025925 Ga0207650_10001812 Ga0207650_100018123 286
676 3300025925 Ga0207650_10284894 Ga0207650_102848941 286
677 3300025927 Ga0207687_10224305 Ga0207687_102243052 286
678 3300025933 Ga0207706_10187128 Ga0207706_101871282 286
679 3300025935 Ga0207709_10260534 Ga0207709_102605342 286
680 3300025936 Ga0207670_10168431 Ga0207670_101684312 286
681 3300025960 Ga0207651_10182498 Ga0207651_101824982 286
682 3300025961 Ga0207712_10352380 Ga0207712_103523802 286
683 3300025981 Ga0207640_10323359 Ga0207640_103233591 286
684 3300026023 Ga0207677_10153953 Ga0207677_101539532 286
685 3300026075 Ga0207708_10179336 Ga0207708_101793362 286
686 3300026089 Ga0207648_10232385 Ga0207648_102323851 286
687 3300026118 Ga0207675_100265036 Ga0207675_1002650362 286
688 3300028380 Ga0268265_10013648 Ga0268265_100136484 286
689 3300031456 Ga0307513_10407276 Ga0307513_104072761 286
690 3300032002 Ga0307416_100553229 Ga0307416_1005532291 286
691 3300032126 Ga0307415_100432512 Ga0307415_1004325121 286
692 3300038443 Ga0395901_0467537 Ga0395901_0467537_22_882 286
693 3300045051 Ga0451576_0276417 Ga0451576_0276417_715_1575 286
694 3300046539 Ga0495621_0002052 Ga0495621_0002052_3908_4768 286
695 3300047318 Ga0495636_0039488 Ga0495636_0039488_22_882 286
696 3300047320 Ga0495672_0019032 Ga0495672_0019032_3209_4069 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02457

DAC

DisA bacterial checkpoint controller nucleotide-binding

139

258

0.97

Feature Viewer

pLDDT pTM Quality
58.59 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map