F475763
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 557 | 366 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300053178|Ga0500637_0009988|Ga0500637_0009988_1639_2601 |
| Length | 320 |
| Sequence | MPSPIDLLPPLREVIAKHDLLARKSLGQHFLCDLNLTRKIASLAGDLTDCTAFEIGPGPGGLTRALVETDAKKIIAIEKDRRCIAALKDVIEASEGRLEVIEGDALKIDLIPLARSLPLTRRADARHPLPPAGGEGTQEKPLALQSREREGPVAKQREGEGQYAVVANLPYNIGTELLLGWLETIDEYKSLTLMFQAEVADRLAAEPDSKTYGRLSVITQFCCDIERVLDIPARAFTPPPKVDSAVVHLTPRKNRPKDVSFKMMGRVTAAAFGQRRKMLRSSLKPLGGEELLKRAGIKPELRAENLSVADFENLARKFGM |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 9 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 10 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 11 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 12 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 13 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 14 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 15 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 16 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 17 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 18 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 19 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 20 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 21 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 22 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 23 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 24 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 25 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 26 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 27 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 28 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 29 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 30 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 31 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 32 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 33 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 34 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 35 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 36 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 37 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 38 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 39 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 40 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 41 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 42 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 43 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 44 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 45 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 46 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 47 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 48 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 49 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 50 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 51 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 52 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 53 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 54 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 55 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 56 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 57 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 58 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 59 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 60 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 61 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 62 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 63 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 64 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 65 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 66 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 67 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 68 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 69 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 70 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 71 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 72 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 73 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 74 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 75 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 76 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 77 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 78 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 79 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 80 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 81 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 82 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 83 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 84 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 85 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 86 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 87 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 88 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 89 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 90 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 91 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 92 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 93 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 94 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 95 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 96 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 97 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 98 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 99 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 100 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 101 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 102 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 103 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 104 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 105 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 106 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 107 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 108 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 109 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 110 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 111 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 112 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 113 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 114 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 115 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 116 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 117 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 118 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 119 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 120 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 121 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 122 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 123 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 124 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 125 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 126 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 127 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 128 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 129 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 130 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 131 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 132 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 133 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 134 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 135 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 136 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 137 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 138 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 139 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 140 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 141 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 142 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 143 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 144 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 145 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 146 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 147 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 148 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 149 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 150 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 151 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 152 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 153 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 154 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 155 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 156 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 157 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 158 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 159 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 160 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 161 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 162 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 163 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 164 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 165 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 166 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 167 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 168 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 169 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 170 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 171 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 172 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 173 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 174 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 175 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 176 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 177 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 178 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 179 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 180 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 181 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 182 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 183 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 184 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 185 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 186 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 187 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 188 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 189 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 190 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 191 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 192 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 193 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 194 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 195 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 196 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 197 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 198 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 199 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 200 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 201 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 202 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 203 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 204 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 205 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 206 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 207 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 208 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 209 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 210 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 211 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 212 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 213 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 214 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 215 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 216 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 217 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 218 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 219 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 220 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 221 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 222 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 223 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 224 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 225 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 226 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 227 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 228 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 229 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 230 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 231 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 232 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 233 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 234 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 235 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 236 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 237 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 238 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 239 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 240 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 241 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 242 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 243 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 244 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 245 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 246 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 247 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 248 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 249 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 250 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 251 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 252 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 253 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 254 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 255 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 256 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 257 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 258 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 259 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 260 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 261 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 262 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 263 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 264 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 265 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 266 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 267 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 268 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 269 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 270 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 271 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 272 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 273 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 274 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 275 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 276 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 277 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 278 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 279 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 280 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 281 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 282 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 283 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 284 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 285 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 286 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 287 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 288 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 289 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 290 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 291 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 292 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 293 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 294 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 295 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 296 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 297 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 298 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 299 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 300 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 301 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 302 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 303 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 304 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 305 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 306 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 307 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 308 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 309 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 310 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 311 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 312 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 313 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 314 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 315 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 316 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 317 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 318 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 319 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 320 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 321 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 322 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 323 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 324 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 325 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 326 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 327 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 328 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 329 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 330 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 331 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 332 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 333 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 335 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 336 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 337 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 338 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 339 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 340 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 341 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 342 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 343 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 344 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 345 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 346 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 347 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 348 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 349 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 350 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 351 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 352 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 353 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 354 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 355 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 356 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 357 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 358 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 359 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 360 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 361 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 362 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 363 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 364 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 365 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 368 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 369 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 370 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 371 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 372 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 373 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 374 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 375 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 376 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 377 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 378 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 379 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 380 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 381 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 382 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 383 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 384 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 385 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 386 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 387 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 388 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 389 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 390 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 391 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 392 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 393 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 394 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 395 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 396 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 397 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 398 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 399 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 400 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 401 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 420 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 422 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 424 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 428 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 429 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 430 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 431 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 432 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 433 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 434 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 435 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 436 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 437 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 438 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 439 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 440 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 441 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 442 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 443 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 444 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 445 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 446 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 447 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 448 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 449 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 450 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 451 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 452 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 453 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 454 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 455 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 475 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 476 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 477 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 478 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 479 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 480 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 481 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 482 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 483 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 484 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 485 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 486 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 487 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 488 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 489 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 490 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 491 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 492 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 493 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 494 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 495 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 496 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 498 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 499 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 500 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 501 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 502 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 503 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 504 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 505 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 506 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 507 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 509 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 510 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 511 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 512 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 513 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 514 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 515 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 516 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 517 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 518 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 519 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 520 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 521 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 523 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 524 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 525 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 526 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 527 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 528 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 529 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 530 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 531 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 532 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 533 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 534 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 535 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 536 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 537 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 538 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 539 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 540 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 541 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 542 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 543 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 544 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 545 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 546 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 547 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 548 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 549 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 550 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 551 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 552 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 553 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 554 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 555 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 556 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 557 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 52.74 |
| Metatranscriptomes | 0 |
| Isolates | 47.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.24 |
| Nodule | 35.45 |
| Rhizoplane | 2.45 |
| Rhizosphere | 32.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001214 | 3300001979 | Bacteria | 11651 |
| 2 | JGI24740J21852_10004386 | 3300001979 | Bacteria | 6067 |
| 3 | JGI24740J21852_10052704 | 3300001979 | Bacteria | 1157 |
| 4 | JGI25155J39150_1000032 | 3300002704 | Bacteria | 105511 |
| 5 | JGI25156J39149_1000129 | 3300002705 | Bacteria | 54812 |
| 6 | JGI25162J39368_1000676 | 3300002737 | Bacteria | 23903 |
| 7 | JGI25162J39368_1001230 | 3300002737 | Bacteria | 14797 |
| 8 | JGI25154J39366_1000324 | 3300002738 | Bacteria | 27739 |
| 9 | JGI25154J39366_1001340 | 3300002738 | Bacteria | 9024 |
| 10 | JGI25157J39369_1000061 | 3300002741 | Bacteria | 105511 |
| 11 | JGI25151J46595_10000192 | 3300003187 | Bacteria | 75239 |
| 12 | JGI25406J46586_10006486 | 3300003203 | Bacteria | 5384 |
| 13 | JGI25165J46597_1000028 | 3300003214 | Bacteria | 325146 |
| 14 | JGI25165J46597_1001649 | 3300003214 | Bacteria | 10326 |
| 15 | JGI25165J46597_1001657 | 3300003214 | Bacteria | 10216 |
| 16 | JGI25153J46596_10016299 | 3300003215 | Bacteria | 2984 |
| 17 | rootH1_10095545 | 3300003323 | Bacteria | 1152 |
| 18 | Ga0055542_1001417 | 3300003762 | Bacteria | 12078 |
| 19 | Ga0055536_1001177 | 3300003781 | Bacteria | 16274 |
| 20 | Ga0055540_1001974 | 3300003792 | Bacteria | 11464 |
| 21 | Ga0055531_10003014 | 3300003794 | Bacteria | 10927 |
| 22 | Ga0058692_1001868 | 3300003856 | Bacteria | 7390 |
| 23 | Ga0065165_1002531 | 3300005262 | Bacteria | 15197 |
| 24 | Ga0070683_100183995 | 3300005329 | Bacteria | 1983 |
| 25 | Ga0070670_100001700 | 3300005331 | Bacteria | 17910 |
| 26 | Ga0070670_100080028 | 3300005331 | Bacteria | 2808 |
| 27 | Ga0068869_100052973 | 3300005334 | Bacteria | 2948 |
| 28 | Ga0070680_100172908 | 3300005336 | Bacteria | 1818 |
| 29 | Ga0070660_100019894 | 3300005339 | Bacteria | 4925 |
| 30 | Ga0070660_100474035 | 3300005339 | Bacteria | 1040 |
| 31 | Ga0070661_100159659 | 3300005344 | Bacteria | 1707 |
| 32 | Ga0070668_100008467 | 3300005347 | Bacteria | 7639 |
| 33 | Ga0070669_100046389 | 3300005353 | Bacteria | 3169 |
| 34 | Ga0070675_100093086 | 3300005354 | Bacteria | 2528 |
| 35 | Ga0070674_100006650 | 3300005356 | Bacteria | 6760 |
| 36 | Ga0070667_100023391 | 3300005367 | Bacteria | 5126 |
| 37 | Ga0070681_10006925 | 3300005458 | Bacteria | 11038 |
| 38 | Ga0070681_10007314 | 3300005458 | Bacteria | 10782 |
| 39 | Ga0068867_100138010 | 3300005459 | Bacteria | 1903 |
| 40 | Ga0068867_100181272 | 3300005459 | Bacteria | 1675 |
| 41 | Ga0068853_100256899 | 3300005539 | Bacteria | 1605 |
| 42 | Ga0068853_100314655 | 3300005539 | Bacteria | 1450 |
| 43 | Ga0070672_100083788 | 3300005543 | Bacteria | 2559 |
| 44 | Ga0070696_100057745 | 3300005546 | Bacteria | 2709 |
| 45 | Ga0070665_100029356 | 3300005548 | Bacteria | 5536 |
| 46 | Ga0068855_100029275 | 3300005563 | Bacteria | 6586 |
| 47 | Ga0068855_100514237 | 3300005563 | Bacteria | 1300 |
| 48 | Ga0068856_100241901 | 3300005614 | Bacteria | 1820 |
| 49 | Ga0068856_100278244 | 3300005614 | Bacteria | 1690 |
| 50 | Ga0068852_100065931 | 3300005616 | Bacteria | 3160 |
| 51 | Ga0068852_100089570 | 3300005616 | Bacteria | 2750 |
| 52 | Ga0068864_100101980 | 3300005618 | Bacteria | 2546 |
| 53 | Ga0068861_100395306 | 3300005719 | Bacteria | 1225 |
| 54 | Ga0068860_100035203 | 3300005843 | Bacteria | 4804 |
| 55 | Ga0068862_100007560 | 3300005844 | Bacteria | 9007 |
| 56 | Ga0068862_100026297 | 3300005844 | Bacteria | 4891 |
| 57 | Ga0081539_10001131 | 3300005985 | Bacteria | 48406 |
| 58 | Ga0075365_10005167 | 3300006038 | Bacteria | 7016 |
| 59 | Ga0075368_10023034 | 3300006042 | Bacteria | 2375 |
| 60 | Ga0075363_100022794 | 3300006048 | Bacteria | 3168 |
| 61 | Ga0075363_100290793 | 3300006048 | Bacteria | 947 |
| 62 | Ga0075364_10003667 | 3300006051 | Bacteria | 8756 |
| 63 | Ga0075364_10025065 | 3300006051 | Bacteria | 3794 |
| 64 | Ga0075364_10066637 | 3300006051 | Bacteria | 2365 |
| 65 | Ga0075364_10238721 | 3300006051 | Bacteria | 1234 |
| 66 | Ga0075367_10034225 | 3300006178 | Bacteria | 2933 |
| 67 | Ga0075367_10051599 | 3300006178 | Bacteria | 2431 |
| 68 | Ga0075367_10067879 | 3300006178 | Bacteria | 2138 |
| 69 | Ga0075367_10110435 | 3300006178 | Bacteria | 1687 |
| 70 | Ga0075369_10074628 | 3300006186 | Bacteria | 1496 |
| 71 | Ga0075369_10175854 | 3300006186 | Bacteria | 984 |
| 72 | Ga0075370_10025852 | 3300006353 | Bacteria | 3249 |
| 73 | Ga0075370_10097326 | 3300006353 | Bacteria | 1701 |
| 74 | Ga0075428_100416352 | 3300006844 | Bacteria | 1440 |
| 75 | Ga0075430_100183521 | 3300006846 | Bacteria | 1740 |
| 76 | Ga0075430_100185697 | 3300006846 | Bacteria | 1729 |
| 77 | Ga0075431_100206251 | 3300006847 | Bacteria | 2009 |
| 78 | Ga0075433_10252023 | 3300006852 | Bacteria | 1566 |
| 79 | Ga0075429_100560990 | 3300006880 | Bacteria | 1001 |
| 80 | Ga0079104_1000032 | 3300006946 | Bacteria | 203094 |
| 81 | Ga0099826_10001725 | 3300006948 | Bacteria | 13474 |
| 82 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 83 | Ga0105240_10013259 | 3300009093 | Bacteria | 11335 |
| 84 | Ga0105240_10142359 | 3300009093 | Bacteria | 2866 |
| 85 | Ga0105240_10250849 | 3300009093 | Bacteria | 2047 |
| 86 | Ga0111539_10119641 | 3300009094 | Bacteria | 3086 |
| 87 | Ga0114129_10312268 | 3300009147 | Unclassified | 2092 |
| 88 | Ga0105241_10093597 | 3300009174 | Bacteria | 2375 |
| 89 | Ga0105241_10476011 | 3300009174 | Bacteria | 1109 |
| 90 | Ga0105242_10546590 | 3300009176 | Bacteria | 1110 |
| 91 | Ga0105248_10360355 | 3300009177 | Bacteria | 1637 |
| 92 | Ga0105237_10000754 | 3300009545 | Bacteria | 44371 |
| 93 | Ga0105237_10697015 | 3300009545 | Bacteria | 1022 |
| 94 | Ga0105238_10321139 | 3300009551 | Bacteria | 1534 |
| 95 | Ga0105238_10553860 | 3300009551 | Bacteria | 1154 |
| 96 | Ga0105249_10212467 | 3300009553 | Bacteria | 1899 |
| 97 | Ga0105239_10058313 | 3300010375 | Bacteria | 4236 |
| 98 | Ga0105239_10067623 | 3300010375 | Bacteria | 3925 |
| 99 | Ga0105239_10199662 | 3300010375 | Bacteria | 2240 |
| 100 | Ga0105239_10393531 | 3300010375 | Bacteria | 1568 |
| 101 | Ga0105239_10554858 | 3300010375 | Bacteria | 1308 |
| 102 | Ga0157373_10012663 | 3300013100 | Bacteria | 6202 |
| 103 | Ga0157371_10017171 | 3300013102 | Bacteria | 5381 |
| 104 | Ga0157370_10000972 | 3300013104 | Bacteria | 36292 |
| 105 | Ga0157370_10068924 | 3300013104 | Bacteria | 3342 |
| 106 | Ga0157370_10425196 | 3300013104 | Bacteria | 1222 |
| 107 | Ga0157369_10057945 | 3300013105 | Bacteria | 4179 |
| 108 | Ga0157374_10226926 | 3300013296 | Bacteria | 1834 |
| 109 | Ga0157372_10220544 | 3300013307 | Bacteria | 2198 |
| 110 | Ga0182008_10029256 | 3300014497 | Bacteria | 2784 |
| 111 | Ga0182007_10019077 | 3300015262 | Bacteria | 2472 |
| 112 | Ga0182005_1005393 | 3300015265 | Bacteria | 3999 |
| 113 | Ga0213872_10000693 | 3300021361 | Bacteria | 25305 |
| 114 | Ga0213872_10008428 | 3300021361 | Bacteria | 4991 |
| 115 | Ga0213874_10029116 | 3300021377 | Bacteria | 1583 |
| 116 | Ga0213876_10000134 | 3300021384 | Bacteria | 80875 |
| 117 | Ga0209435_100042 | 3300025206 | Bacteria | 105563 |
| 118 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 119 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 120 | Ga0209437_107205 | 3300025233 | Bacteria | 1821 |
| 121 | Ga0209646_1000145 | 3300025246 | Bacteria | 105563 |
| 122 | Ga0209026_1000120 | 3300025250 | Bacteria | 130091 |
| 123 | Ga0209026_1000160 | 3300025250 | Bacteria | 105563 |
| 124 | Ga0209677_101323 | 3300025253 | Bacteria | 10926 |
| 125 | Ga0209148_1000056 | 3300025254 | Bacteria | 363380 |
| 126 | Ga0209759_1000177 | 3300025256 | Bacteria | 105563 |
| 127 | Ga0209759_1000368 | 3300025256 | Bacteria | 56484 |
| 128 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 129 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 130 | Ga0209233_1000087 | 3300025261 | Bacteria | 325225 |
| 131 | Ga0209233_1000209 | 3300025261 | Bacteria | 115124 |
| 132 | Ga0209233_1009458 | 3300025261 | Bacteria | 2964 |
| 133 | Ga0209455_1000137 | 3300025272 | Bacteria | 142099 |
| 134 | Ga0209676_1002466 | 3300025292 | Bacteria | 13070 |
| 135 | Ga0209025_1000077 | 3300025294 | Bacteria | 271958 |
| 136 | Ga0209758_1000554 | 3300025297 | Bacteria | 59218 |
| 137 | Ga0209758_1003923 | 3300025297 | Bacteria | 12985 |
| 138 | Ga0209758_1004764 | 3300025297 | Bacteria | 11008 |
| 139 | Ga0209050_1010473 | 3300025298 | Bacteria | 4564 |
| 140 | Ga0209051_1000459 | 3300025303 | Bacteria | 53735 |
| 141 | Ga0209257_1002585 | 3300025304 | Bacteria | 17600 |
| 142 | Ga0207707_10010344 | 3300025912 | Bacteria | 8095 |
| 143 | Ga0207707_10028728 | 3300025912 | Bacteria | 4859 |
| 144 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 145 | Ga0207695_10003143 | 3300025913 | Bacteria | 23591 |
| 146 | Ga0207695_10015043 | 3300025913 | Bacteria | 9131 |
| 147 | Ga0207671_10000718 | 3300025914 | Bacteria | 42274 |
| 148 | Ga0207671_10064787 | 3300025914 | Bacteria | 2717 |
| 149 | Ga0207660_10077156 | 3300025917 | Bacteria | 2438 |
| 150 | Ga0207660_10110648 | 3300025917 | Bacteria | 2067 |
| 151 | Ga0207657_10090293 | 3300025919 | Bacteria | 2557 |
| 152 | Ga0207681_10140543 | 3300025923 | Bacteria | 1797 |
| 153 | Ga0207650_10025936 | 3300025925 | Bacteria | 4178 |
| 154 | Ga0207659_10044372 | 3300025926 | Bacteria | 3128 |
| 155 | Ga0207711_10262745 | 3300025941 | Bacteria | 1587 |
| 156 | Ga0207689_10065924 | 3300025942 | Bacteria | 2978 |
| 157 | Ga0207667_10020984 | 3300025949 | Bacteria | 7245 |
| 158 | Ga0207667_10222472 | 3300025949 | Bacteria | 1934 |
| 159 | Ga0207712_10059712 | 3300025961 | Bacteria | 2700 |
| 160 | Ga0207668_10001888 | 3300025972 | Bacteria | 12260 |
| 161 | Ga0207640_10043430 | 3300025981 | Bacteria | 2873 |
| 162 | Ga0207658_10016989 | 3300025986 | Bacteria | 5008 |
| 163 | Ga0207639_10092724 | 3300026041 | Bacteria | 2421 |
| 164 | Ga0207639_10387256 | 3300026041 | Bacteria | 1257 |
| 165 | Ga0207702_10145723 | 3300026078 | Bacteria | 2149 |
| 166 | Ga0207648_10079288 | 3300026089 | Bacteria | 2864 |
| 167 | Ga0207648_10083342 | 3300026089 | Bacteria | 2789 |
| 168 | Ga0207648_10092376 | 3300026089 | Bacteria | 2646 |
| 169 | Ga0209281_1000053 | 3300027111 | Bacteria | 309587 |
| 170 | Ga0209371_1001029 | 3300027312 | Bacteria | 21140 |
| 171 | Ga0209282_1000102 | 3300027666 | Bacteria | 57412 |
| 172 | Ga0209813_10028846 | 3300027866 | Bacteria | 1621 |
| 173 | Ga0207428_10142070 | 3300027907 | Bacteria | 1831 |
| 174 | Ga0268266_10044390 | 3300028379 | Bacteria | 3800 |
| 175 | Ga0268266_10241232 | 3300028379 | Bacteria | 1668 |
| 176 | Ga0268266_10246104 | 3300028379 | Bacteria | 1652 |
| 177 | Ga0268265_10048603 | 3300028380 | Bacteria | 3185 |
| 178 | Ga0268264_10021248 | 3300028381 | Bacteria | 5303 |
| 179 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 180 | Ga0265338_10030725 | 3300028800 | Bacteria | 5282 |
| 181 | Ga0268256_1001309 | 3300030500 | Bacteria | 15327 |
| 182 | Ga0265331_10002627 | 3300031250 | Bacteria | 12061 |
| 183 | Ga0265331_10028764 | 3300031250 | Bacteria | 2778 |
| 184 | Ga0265327_10000190 | 3300031251 | Bacteria | 130086 |
| 185 | Ga0265316_10027899 | 3300031344 | Bacteria | 4667 |
| 186 | Ga0265316_10057177 | 3300031344 | Bacteria | 3043 |
| 187 | Ga0307513_10008189 | 3300031456 | Bacteria | 13404 |
| 188 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 189 | Ga0307413_10128578 | 3300031824 | Bacteria | 1730 |
| 190 | Ga0307410_10120870 | 3300031852 | Bacteria | 1910 |
| 191 | Ga0307407_10194377 | 3300031903 | Bacteria | 1355 |
| 192 | Ga0307416_100227722 | 3300032002 | Bacteria | 1794 |
| 193 | Ga0395899_0000213 | 3300037312 | Bacteria | 83403 |
| 194 | Ga0395899_0141708 | 3300037312 | Bacteria | 1710 |
| 195 | Ga0395899_0511327 | 3300037312 | Bacteria | 778 |
| 196 | Ga0395900_0000121 | 3300037418 | Bacteria | 135026 |
| 197 | Ga0395900_0011881 | 3300037418 | Bacteria | 8903 |
| 198 | Ga0395900_0217756 | 3300037418 | Bacteria | 1926 |
| 199 | Ga0395900_0246857 | 3300037418 | Bacteria | 1788 |
| 200 | Ga0395900_0280327 | 3300037418 | Bacteria | 1659 |
| 201 | Ga0395898_0000247 | 3300037466 | Bacteria | 135026 |
| 202 | Ga0395898_0085187 | 3300037466 | Bacteria | 3046 |
| 203 | Ga0395898_0603117 | 3300037466 | Bacteria | 1041 |
| 204 | Ga0395905_0000112 | 3300037471 | Bacteria | 135010 |
| 205 | Ga0395905_0018071 | 3300037471 | Bacteria | 6694 |
| 206 | Ga0395905_0055874 | 3300037471 | Bacteria | 3695 |
| 207 | Ga0436364_1313619 | 3300037853 | Bacteria | 1395 |
| 208 | Ga0395901_0000078 | 3300038443 | Bacteria | 135026 |
| 209 | Ga0395901_0007884 | 3300038443 | Bacteria | 10743 |
| 210 | Ga0395901_0030144 | 3300038443 | Bacteria | 5588 |
| 211 | Ga0395901_0064543 | 3300038443 | Bacteria | 3812 |
| 212 | Ga0400483_138427 | 3300039062 | Bacteria | 1445 |
| 213 | Ga0400483_157157 | 3300039062 | Bacteria | 2691 |
| 214 | Ga0400483_178012 | 3300039062 | Bacteria | 2457 |
| 215 | Ga0436365_0881464 | 3300039437 | Bacteria | 1800 |
| 216 | Ga0436365_1830840 | 3300039437 | Bacteria | 45078 |
| 217 | Ga0436361_0187236 | 3300039447 | Bacteria | 14656 |
| 218 | Ga0436361_0206950 | 3300039447 | Bacteria | 229672 |
| 219 | Ga0436363_1297661 | 3300039450 | Bacteria | 5607 |
| 220 | Ga0451855_1869378 | 3300041511 | Bacteria | 973 |
| 221 | Ga0466972_0168153 | 3300044658 | Bacteria | 1029 |
| 222 | Ga0453684_0061971 | 3300044712 | Bacteria | 4795 |
| 223 | Ga0466968_0060343 | 3300044735 | Bacteria | 1635 |
| 224 | Ga0466960_0114492 | 3300044901 | Bacteria | 1405 |
| 225 | Ga0451576_0002273 | 3300045051 | Bacteria | 29322 |
| 226 | Ga0495638_0002756 | 3300046460 | Bacteria | 14121 |
| 227 | Ga0495607_0102276 | 3300046501 | Bacteria | 1533 |
| 228 | Ga0495607_0105419 | 3300046501 | Bacteria | 1503 |
| 229 | Ga0495583_0004487 | 3300046506 | Bacteria | 9971 |
| 230 | Ga0495606_0011595 | 3300046507 | Bacteria | 7167 |
| 231 | Ga0495606_0076436 | 3300046507 | Bacteria | 2093 |
| 232 | Ga0495610_0021290 | 3300046512 | Bacteria | 3570 |
| 233 | Ga0495637_0066954 | 3300046520 | Bacteria | 1459 |
| 234 | Ga0495643_0048138 | 3300046522 | Bacteria | 2306 |
| 235 | Ga0495648_0165350 | 3300046524 | Bacteria | 1139 |
| 236 | Ga0495654_0000092 | 3300046530 | Bacteria | 101504 |
| 237 | Ga0495597_0032202 | 3300046542 | Bacteria | 2380 |
| 238 | Ga0495633_0009132 | 3300046558 | Bacteria | 5504 |
| 239 | Ga0495633_0126357 | 3300046558 | Bacteria | 1183 |
| 240 | Ga0495656_0161522 | 3300046615 | Bacteria | 1089 |
| 241 | Ga0495668_0046834 | 3300046616 | Bacteria | 2402 |
| 242 | Ga0495625_0051172 | 3300046660 | Bacteria | 2962 |
| 243 | Ga0495669_0000001 | 3300046684 | Bacteria | 291866 |
| 244 | Ga0495613_0000964 | 3300046689 | Bacteria | 22013 |
| 245 | Ga0495670_0203564 | 3300046691 | Bacteria | 1049 |
| 246 | Ga0495660_0067953 | 3300046810 | Bacteria | 1897 |
| 247 | Ga0495673_0137288 | 3300047469 | Bacteria | 956 |
| 248 | Ga0496102_0020221 | 3300048905 | Bacteria | 5881 |
| 249 | Ga0496107_0173742 | 3300048910 | Bacteria | 1599 |
| 250 | Ga0496110_0370540 | 3300048913 | Bacteria | 1305 |
| 251 | Ga0496111_0000236 | 3300048914 | Bacteria | 26454 |
| 252 | Ga0496111_0431528 | 3300048914 | Bacteria | 973 |
| 253 | Ga0496112_0010289 | 3300048915 | Bacteria | 8481 |
| 254 | Ga0496113_0090953 | 3300048916 | Bacteria | 2352 |
| 255 | Ga0496116_0000036 | 3300048919 | Bacteria | 388508 |
| 256 | Ga0496116_0000123 | 3300048919 | Bacteria | 161733 |
| 257 | Ga0496116_0055212 | 3300048919 | Bacteria | 2610 |
| 258 | Ga0496117_0005581 | 3300048920 | Bacteria | 13162 |
| 259 | Ga0496117_0013040 | 3300048920 | Bacteria | 7276 |
| 260 | Ga0496118_0002790 | 3300048921 | Bacteria | 22870 |
| 261 | Ga0496118_0003518 | 3300048921 | Bacteria | 19619 |
| 262 | Ga0496118_0013692 | 3300048921 | Bacteria | 7654 |
| 263 | Ga0496118_0052275 | 3300048921 | Bacteria | 3118 |
| 264 | Ga0496119_0000208 | 3300048922 | Bacteria | 83742 |
| 265 | Ga0496119_0018528 | 3300048922 | Bacteria | 5175 |
| 266 | Ga0496119_0030665 | 3300048922 | Bacteria | 3620 |
| 267 | Ga0496120_0000781 | 3300048923 | Bacteria | 46067 |
| 268 | Ga0496121_0001948 | 3300048924 | Bacteria | 32895 |
| 269 | Ga0496121_0004987 | 3300048924 | Bacteria | 17381 |
| 270 | Ga0496121_0096399 | 3300048924 | Bacteria | 2295 |
| 271 | Ga0496121_0340326 | 3300048924 | Bacteria | 1003 |
| 272 | Ga0496122_0000160 | 3300048925 | Bacteria | 159236 |
| 273 | Ga0496122_0004196 | 3300048925 | Bacteria | 18127 |
| 274 | Ga0496122_0006797 | 3300048925 | Bacteria | 12992 |
| 275 | Ga0496122_0019960 | 3300048925 | Bacteria | 6092 |
| 276 | Ga0496122_0030419 | 3300048925 | Bacteria | 4523 |
| 277 | Ga0496122_0041368 | 3300048925 | Bacteria | 3645 |
| 278 | Ga0496122_0078027 | 3300048925 | Bacteria | 2322 |
| 279 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 280 | Ga0496123_0004429 | 3300048926 | Bacteria | 14773 |
| 281 | Ga0496123_0009397 | 3300048926 | Bacteria | 8809 |
| 282 | Ga0496124_0000349 | 3300048927 | Bacteria | 84498 |
| 283 | Ga0496124_0006016 | 3300048927 | Bacteria | 13378 |
| 284 | Ga0496124_0008594 | 3300048927 | Bacteria | 10654 |
| 285 | Ga0496124_0037757 | 3300048927 | Bacteria | 4198 |
| 286 | Ga0496124_0072319 | 3300048927 | Bacteria | 2856 |
| 287 | Ga0496124_0282378 | 3300048927 | Bacteria | 1209 |
| 288 | Ga0496124_0316671 | 3300048927 | Bacteria | 1119 |
| 289 | Ga0496125_0025328 | 3300048928 | Bacteria | 5435 |
| 290 | Ga0496126_0000156 | 3300048929 | Bacteria | 158537 |
| 291 | Ga0496126_0036343 | 3300048929 | Bacteria | 4606 |
| 292 | Ga0496126_0233016 | 3300048929 | Bacteria | 1542 |
| 293 | Ga0496126_0253397 | 3300048929 | Bacteria | 1466 |
| 294 | Ga0496126_0403878 | 3300048929 | Bacteria | 1107 |
| 295 | Ga0501031_0002553 | 3300049568 | Bacteria | 11599 |
| 296 | Ga0501032_0000025 | 3300049569 | Bacteria | 138521 |
| 297 | Ga0501032_0206680 | 3300049569 | Bacteria | 1281 |
| 298 | Ga0501033_0000229 | 3300049570 | Bacteria | 54036 |
| 299 | Ga0501033_0000742 | 3300049570 | Bacteria | 29975 |
| 300 | Ga0501033_0330678 | 3300049570 | Bacteria | 1069 |
| 301 | Ga0501034_0000189 | 3300049571 | Bacteria | 115780 |
| 302 | Ga0501034_0001654 | 3300049571 | Bacteria | 28764 |
| 303 | Ga0501034_0024556 | 3300049571 | Bacteria | 6131 |
| 304 | Ga0501034_0150335 | 3300049571 | Bacteria | 2305 |
| 305 | Ga0501034_0435433 | 3300049571 | Bacteria | 1230 |
| 306 | Ga0501036_0001402 | 3300049572 | Bacteria | 18518 |
| 307 | Ga0501037_0000176 | 3300049573 | Bacteria | 60011 |
| 308 | Ga0501038_0000862 | 3300049574 | Bacteria | 26891 |
| 309 | Ga0501039_0000003 | 3300049575 | Bacteria | 357424 |
| 310 | Ga0501043_0000051 | 3300049579 | Bacteria | 106957 |
| 311 | Ga0501043_0168340 | 3300049579 | Bacteria | 1710 |
| 312 | Ga0501043_0185702 | 3300049579 | Bacteria | 1619 |
| 313 | Ga0501046_0042431 | 3300049580 | Bacteria | 3628 |
| 314 | Ga0501047_0018334 | 3300049581 | Bacteria | 6708 |
| 315 | Ga0501047_0025612 | 3300049581 | Bacteria | 5671 |
| 316 | Ga0501047_0029991 | 3300049581 | Bacteria | 5244 |
| 317 | Ga0501047_0050464 | 3300049581 | Bacteria | 4018 |
| 318 | Ga0501047_0180447 | 3300049581 | Bacteria | 1978 |
| 319 | Ga0501067_0168292 | 3300049583 | Bacteria | 1221 |
| 320 | Ga0501071_0144515 | 3300049587 | Bacteria | 1773 |
| 321 | Ga0501072_0133088 | 3300049588 | Bacteria | 1983 |
| 322 | Ga0501080_0011665 | 3300049742 | Bacteria | 8049 |
| 323 | Ga0501083_0016175 | 3300049744 | Bacteria | 5223 |
| 324 | Ga0501035_0000102 | 3300049822 | Bacteria | 106915 |
| 325 | Ga0501035_0000950 | 3300049822 | Bacteria | 30620 |
| 326 | Ga0501044_0020712 | 3300049823 | Bacteria | 7019 |
| 327 | Ga0501044_0105376 | 3300049823 | Bacteria | 2832 |
| 328 | Ga0501044_0282309 | 3300049823 | Bacteria | 1594 |
| 329 | nmdc:mga03n38_106237_c1 | 3300050490 | Bacteria | 1361 |
| 330 | nmdc:mga00v17_206289_c1 | 3300050491 | Bacteria | 1271 |
| 331 | nmdc:mga00v17_21259_c1 | 3300050491 | Bacteria | 3729 |
| 332 | nmdc:mga00v17_261276_c1 | 3300050491 | Bacteria | 1123 |
| 333 | nmdc:mga00v17_556_c1 | 3300050491 | Bacteria | 20858 |
| 334 | nmdc:mga0yw44_19023_c1 | 3300050492 | Bacteria | 3778 |
| 335 | nmdc:mga0yw44_26440_c1 | 3300050492 | Bacteria | 3315 |
| 336 | nmdc:mga0k408_49705_c1 | 3300050493 | Bacteria | 2427 |
| 337 | nmdc:mga06z11_24472_c1 | 3300050494 | Bacteria | 2849 |
| 338 | nmdc:mga07m45_24675_c1 | 3300050496 | Bacteria | 3295 |
| 339 | nmdc:mga05p37_100388_c1 | 3300050507 | Bacteria | 3564 |
| 340 | nmdc:mga09592_564724_c1 | 3300050508 | Bacteria | 977 |
| 341 | nmdc:mga0qj67_84686_c1 | 3300050509 | Bacteria | 2542 |
| 342 | nmdc:mga08y16_62367_c1 | 3300050511 | Bacteria | 3893 |
| 343 | nmdc:mga0n895_8900_c1 | 3300050512 | Bacteria | 8746 |
| 344 | nmdc:mga0a205_336780_c1 | 3300050515 | Bacteria | 1378 |
| 345 | Ga0495655_0018261 | 3300053083 | Bacteria | 1539 |
| 346 | Ga0500643_021878 | 3300053087 | Bacteria | 2068 |
| 347 | Ga0500562_000800 | 3300053108 | Bacteria | 7686 |
| 348 | Ga0500572_001733 | 3300053111 | Bacteria | 5661 |
| 349 | Ga0500595_004093 | 3300053119 | Bacteria | 6617 |
| 350 | Ga0500607_159938 | 3300053121 | Bacteria | 1031 |
| 351 | Ga0500608_067653 | 3300053122 | Bacteria | 1702 |
| 352 | Ga0500618_000227 | 3300053125 | Bacteria | 44231 |
| 353 | Ga0500618_007584 | 3300053125 | Bacteria | 3082 |
| 354 | Ga0500652_006919 | 3300053131 | Bacteria | 3681 |
| 355 | Ga0500573_0001776 | 3300053140 | Bacteria | 10485 |
| 356 | Ga0500573_0012488 | 3300053140 | Bacteria | 4770 |
| 357 | Ga0500616_0001544 | 3300053153 | Bacteria | 21664 |
| 358 | Ga0500616_0006086 | 3300053153 | Bacteria | 7991 |
| 359 | Ga0500620_000690 | 3300053155 | Bacteria | 5782 |
| 360 | Ga0500627_0163785 | 3300053158 | Bacteria | 1003 |
| 361 | Ga0500633_0075135 | 3300053160 | Bacteria | 1214 |
| 362 | Ga0500634_0000112 | 3300053161 | Bacteria | 30260 |
| 363 | Ga0500634_0068617 | 3300053161 | Bacteria | 1862 |
| 364 | Ga0500636_0067626 | 3300053177 | Bacteria | 2075 |
| 365 | Ga0500637_0009988 | 3300053178 | Bacteria | 4854 |
| 366 | Ga0501082_0000811 | 3300060353 | Bacteria | 27462 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100172908 | Ga0070680_1001729082 | 196 |
| 2 | 3300005546 | Ga0070696_100057745 | Ga0070696_1000577452 | 196 |
| 3 | 3300025917 | Ga0207660_10110648 | Ga0207660_101106482 | 196 |
| 4 | 3300026089 | Ga0207648_10083342 | Ga0207648_100833422 | 196 |
| 5 | 3300006852 | Ga0075433_10252023 | Ga0075433_102520232 | 210 |
| 6 | 3300009094 | Ga0111539_10119641 | Ga0111539_101196411 | 210 |
| 7 | 3300027907 | Ga0207428_10142070 | Ga0207428_101420703 | 210 |
| 8 | 3300050511 | nmdc:mga08y16_62367_c1 | nmdc:mga08y16_62367_c1_10_693 | 210 |
| 9 | 3300050512 | nmdc:mga0n895_8900_c1 | nmdc:mga0n895_8900_c1_1246_1929 | 210 |
| 10 | 3300050515 | nmdc:mga0a205_336780_c1 | nmdc:mga0a205_336780_c1_344_1027 | 210 |
| 11 | iso_pu_bacteria | 2844533157 | 2844533647 | 216 |
| 12 | 3300031852 | Ga0307410_10120870 | Ga0307410_101208702 | 226 |
| 13 | 3300032002 | Ga0307416_100227722 | Ga0307416_1002277222 | 226 |
| 14 | 3300046615 | Ga0495656_0161522 | Ga0495656_0161522_25_708 | 227 |
| 15 | 3300037312 | Ga0395899_0511327 | Ga0395899_0511327_73_765 | 229 |
| 16 | iso_pu_bacteria | 2938014810 | 2938015505 | 229 |
| 17 | 3300037466 | Ga0395898_0603117 | Ga0395898_0603117_14_715 | 230 |
| 18 | iso_pu_bacteria | 2924754689 | 2924756390 | 233 |
| 19 | 3300009147 | Ga0114129_10312268 | Ga0114129_103122682 | 241 |
| 20 | 3300006844 | Ga0075428_100416352 | Ga0075428_1004163522 | 242 |
| 21 | 3300006846 | Ga0075430_100185697 | Ga0075430_1001856971 | 242 |
| 22 | 3300006847 | Ga0075431_100206251 | Ga0075431_1002062512 | 242 |
| 23 | 3300050507 | nmdc:mga05p37_100388_c1 | nmdc:mga05p37_100388_c1_652_1437 | 242 |
| 24 | 3300049571 | Ga0501034_0435433 | Ga0501034_0435433_167_1003 | 246 |
| 25 | 3300049581 | Ga0501047_0050464 | Ga0501047_0050464_214_1050 | 246 |
| 26 | 3300001979 | JGI24740J21852_10004386 | JGI24740J21852_100043861 | 249 |
| 27 | 3300005563 | Ga0068855_100514237 | Ga0068855_1005142372 | 249 |
| 28 | 3300005616 | Ga0068852_100089570 | Ga0068852_1000895703 | 249 |
| 29 | 3300006038 | Ga0075365_10005167 | Ga0075365_100051676 | 249 |
| 30 | 3300006048 | Ga0075363_100022794 | Ga0075363_1000227943 | 249 |
| 31 | 3300006051 | Ga0075364_10025065 | Ga0075364_100250653 | 249 |
| 32 | 3300006178 | Ga0075367_10034225 | Ga0075367_100342252 | 249 |
| 33 | 3300006353 | Ga0075370_10025852 | Ga0075370_100258522 | 249 |
| 34 | 3300013296 | Ga0157374_10226926 | Ga0157374_102269262 | 249 |
| 35 | 3300048929 | Ga0496126_0233016 | Ga0496126_0233016_457_1296 | 249 |
| 36 | 3300050490 | nmdc:mga03n38_106237_c1 | nmdc:mga03n38_106237_c1_250_1089 | 249 |
| 37 | 3300050491 | nmdc:mga00v17_21259_c1 | nmdc:mga00v17_21259_c1_1420_2259 | 249 |
| 38 | 3300050492 | nmdc:mga0yw44_19023_c1 | nmdc:mga0yw44_19023_c1_2177_3016 | 249 |
| 39 | 3300050494 | nmdc:mga06z11_24472_c1 | nmdc:mga06z11_24472_c1_1443_2282 | 249 |
| 40 | 3300050496 | nmdc:mga07m45_24675_c1 | nmdc:mga07m45_24675_c1_2132_2971 | 249 |
| 41 | 3300039062 | Ga0400483_138427 | Ga0400483_138427_11_847 | 254 |
| 42 | 3300005354 | Ga0070675_100093086 | Ga0070675_1000930863 | 257 |
| 43 | 3300005356 | Ga0070674_100006650 | Ga0070674_1000066505 | 257 |
| 44 | 3300005543 | Ga0070672_100083788 | Ga0070672_1000837881 | 257 |
| 45 | 3300005548 | Ga0070665_100029356 | Ga0070665_1000293563 | 257 |
| 46 | 3300010375 | Ga0105239_10554858 | Ga0105239_105548582 | 257 |
| 47 | 3300025919 | Ga0207657_10090293 | Ga0207657_100902932 | 257 |
| 48 | 3300025926 | Ga0207659_10044372 | Ga0207659_100443723 | 257 |
| 49 | 3300028379 | Ga0268266_10246104 | Ga0268266_102461042 | 257 |
| 50 | 3300003187 | JGI25151J46595_10000192 | JGI25151J46595_1000019253 | 258 |
| 51 | 3300025294 | Ga0209025_1000077 | Ga0209025_1000077223 | 258 |
| 52 | 3300025297 | Ga0209758_1003923 | Ga0209758_10039234 | 258 |
| 53 | 3300046512 | Ga0495610_0021290 | Ga0495610_0021290_2380_3177 | 258 |
| 54 | 3300005614 | Ga0068856_100241901 | Ga0068856_1002419012 | 260 |
| 55 | 3300026089 | Ga0207648_10079288 | Ga0207648_100792882 | 260 |
| 56 | 3300013102 | Ga0157371_10017171 | Ga0157371_100171713 | 261 |
| 57 | 3300013105 | Ga0157369_10057945 | Ga0157369_100579452 | 261 |
| 58 | 3300048919 | Ga0496116_0000036 | Ga0496116_0000036_288031_288861 | 261 |
| 59 | 3300048925 | Ga0496122_0006797 | Ga0496122_0006797_5933_6763 | 261 |
| 60 | 3300048925 | Ga0496122_0078027 | Ga0496122_0078027_262_1092 | 261 |
| 61 | 3300048927 | Ga0496124_0282378 | Ga0496124_0282378_306_1136 | 261 |
| 62 | 3300053111 | Ga0500572_001733 | Ga0500572_001733_4471_5304 | 261 |
| 63 | 3300053177 | Ga0500636_0067626 | Ga0500636_0067626_504_1337 | 261 |
| 64 | iso_pu_bacteria | 2876377896 | 2876379667 | 261 |
| 65 | 3300037312 | Ga0395899_0000213 | Ga0395899_0000213_52389_53183 | 262 |
| 66 | 3300037418 | Ga0395900_0000121 | Ga0395900_0000121_104012_104806 | 262 |
| 67 | 3300037466 | Ga0395898_0000247 | Ga0395898_0000247_30221_31015 | 262 |
| 68 | 3300037471 | Ga0395905_0000112 | Ga0395905_0000112_30205_30999 | 262 |
| 69 | 3300038443 | Ga0395901_0000078 | Ga0395901_0000078_104012_104806 | 262 |
| 70 | 3300048919 | Ga0496116_0000123 | Ga0496116_0000123_145280_146101 | 262 |
| 71 | 3300048920 | Ga0496117_0013040 | Ga0496117_0013040_3351_4172 | 262 |
| 72 | 3300048921 | Ga0496118_0003518 | Ga0496118_0003518_4255_5076 | 262 |
| 73 | 3300048927 | Ga0496124_0316671 | Ga0496124_0316671_95_910 | 262 |
| 74 | 3300048929 | Ga0496126_0000156 | Ga0496126_0000156_87592_88422 | 262 |
| 75 | 3300053160 | Ga0500633_0075135 | Ga0500633_0075135_47_895 | 262 |
| 76 | 3300050493 | nmdc:mga0k408_49705_c1 | nmdc:mga0k408_49705_c1_1552_2361 | 264 |
| 77 | 3300010375 | Ga0105239_10058313 | Ga0105239_100583134 | 265 |
| 78 | 3300031344 | Ga0265316_10027899 | Ga0265316_100278994 | 265 |
| 79 | iso_pu_bacteria | 2854681122 | 2854683558 | 265 |
| 80 | 3300006846 | Ga0075430_100183521 | Ga0075430_1001835212 | 266 |
| 81 | 3300009093 | Ga0105240_10013259 | Ga0105240_100132597 | 266 |
| 82 | 3300009551 | Ga0105238_10553860 | Ga0105238_105538602 | 266 |
| 83 | 3300021377 | Ga0213874_10029116 | Ga0213874_100291162 | 266 |
| 84 | 3300021384 | Ga0213876_10000134 | Ga0213876_1000013467 | 266 |
| 85 | 3300025913 | Ga0207695_10003143 | Ga0207695_100031437 | 266 |
| 86 | 3300031903 | Ga0307407_10194377 | Ga0307407_101943772 | 266 |
| 87 | 3300037853 | Ga0436364_1313619 | Ga0436364_1313619_402_1235 | 266 |
| 88 | 3300039437 | Ga0436365_0881464 | Ga0436365_0881464_922_1755 | 266 |
| 89 | 3300039437 | Ga0436365_1830840 | Ga0436365_1830840_25452_26285 | 266 |
| 90 | 3300039450 | Ga0436363_1297661 | Ga0436363_1297661_3143_3976 | 266 |
| 91 | 3300049587 | Ga0501071_0144515 | Ga0501071_0144515_394_1233 | 266 |
| 92 | 3300049588 | Ga0501072_0133088 | Ga0501072_0133088_916_1758 | 266 |
| 93 | 3300049742 | Ga0501080_0011665 | Ga0501080_0011665_5301_6143 | 266 |
| 94 | 3300049744 | Ga0501083_0016175 | Ga0501083_0016175_3316_4158 | 266 |
| 95 | 3300050509 | nmdc:mga0qj67_84686_c1 | nmdc:mga0qj67_84686_c1_1429_2262 | 266 |
| 96 | 3300060353 | Ga0501082_0000811 | Ga0501082_0000811_6192_7034 | 266 |
| 97 | iso_pu_bacteria | 2842333319 | 2842333655 | 266 |
| 98 | iso_pu_bacteria | 2899259804 | 2899261802 | 266 |
| 99 | iso_pu_bacteria | 2965119406 | 2965120111 | 266 |
| 100 | iso_pu_bacteria | 3000017691 | 3000018631 | 266 |
| 101 | 3300005458 | Ga0070681_10006925 | Ga0070681_100069255 | 267 |
| 102 | 3300005458 | Ga0070681_10007314 | Ga0070681_100073144 | 267 |
| 103 | 3300005539 | Ga0068853_100256899 | Ga0068853_1002568992 | 267 |
| 104 | 3300005563 | Ga0068855_100029275 | Ga0068855_1000292753 | 267 |
| 105 | 3300005616 | Ga0068852_100065931 | Ga0068852_1000659312 | 267 |
| 106 | 3300009177 | Ga0105248_10360355 | Ga0105248_103603552 | 267 |
| 107 | 3300010375 | Ga0105239_10067623 | Ga0105239_100676234 | 267 |
| 108 | 3300013104 | Ga0157370_10068924 | Ga0157370_100689243 | 267 |
| 109 | 3300013307 | Ga0157372_10220544 | Ga0157372_102205443 | 267 |
| 110 | 3300014497 | Ga0182008_10029256 | Ga0182008_100292563 | 267 |
| 111 | 3300025912 | Ga0207707_10010344 | Ga0207707_100103446 | 267 |
| 112 | 3300025912 | Ga0207707_10028728 | Ga0207707_100287284 | 267 |
| 113 | 3300025913 | Ga0207695_10015043 | Ga0207695_100150434 | 267 |
| 114 | 3300025917 | Ga0207660_10077156 | Ga0207660_100771562 | 267 |
| 115 | 3300025941 | Ga0207711_10262745 | Ga0207711_102627452 | 267 |
| 116 | 3300025949 | Ga0207667_10020984 | Ga0207667_100209843 | 267 |
| 117 | 3300031730 | Ga0307516_10000004 | Ga0307516_100000046 | 267 |
| 118 | 3300039447 | Ga0436361_0187236 | Ga0436361_0187236_10797_11630 | 267 |
| 119 | 3300046460 | Ga0495638_0002756 | Ga0495638_0002756_4813_5643 | 267 |
| 120 | 3300046507 | Ga0495606_0011595 | Ga0495606_0011595_2812_3678 | 267 |
| 121 | 3300048915 | Ga0496112_0010289 | Ga0496112_0010289_3672_4511 | 267 |
| 122 | 3300053108 | Ga0500562_000800 | Ga0500562_000800_1714_2541 | 267 |
| 123 | 3300053161 | Ga0500634_0068617 | Ga0500634_0068617_832_1665 | 267 |
| 124 | iso_pu_bacteria | 2643221550 | 2643773604 | 267 |
| 125 | iso_pu_bacteria | 2821443989 | 2821449371 | 267 |
| 126 | 3300005331 | Ga0070670_100080028 | Ga0070670_1000800284 | 268 |
| 127 | 3300005334 | Ga0068869_100052973 | Ga0068869_1000529732 | 268 |
| 128 | 3300005347 | Ga0070668_100008467 | Ga0070668_1000084674 | 268 |
| 129 | 3300005353 | Ga0070669_100046389 | Ga0070669_1000463893 | 268 |
| 130 | 3300005367 | Ga0070667_100023391 | Ga0070667_1000233913 | 268 |
| 131 | 3300005459 | Ga0068867_100138010 | Ga0068867_1001380102 | 268 |
| 132 | 3300005618 | Ga0068864_100101980 | Ga0068864_1001019802 | 268 |
| 133 | 3300005719 | Ga0068861_100395306 | Ga0068861_1003953062 | 268 |
| 134 | 3300005843 | Ga0068860_100035203 | Ga0068860_1000352034 | 268 |
| 135 | 3300005844 | Ga0068862_100007560 | Ga0068862_10000756012 | 268 |
| 136 | 3300005844 | Ga0068862_100026297 | Ga0068862_1000262973 | 268 |
| 137 | 3300021361 | Ga0213872_10000693 | Ga0213872_100006937 | 268 |
| 138 | 3300025923 | Ga0207681_10140543 | Ga0207681_101405433 | 268 |
| 139 | 3300025925 | Ga0207650_10025936 | Ga0207650_100259364 | 268 |
| 140 | 3300025942 | Ga0207689_10065924 | Ga0207689_100659245 | 268 |
| 141 | 3300025961 | Ga0207712_10059712 | Ga0207712_100597123 | 268 |
| 142 | 3300025972 | Ga0207668_10001888 | Ga0207668_100018884 | 268 |
| 143 | 3300025986 | Ga0207658_10016989 | Ga0207658_100169892 | 268 |
| 144 | 3300028380 | Ga0268265_10048603 | Ga0268265_100486035 | 268 |
| 145 | 3300028381 | Ga0268264_10021248 | Ga0268264_100212489 | 268 |
| 146 | 3300031251 | Ga0265327_10000190 | Ga0265327_1000019040 | 268 |
| 147 | 3300039447 | Ga0436361_0206950 | Ga0436361_0206950_145540_146376 | 268 |
| 148 | 3300046684 | Ga0495669_0000001 | Ga0495669_0000001_49839_50675 | 268 |
| 149 | 3300048914 | Ga0496111_0431528 | Ga0496111_0431528_24_851 | 268 |
| 150 | 3300048925 | Ga0496122_0004196 | Ga0496122_0004196_9068_9895 | 268 |
| 151 | 3300048926 | Ga0496123_0004429 | Ga0496123_0004429_11580_12407 | 268 |
| 152 | 3300048927 | Ga0496124_0006016 | Ga0496124_0006016_11733_12560 | 268 |
| 153 | 3300049579 | Ga0501043_0168340 | Ga0501043_0168340_578_1405 | 268 |
| 154 | 3300049581 | Ga0501047_0029991 | Ga0501047_0029991_38_865 | 268 |
| 155 | 3300053119 | Ga0500595_004093 | Ga0500595_004093_3649_4479 | 268 |
| 156 | 3300053122 | Ga0500608_067653 | Ga0500608_067653_374_1201 | 268 |
| 157 | 3300053153 | Ga0500616_0006086 | Ga0500616_0006086_4361_5194 | 268 |
| 158 | iso_pu_bacteria | 2522572158 | 2523102558 | 268 |
| 159 | iso_pu_bacteria | 2643221551 | 2643775444 | 268 |
| 160 | iso_pu_bacteria | 2643221555 | 2643793890 | 268 |
| 161 | iso_pu_bacteria | 2643221564 | 2643837779 | 268 |
| 162 | iso_pu_bacteria | 2765235802 | 2765465211 | 268 |
| 163 | iso_pu_bacteria | 2767802442 | 2770197357 | 268 |
| 164 | iso_pu_bacteria | 2904578770 | 2904581381 | 268 |
| 165 | iso_pu_bacteria | 2919119836 | 2919122617 | 268 |
| 166 | 3300005329 | Ga0070683_100183995 | Ga0070683_1001839952 | 269 |
| 167 | 3300009551 | Ga0105238_10321139 | Ga0105238_103211392 | 269 |
| 168 | 3300028800 | Ga0265338_10030725 | Ga0265338_100307252 | 269 |
| 169 | 3300037312 | Ga0395899_0141708 | Ga0395899_0141708_729_1562 | 269 |
| 170 | 3300037418 | Ga0395900_0246857 | Ga0395900_0246857_717_1550 | 269 |
| 171 | 3300037466 | Ga0395898_0085187 | Ga0395898_0085187_160_993 | 269 |
| 172 | 3300037471 | Ga0395905_0055874 | Ga0395905_0055874_1566_2399 | 269 |
| 173 | 3300038443 | Ga0395901_0064543 | Ga0395901_0064543_2333_3166 | 269 |
| 174 | 3300044712 | Ga0453684_0061971 | Ga0453684_0061971_1519_2388 | 269 |
| 175 | 3300048910 | Ga0496107_0173742 | Ga0496107_0173742_334_1179 | 269 |
| 176 | 3300049581 | Ga0501047_0025612 | Ga0501047_0025612_3460_4362 | 269 |
| 177 | 3300053158 | Ga0500627_0163785 | Ga0500627_0163785_177_992 | 269 |
| 178 | iso_pu_bacteria | 2503198000 | 2503203294 | 269 |
| 179 | iso_pu_bacteria | 2996310559 | 2996313323 | 269 |
| 180 | 3300021361 | Ga0213872_10008428 | Ga0213872_100084282 | 270 |
| 181 | 3300028379 | Ga0268266_10044390 | Ga0268266_100443903 | 270 |
| 182 | 3300031250 | Ga0265331_10002627 | Ga0265331_1000262711 | 270 |
| 183 | 3300031250 | Ga0265331_10028764 | Ga0265331_100287644 | 270 |
| 184 | 3300039062 | Ga0400483_157157 | Ga0400483_157157_210_1049 | 270 |
| 185 | 3300039062 | Ga0400483_178012 | Ga0400483_178012_321_1160 | 270 |
| 186 | 3300045051 | Ga0451576_0002273 | Ga0451576_0002273_4280_5134 | 270 |
| 187 | 3300046689 | Ga0495613_0000964 | Ga0495613_0000964_16272_17123 | 270 |
| 188 | 3300049571 | Ga0501034_0000189 | Ga0501034_0000189_56387_57235 | 270 |
| 189 | 3300053131 | Ga0500652_006919 | Ga0500652_006919_1472_2311 | 270 |
| 190 | iso_pu_bacteria | 2508501123 | 2509116056 | 270 |
| 191 | iso_pu_bacteria | 2508501127 | 2509141470 | 270 |
| 192 | iso_pu_bacteria | 2509276018 | 2509371832 | 270 |
| 193 | iso_pu_bacteria | 2509276022 | 2509397725 | 270 |
| 194 | iso_pu_bacteria | 2510065059 | 2510318981 | 270 |
| 195 | iso_pu_bacteria | 2512875016 | 2512929817 | 270 |
| 196 | iso_pu_bacteria | 2512875024 | 2512964586 | 270 |
| 197 | iso_pu_bacteria | 2513237087 | 2513590219 | 270 |
| 198 | iso_pu_bacteria | 2513237164 | 2514033300 | 270 |
| 199 | iso_pu_bacteria | 2513237305 | 2514420483 | 270 |
| 200 | iso_pu_bacteria | 2513237351 | 2514588177 | 270 |
| 201 | iso_pu_bacteria | 2588253730 | 2588515409 | 270 |
| 202 | iso_pu_bacteria | 2597489875 | 2597815013 | 270 |
| 203 | iso_pu_bacteria | 2597490356 | 2599106086 | 270 |
| 204 | iso_pu_bacteria | 2643221595 | 2643985341 | 270 |
| 205 | iso_pu_bacteria | 2643221627 | 2644155023 | 270 |
| 206 | iso_pu_bacteria | 2671180139 | 2671692764 | 270 |
| 207 | iso_pu_bacteria | 2687453392 | 2688600132 | 270 |
| 208 | iso_pu_bacteria | 2721755686 | 2723577412 | 270 |
| 209 | iso_pu_bacteria | 2756170246 | 2756673305 | 270 |
| 210 | iso_pu_bacteria | 2791355123 | 2792749115 | 270 |
| 211 | iso_pu_bacteria | 2841734538 | 2841741125 | 270 |
| 212 | iso_pu_bacteria | 2844002411 | 2844005766 | 270 |
| 213 | iso_pu_bacteria | 2844009547 | 2844015444 | 270 |
| 214 | iso_pu_bacteria | 2846952575 | 2846955880 | 270 |
| 215 | iso_pu_bacteria | 2847670302 | 2847671814 | 270 |
| 216 | iso_pu_bacteria | 2848858292 | 2848862299 | 270 |
| 217 | iso_pu_bacteria | 2856314179 | 2856318456 | 270 |
| 218 | iso_pu_bacteria | 2856320880 | 2856324408 | 270 |
| 219 | iso_pu_bacteria | 2856328259 | 2856333387 | 270 |
| 220 | iso_pu_bacteria | 2856334872 | 2856335712 | 270 |
| 221 | iso_pu_bacteria | 2856342000 | 2856345456 | 270 |
| 222 | iso_pu_bacteria | 2856349417 | 2856350409 | 270 |
| 223 | iso_pu_bacteria | 2856356410 | 2856362074 | 270 |
| 224 | iso_pu_bacteria | 2857367948 | 2857375518 | 270 |
| 225 | iso_pu_bacteria | 2869162929 | 2869165012 | 270 |
| 226 | iso_pu_bacteria | 2869169390 | 2869175763 | 270 |
| 227 | iso_pu_bacteria | 2869234852 | 2869240244 | 270 |
| 228 | iso_pu_bacteria | 2869242130 | 2869248585 | 270 |
| 229 | iso_pu_bacteria | 2869249662 | 2869256484 | 270 |
| 230 | iso_pu_bacteria | 2869256925 | 2869260184 | 270 |
| 231 | iso_pu_bacteria | 2869264136 | 2869264435 | 270 |
| 232 | iso_pu_bacteria | 2869271264 | 2869276513 | 270 |
| 233 | iso_pu_bacteria | 2869278585 | 2869281594 | 270 |
| 234 | iso_pu_bacteria | 2871451962 | 2871456680 | 270 |
| 235 | iso_pu_bacteria | 2871459585 | 2871462212 | 270 |
| 236 | iso_pu_bacteria | 2871466892 | 2871470002 | 270 |
| 237 | iso_pu_bacteria | 2871474448 | 2871478512 | 270 |
| 238 | iso_pu_bacteria | 2871481445 | 2871488446 | 270 |
| 239 | iso_pu_bacteria | 2871488783 | 2871493934 | 270 |
| 240 | iso_pu_bacteria | 2874109183 | 2874111271 | 270 |
| 241 | iso_pu_bacteria | 2874116593 | 2874120114 | 270 |
| 242 | iso_pu_bacteria | 2874131515 | 2874132698 | 270 |
| 243 | iso_pu_bacteria | 2874139085 | 2874140742 | 270 |
| 244 | iso_pu_bacteria | 2874162495 | 2874163468 | 270 |
| 245 | iso_pu_bacteria | 2874168670 | 2874175451 | 270 |
| 246 | iso_pu_bacteria | 2876363079 | 2876366620 | 270 |
| 247 | iso_pu_bacteria | 2876386047 | 2876388113 | 270 |
| 248 | iso_pu_bacteria | 2876399893 | 2876406245 | 270 |
| 249 | iso_pu_bacteria | 2876406927 | 2876411932 | 270 |
| 250 | iso_pu_bacteria | 2876420981 | 2876424469 | 270 |
| 251 | iso_pu_bacteria | 2878035449 | 2878037792 | 270 |
| 252 | iso_pu_bacteria | 2878738818 | 2878742523 | 270 |
| 253 | iso_pu_bacteria | 2878753008 | 2878756510 | 270 |
| 254 | iso_pu_bacteria | 2878774303 | 2878775917 | 270 |
| 255 | iso_pu_bacteria | 2878781027 | 2878783626 | 270 |
| 256 | iso_pu_bacteria | 2878788777 | 2878793530 | 270 |
| 257 | iso_pu_bacteria | 2881155292 | 2881157451 | 270 |
| 258 | iso_pu_bacteria | 2881845957 | 2881847017 | 270 |
| 259 | iso_pu_bacteria | 2881853255 | 2881857060 | 270 |
| 260 | iso_pu_bacteria | 2881861095 | 2881867287 | 270 |
| 261 | iso_pu_bacteria | 2882632389 | 2882634377 | 270 |
| 262 | iso_pu_bacteria | 2882912400 | 2882915271 | 270 |
| 263 | iso_pu_bacteria | 2885312484 | 2885316396 | 270 |
| 264 | iso_pu_bacteria | 2885318864 | 2885321161 | 270 |
| 265 | iso_pu_bacteria | 2885342637 | 2885349999 | 270 |
| 266 | iso_pu_bacteria | 2885350715 | 2885356052 | 270 |
| 267 | iso_pu_bacteria | 2888337043 | 2888341306 | 270 |
| 268 | iso_pu_bacteria | 2888343758 | 2888348490 | 270 |
| 269 | iso_pu_bacteria | 2903448605 | 2903452796 | 270 |
| 270 | iso_pu_bacteria | 2903492973 | 2903502562 | 270 |
| 271 | iso_pu_bacteria | 2903513507 | 2903518240 | 270 |
| 272 | iso_pu_bacteria | 2903521522 | 2903524487 | 270 |
| 273 | iso_pu_bacteria | 2903528002 | 2903530118 | 270 |
| 274 | iso_pu_bacteria | 2906370794 | 2906375479 | 270 |
| 275 | iso_pu_bacteria | 2906386501 | 2906386883 | 270 |
| 276 | iso_pu_bacteria | 2906408224 | 2906411685 | 270 |
| 277 | iso_pu_bacteria | 2906414383 | 2906418493 | 270 |
| 278 | iso_pu_bacteria | 2922151315 | 2922154110 | 270 |
| 279 | iso_pu_bacteria | 2922172374 | 2922176873 | 270 |
| 280 | iso_pu_bacteria | 2924741084 | 2924743055 | 270 |
| 281 | iso_pu_bacteria | 2924748358 | 2924751453 | 270 |
| 282 | iso_pu_bacteria | 2924762789 | 2924764629 | 270 |
| 283 | iso_pu_bacteria | 2924776078 | 2924780323 | 270 |
| 284 | iso_pu_bacteria | 2924784321 | 2924788095 | 270 |
| 285 | iso_pu_bacteria | 2937822353 | 2937829281 | 270 |
| 286 | iso_pu_bacteria | 2937836603 | 2937840500 | 270 |
| 287 | iso_pu_bacteria | 2937848649 | 2937852405 | 270 |
| 288 | iso_pu_bacteria | 2937861824 | 2937862744 | 270 |
| 289 | iso_pu_bacteria | 2937877337 | 2937882845 | 270 |
| 290 | iso_pu_bacteria | 2937972304 | 2937973182 | 270 |
| 291 | iso_pu_bacteria | 2937980651 | 2937986440 | 270 |
| 292 | iso_pu_bacteria | 2958034702 | 2958037555 | 270 |
| 293 | iso_pu_bacteria | 2958041894 | 2958047266 | 270 |
| 294 | iso_pu_bacteria | 2958064165 | 2958068678 | 270 |
| 295 | iso_pu_bacteria | 2958071322 | 2958071375 | 270 |
| 296 | iso_pu_bacteria | 2958084443 | 2958089970 | 270 |
| 297 | iso_pu_bacteria | 2958108152 | 2958112382 | 270 |
| 298 | iso_pu_bacteria | 2958122699 | 2958126408 | 270 |
| 299 | iso_pu_bacteria | 2958144490 | 2958148992 | 270 |
| 300 | iso_pu_bacteria | 2961127735 | 2961135143 | 270 |
| 301 | iso_pu_bacteria | 2961136820 | 2961143484 | 270 |
| 302 | iso_pu_bacteria | 2961170736 | 2961172799 | 270 |
| 303 | iso_pu_bacteria | 2961183825 | 2961190646 | 270 |
| 304 | iso_pu_bacteria | 2963644680 | 2963649414 | 270 |
| 305 | iso_pu_bacteria | 2965025482 | 2965030659 | 270 |
| 306 | iso_pu_bacteria | 2965040258 | 2965046029 | 270 |
| 307 | iso_pu_bacteria | 2965047637 | 2965053313 | 270 |
| 308 | iso_pu_bacteria | 2965089291 | 2965095116 | 270 |
| 309 | iso_pu_bacteria | 2965102966 | 2965107272 | 270 |
| 310 | iso_pu_bacteria | 2967996073 | 2967998011 | 270 |
| 311 | iso_pu_bacteria | 2968003550 | 2968008662 | 270 |
| 312 | iso_pu_bacteria | 2968016561 | 2968019611 | 270 |
| 313 | iso_pu_bacteria | 2968083720 | 2968084577 | 270 |
| 314 | iso_pu_bacteria | 2968138860 | 2968146102 | 270 |
| 315 | iso_pu_bacteria | 2970469710 | 2970472932 | 270 |
| 316 | iso_pu_bacteria | 2970489779 | 2970492078 | 270 |
| 317 | iso_pu_bacteria | 2970503327 | 2970505393 | 270 |
| 318 | iso_pu_bacteria | 2970510686 | 2970512514 | 270 |
| 319 | iso_pu_bacteria | 2970524798 | 2970529707 | 270 |
| 320 | iso_pu_bacteria | 2970532167 | 2970535252 | 270 |
| 321 | iso_pu_bacteria | 2970540015 | 2970545087 | 270 |
| 322 | iso_pu_bacteria | 2970547951 | 2970551110 | 270 |
| 323 | iso_pu_bacteria | 2970593180 | 2970596197 | 270 |
| 324 | iso_pu_bacteria | 2970619444 | 2970624992 | 270 |
| 325 | iso_pu_bacteria | 2970627176 | 2970627372 | 270 |
| 326 | iso_pu_bacteria | 2977821940 | 2977825691 | 270 |
| 327 | iso_pu_bacteria | 2977828996 | 2977832260 | 270 |
| 328 | iso_pu_bacteria | 2977864932 | 2977869569 | 270 |
| 329 | iso_pu_bacteria | 2977872689 | 2977873749 | 270 |
| 330 | iso_pu_bacteria | 2977907340 | 2977914993 | 270 |
| 331 | iso_pu_bacteria | 2977915119 | 2977915314 | 270 |
| 332 | iso_pu_bacteria | 2977922695 | 2977927225 | 270 |
| 333 | iso_pu_bacteria | 2977935797 | 2977937007 | 270 |
| 334 | iso_pu_bacteria | 2977950692 | 2977954377 | 270 |
| 335 | iso_pu_bacteria | 2977957713 | 2977960054 | 270 |
| 336 | iso_pu_bacteria | 2977986579 | 2977989923 | 270 |
| 337 | iso_pu_bacteria | 2979764755 | 2979770064 | 270 |
| 338 | iso_pu_bacteria | 2979772303 | 2979779447 | 270 |
| 339 | iso_pu_bacteria | 2979793036 | 2979794270 | 270 |
| 340 | iso_pu_bacteria | 2979808191 | 2979810114 | 270 |
| 341 | iso_pu_bacteria | 2987645492 | 2987648775 | 270 |
| 342 | iso_pu_bacteria | 2987666974 | 2987667433 | 270 |
| 343 | iso_pu_bacteria | 2987673487 | 2987674016 | 270 |
| 344 | iso_pu_bacteria | 2996348954 | 2996351948 | 270 |
| 345 | iso_pu_bacteria | 2996386984 | 2996392344 | 270 |
| 346 | iso_pu_bacteria | 3000135777 | 3000141853 | 270 |
| 347 | iso_pu_bacteria | 3004167301 | 3004170901 | 270 |
| 348 | iso_pu_bacteria | 3004195979 | 3004199916 | 270 |
| 349 | iso_pu_bacteria | 3004232784 | 3004238116 | 270 |
| 350 | iso_pu_bacteria | 3004239961 | 3004240345 | 270 |
| 351 | iso_pu_bacteria | 3004248173 | 3004252837 | 270 |
| 352 | iso_pu_bacteria | 3004268573 | 3004273132 | 270 |
| 353 | iso_pu_bacteria | 3004275668 | 3004278646 | 270 |
| 354 | iso_pu_bacteria | 3004289098 | 3004295124 | 270 |
| 355 | iso_pu_bacteria | 3004334049 | 3004339398 | 270 |
| 356 | iso_pu_bacteria | 637000159 | 637079561 | 270 |
| 357 | iso_pu_bacteria | 649633066 | 649874609 | 270 |
| 358 | iso_pu_bacteria | 8004300914 | 8004301768 | 270 |
| 359 | iso_pu_bacteria | 8004312739 | 8004321170 | 270 |
| 360 | iso_pu_bacteria | 8004361976 | 8004365565 | 270 |
| 361 | iso_pu_bacteria | 8004374579 | 8004378099 | 270 |
| 362 | iso_pu_bacteria | 8004395343 | 8004401866 | 270 |
| 363 | iso_pu_bacteria | 8004633249 | 8004634181 | 270 |
| 364 | iso_pu_bacteria | 8004695233 | 8004700628 | 270 |
| 365 | iso_pu_bacteria | 8004727605 | 8004731419 | 270 |
| 366 | iso_pu_bacteria | 8055617313 | 8055622703 | 270 |
| 367 | 3300025981 | Ga0207640_10043430 | Ga0207640_100434303 | 271 |
| 368 | iso_pu_bacteria | 2510461069 | 2510839677 | 271 |
| 369 | iso_pu_bacteria | 2510917026 | 2511174517 | 271 |
| 370 | iso_pu_bacteria | 2582581299 | 2585231481 | 271 |
| 371 | iso_pu_bacteria | 2582581308 | 2585278917 | 271 |
| 372 | iso_pu_bacteria | 2582581315 | 2585325469 | 271 |
| 373 | iso_pu_bacteria | 2582581316 | 2585329626 | 271 |
| 374 | iso_pu_bacteria | 2585427527 | 2585530714 | 271 |
| 375 | iso_pu_bacteria | 2585427530 | 2585554894 | 271 |
| 376 | iso_pu_bacteria | 2585427633 | 2585995130 | 271 |
| 377 | iso_pu_bacteria | 2585427634 | 2585999677 | 271 |
| 378 | iso_pu_bacteria | 2599185156 | 2599333754 | 271 |
| 379 | iso_pu_bacteria | 2599185210 | 2599602583 | 271 |
| 380 | iso_pu_bacteria | 2599185236 | 2599722027 | 271 |
| 381 | iso_pu_bacteria | 2600254933 | 2600375279 | 271 |
| 382 | iso_pu_bacteria | 2600255279 | 2601608664 | 271 |
| 383 | iso_pu_bacteria | 2600255308 | 2601745438 | 271 |
| 384 | iso_pu_bacteria | 2615840626 | 2616305810 | 271 |
| 385 | iso_pu_bacteria | 2615840698 | 2616553948 | 271 |
| 386 | iso_pu_bacteria | 2643221558 | 2643809994 | 271 |
| 387 | iso_pu_bacteria | 2643221634 | 2644196528 | 271 |
| 388 | iso_pu_bacteria | 2643221643 | 2644242896 | 271 |
| 389 | iso_pu_bacteria | 2667528174 | 2671115297 | 271 |
| 390 | iso_pu_bacteria | 2738541317 | 2738946530 | 271 |
| 391 | iso_pu_bacteria | 2775507049 | 2776912788 | 271 |
| 392 | iso_pu_bacteria | 2791355265 | 2793353582 | 271 |
| 393 | iso_pu_bacteria | 2818991453 | 2819639239 | 271 |
| 394 | iso_pu_bacteria | 2818991461 | 2819684102 | 271 |
| 395 | iso_pu_bacteria | 2821123053 | 2821124297 | 271 |
| 396 | iso_pu_bacteria | 2837678835 | 2837681212 | 271 |
| 397 | iso_pu_bacteria | 2838029111 | 2838031436 | 271 |
| 398 | iso_pu_bacteria | 2838736955 | 2838741210 | 271 |
| 399 | iso_pu_bacteria | 2841840854 | 2841844893 | 271 |
| 400 | iso_pu_bacteria | 2842140634 | 2842144615 | 271 |
| 401 | iso_pu_bacteria | 2842475841 | 2842477969 | 271 |
| 402 | iso_pu_bacteria | 2842482326 | 2842482863 | 271 |
| 403 | iso_pu_bacteria | 2842502639 | 2842504778 | 271 |
| 404 | iso_pu_bacteria | 2842509118 | 2842509738 | 271 |
| 405 | iso_pu_bacteria | 2842922631 | 2842924808 | 271 |
| 406 | iso_pu_bacteria | 2854896431 | 2854897195 | 271 |
| 407 | iso_pu_bacteria | 2854916844 | 2854918185 | 271 |
| 408 | iso_pu_bacteria | 2857531043 | 2857531877 | 271 |
| 409 | iso_pu_bacteria | 2891048133 | 2891051624 | 271 |
| 410 | iso_pu_bacteria | 2899803654 | 2899803788 | 271 |
| 411 | iso_pu_bacteria | 2913308742 | 2913310947 | 271 |
| 412 | iso_pu_bacteria | 2919166419 | 2919167379 | 271 |
| 413 | iso_pu_bacteria | 2919171160 | 2919171408 | 271 |
| 414 | iso_pu_bacteria | 2919408235 | 2919409318 | 271 |
| 415 | iso_pu_bacteria | 2924733363 | 2924735385 | 271 |
| 416 | iso_pu_bacteria | 2933594066 | 2933595079 | 271 |
| 417 | iso_pu_bacteria | 2995392953 | 2995393784 | 271 |
| 418 | iso_pu_bacteria | 8005682033 | 8005684559 | 271 |
| 419 | iso_pu_bacteria | 8018150411 | 8018152543 | 271 |
| 420 | iso_pu_bacteria | 8055431914 | 8055434205 | 271 |
| 421 | 3300005344 | Ga0070661_100159659 | Ga0070661_1001596592 | 272 |
| 422 | 3300053178 | Ga0500637_0009988 | Ga0500637_0009988_1639_2601 | 272 |
| 423 | 3300003203 | JGI25406J46586_10006486 | JGI25406J46586_100064866 | 273 |
| 424 | 3300005339 | Ga0070660_100019894 | Ga0070660_1000198942 | 273 |
| 425 | 3300005985 | Ga0081539_10001131 | Ga0081539_1000113140 | 273 |
| 426 | 3300006042 | Ga0075368_10023034 | Ga0075368_100230344 | 273 |
| 427 | 3300006051 | Ga0075364_10238721 | Ga0075364_102387212 | 273 |
| 428 | 3300006178 | Ga0075367_10051599 | Ga0075367_100515992 | 273 |
| 429 | 3300006353 | Ga0075370_10097326 | Ga0075370_100973262 | 273 |
| 430 | 3300009176 | Ga0105242_10546590 | Ga0105242_105465902 | 273 |
| 431 | 3300027866 | Ga0209813_10028846 | Ga0209813_100288461 | 273 |
| 432 | 3300037418 | Ga0395900_0280327 | Ga0395900_0280327_609_1439 | 273 |
| 433 | 3300048922 | Ga0496119_0000208 | Ga0496119_0000208_37609_38472 | 273 |
| 434 | 3300048929 | Ga0496126_0036343 | Ga0496126_0036343_1198_2079 | 273 |
| 435 | 3300049568 | Ga0501031_0002553 | Ga0501031_0002553_9155_10006 | 273 |
| 436 | 3300049569 | Ga0501032_0000025 | Ga0501032_0000025_67494_68345 | 273 |
| 437 | 3300049569 | Ga0501032_0206680 | Ga0501032_0206680_314_1141 | 273 |
| 438 | 3300049570 | Ga0501033_0000229 | Ga0501033_0000229_16934_17785 | 273 |
| 439 | 3300049570 | Ga0501033_0330678 | Ga0501033_0330678_202_1026 | 273 |
| 440 | 3300049571 | Ga0501034_0001654 | Ga0501034_0001654_20638_21489 | 273 |
| 441 | 3300049572 | Ga0501036_0001402 | Ga0501036_0001402_16921_17772 | 273 |
| 442 | 3300049573 | Ga0501037_0000176 | Ga0501037_0000176_31028_31879 | 273 |
| 443 | 3300049574 | Ga0501038_0000862 | Ga0501038_0000862_25112_25963 | 273 |
| 444 | 3300049575 | Ga0501039_0000003 | Ga0501039_0000003_97777_98628 | 273 |
| 445 | 3300049579 | Ga0501043_0000051 | Ga0501043_0000051_16932_17783 | 273 |
| 446 | 3300049579 | Ga0501043_0185702 | Ga0501043_0185702_391_1218 | 273 |
| 447 | 3300049580 | Ga0501046_0042431 | Ga0501046_0042431_727_1578 | 273 |
| 448 | 3300049581 | Ga0501047_0180447 | Ga0501047_0180447_876_1727 | 273 |
| 449 | 3300049822 | Ga0501035_0000102 | Ga0501035_0000102_89173_90024 | 273 |
| 450 | 3300049823 | Ga0501044_0020712 | Ga0501044_0020712_2252_3103 | 273 |
| 451 | 3300049823 | Ga0501044_0282309 | Ga0501044_0282309_529_1356 | 273 |
| 452 | 3300050491 | nmdc:mga00v17_261276_c1 | nmdc:mga00v17_261276_c1_134_970 | 273 |
| 453 | 3300003762 | Ga0055542_1001417 | Ga0055542_10014176 | 274 |
| 454 | 3300005339 | Ga0070660_100474035 | Ga0070660_1004740351 | 274 |
| 455 | 3300005459 | Ga0068867_100181272 | Ga0068867_1001812722 | 274 |
| 456 | 3300006048 | Ga0075363_100290793 | Ga0075363_1002907932 | 274 |
| 457 | 3300006051 | Ga0075364_10066637 | Ga0075364_100666374 | 274 |
| 458 | 3300006178 | Ga0075367_10067879 | Ga0075367_100678792 | 274 |
| 459 | 3300006186 | Ga0075369_10074628 | Ga0075369_100746282 | 274 |
| 460 | 3300006186 | Ga0075369_10175854 | Ga0075369_101758541 | 274 |
| 461 | 3300006880 | Ga0075429_100560990 | Ga0075429_1005609902 | 274 |
| 462 | 3300009093 | Ga0105240_10142359 | Ga0105240_101423594 | 274 |
| 463 | 3300009093 | Ga0105240_10250849 | Ga0105240_102508492 | 274 |
| 464 | 3300009174 | Ga0105241_10093597 | Ga0105241_100935972 | 274 |
| 465 | 3300009553 | Ga0105249_10212467 | Ga0105249_102124672 | 274 |
| 466 | 3300010375 | Ga0105239_10393531 | Ga0105239_103935313 | 274 |
| 467 | 3300013104 | Ga0157370_10425196 | Ga0157370_104251962 | 274 |
| 468 | 3300025254 | Ga0209148_1000056 | Ga0209148_1000056234 | 274 |
| 469 | 3300025261 | Ga0209233_1009458 | Ga0209233_10094582 | 274 |
| 470 | 3300025272 | Ga0209455_1000137 | Ga0209455_1000137129 | 274 |
| 471 | 3300025949 | Ga0207667_10222472 | Ga0207667_102224722 | 274 |
| 472 | 3300026089 | Ga0207648_10092376 | Ga0207648_100923762 | 274 |
| 473 | 3300031344 | Ga0265316_10057177 | Ga0265316_100571772 | 274 |
| 474 | 3300031824 | Ga0307413_10128578 | Ga0307413_101285782 | 274 |
| 475 | 3300041511 | Ga0451855_1869378 | Ga0451855_1869378_94_933 | 274 |
| 476 | 3300046520 | Ga0495637_0066954 | Ga0495637_0066954_68_907 | 274 |
| 477 | 3300046542 | Ga0495597_0032202 | Ga0495597_0032202_139_978 | 274 |
| 478 | 3300046616 | Ga0495668_0046834 | Ga0495668_0046834_816_1655 | 274 |
| 479 | 3300046810 | Ga0495660_0067953 | Ga0495660_0067953_215_1054 | 274 |
| 480 | 3300048913 | Ga0496110_0370540 | Ga0496110_0370540_236_1069 | 274 |
| 481 | 3300048924 | Ga0496121_0340326 | Ga0496121_0340326_137_976 | 274 |
| 482 | 3300049571 | Ga0501034_0150335 | Ga0501034_0150335_659_1519 | 274 |
| 483 | 3300049581 | Ga0501047_0018334 | Ga0501047_0018334_2523_3383 | 274 |
| 484 | 3300049823 | Ga0501044_0105376 | Ga0501044_0105376_1830_2690 | 274 |
| 485 | 3300050491 | nmdc:mga00v17_206289_c1 | nmdc:mga00v17_206289_c1_348_1187 | 274 |
| 486 | 3300050492 | nmdc:mga0yw44_26440_c1 | nmdc:mga0yw44_26440_c1_2331_3167 | 274 |
| 487 | 3300050508 | nmdc:mga09592_564724_c1 | nmdc:mga09592_564724_c1_83_937 | 274 |
| 488 | 3300053083 | Ga0495655_0018261 | Ga0495655_0018261_428_1267 | 274 |
| 489 | 3300053155 | Ga0500620_000690 | Ga0500620_000690_889_1737 | 274 |
| 490 | iso_pu_bacteria | 2513237090 | 2513609081 | 274 |
| 491 | iso_pu_bacteria | 2599185301 | 2599937998 | 274 |
| 492 | iso_pu_bacteria | 2693429783 | 2694633679 | 274 |
| 493 | iso_pu_bacteria | 2693429784 | 2694639982 | 274 |
| 494 | iso_pu_bacteria | 2856364286 | 2856364609 | 274 |
| 495 | iso_pu_bacteria | 2857349434 | 2857355865 | 274 |
| 496 | iso_pu_bacteria | 2869285874 | 2869292718 | 274 |
| 497 | iso_pu_bacteria | 2871429161 | 2871429531 | 274 |
| 498 | iso_pu_bacteria | 2874146452 | 2874146994 | 274 |
| 499 | iso_pu_bacteria | 2874155637 | 2874157026 | 274 |
| 500 | iso_pu_bacteria | 2876413966 | 2876414465 | 274 |
| 501 | iso_pu_bacteria | 2878745973 | 2878746297 | 274 |
| 502 | iso_pu_bacteria | 2889010040 | 2889012970 | 274 |
| 503 | iso_pu_bacteria | 2889016732 | 2889022162 | 274 |
| 504 | iso_pu_bacteria | 2903492973 | 2903500639 | 274 |
| 505 | iso_pu_bacteria | 2906308376 | 2906308430 | 274 |
| 506 | iso_pu_bacteria | 2906321335 | 2906321978 | 274 |
| 507 | iso_pu_bacteria | 2906354277 | 2906355772 | 274 |
| 508 | iso_pu_bacteria | 2922130491 | 2922137674 | 274 |
| 509 | iso_pu_bacteria | 2922185730 | 2922193034 | 274 |
| 510 | iso_pu_bacteria | 2937813078 | 2937814357 | 274 |
| 511 | iso_pu_bacteria | 2958041894 | 2958046732 | 274 |
| 512 | iso_pu_bacteria | 2958100919 | 2958105461 | 274 |
| 513 | iso_pu_bacteria | 2958130278 | 2958137389 | 274 |
| 514 | iso_pu_bacteria | 2958172287 | 2958177389 | 274 |
| 515 | iso_pu_bacteria | 2958179912 | 2958180234 | 274 |
| 516 | iso_pu_bacteria | 2961077736 | 2961078066 | 274 |
| 517 | iso_pu_bacteria | 2968117919 | 2968118284 | 274 |
| 518 | iso_pu_bacteria | 2977843712 | 2977844864 | 274 |
| 519 | iso_pu_bacteria | 2977942078 | 2977943844 | 274 |
| 520 | iso_pu_bacteria | 2977971508 | 2977972511 | 274 |
| 521 | iso_pu_bacteria | 2979742915 | 2979751392 | 274 |
| 522 | iso_pu_bacteria | 2987636660 | 2987639679 | 274 |
| 523 | iso_pu_bacteria | 2987652177 | 2987658667 | 274 |
| 524 | iso_pu_bacteria | 3004203850 | 3004207252 | 274 |
| 525 | iso_pu_bacteria | 8004387939 | 8004388462 | 274 |
| 526 | iso_pu_bacteria | 8004640170 | 8004641754 | 274 |
| 527 | iso_pu_bacteria | 8004714634 | 8004714686 | 274 |
| 528 | 3300001979 | JGI24740J21852_10001214 | JGI24740J21852_1000121413 | 275 |
| 529 | 3300001979 | JGI24740J21852_10052704 | JGI24740J21852_100527042 | 275 |
| 530 | 3300002704 | JGI25155J39150_1000032 | JGI25155J39150_100003244 | 275 |
| 531 | 3300002705 | JGI25156J39149_1000129 | JGI25156J39149_100012944 | 275 |
| 532 | 3300002737 | JGI25162J39368_1000676 | JGI25162J39368_10006766 | 275 |
| 533 | 3300002737 | JGI25162J39368_1001230 | JGI25162J39368_10012308 | 275 |
| 534 | 3300002738 | JGI25154J39366_1000324 | JGI25154J39366_100032424 | 275 |
| 535 | 3300002738 | JGI25154J39366_1001340 | JGI25154J39366_10013404 | 275 |
| 536 | 3300002741 | JGI25157J39369_1000061 | JGI25157J39369_100006144 | 275 |
| 537 | 3300003214 | JGI25165J46597_1000028 | JGI25165J46597_1000028190 | 275 |
| 538 | 3300003214 | JGI25165J46597_1001649 | JGI25165J46597_10016496 | 275 |
| 539 | 3300003214 | JGI25165J46597_1001657 | JGI25165J46597_10016576 | 275 |
| 540 | 3300003215 | JGI25153J46596_10016299 | JGI25153J46596_100162993 | 275 |
| 541 | 3300003323 | rootH1_10095545 | rootH1_100955451 | 275 |
| 542 | 3300003781 | Ga0055536_1001177 | Ga0055536_100117714 | 275 |
| 543 | 3300003792 | Ga0055540_1001974 | Ga0055540_10019749 | 275 |
| 544 | 3300003794 | Ga0055531_10003014 | Ga0055531_100030149 | 275 |
| 545 | 3300003856 | Ga0058692_1001868 | Ga0058692_10018686 | 275 |
| 546 | 3300005262 | Ga0065165_1002531 | Ga0065165_100253114 | 275 |
| 547 | 3300005331 | Ga0070670_100001700 | Ga0070670_10000170013 | 275 |
| 548 | 3300005539 | Ga0068853_100314655 | Ga0068853_1003146551 | 275 |
| 549 | 3300005614 | Ga0068856_100278244 | Ga0068856_1002782442 | 275 |
| 550 | 3300006051 | Ga0075364_10003667 | Ga0075364_100036676 | 275 |
| 551 | 3300006178 | Ga0075367_10110435 | Ga0075367_101104352 | 275 |
| 552 | 3300006946 | Ga0079104_1000032 | Ga0079104_100003299 | 275 |
| 553 | 3300006948 | Ga0099826_10001725 | Ga0099826_100017259 | 275 |
| 554 | 3300009093 | Ga0105240_10000032 | Ga0105240_10000032205 | 275 |
| 555 | 3300009174 | Ga0105241_10476011 | Ga0105241_104760111 | 275 |
| 556 | 3300009545 | Ga0105237_10000754 | Ga0105237_1000075416 | 275 |
| 557 | 3300009545 | Ga0105237_10697015 | Ga0105237_106970152 | 275 |
| 558 | 3300010375 | Ga0105239_10199662 | Ga0105239_101996621 | 275 |
| 559 | 3300013100 | Ga0157373_10012663 | Ga0157373_100126635 | 275 |
| 560 | 3300013104 | Ga0157370_10000972 | Ga0157370_1000097213 | 275 |
| 561 | 3300015262 | Ga0182007_10019077 | Ga0182007_100190772 | 275 |
| 562 | 3300015265 | Ga0182005_1005393 | Ga0182005_10053932 | 275 |
| 563 | 3300025206 | Ga0209435_100042 | Ga0209435_10004245 | 275 |
| 564 | 3300025233 | Ga0209437_100033 | Ga0209437_100033289 | 275 |
| 565 | 3300025233 | Ga0209437_100075 | Ga0209437_100075219 | 275 |
| 566 | 3300025233 | Ga0209437_107205 | Ga0209437_1072052 | 275 |
| 567 | 3300025246 | Ga0209646_1000145 | Ga0209646_100014545 | 275 |
| 568 | 3300025250 | Ga0209026_1000120 | Ga0209026_1000120105 | 275 |
| 569 | 3300025250 | Ga0209026_1000160 | Ga0209026_100016045 | 275 |
| 570 | 3300025253 | Ga0209677_101323 | Ga0209677_10132311 | 275 |
| 571 | 3300025256 | Ga0209759_1000177 | Ga0209759_100017745 | 275 |
| 572 | 3300025256 | Ga0209759_1000368 | Ga0209759_100036838 | 275 |
| 573 | 3300025261 | Ga0209233_1000056 | Ga0209233_100005645 | 275 |
| 574 | 3300025261 | Ga0209233_1000064 | Ga0209233_1000064133 | 275 |
| 575 | 3300025261 | Ga0209233_1000087 | Ga0209233_1000087192 | 275 |
| 576 | 3300025261 | Ga0209233_1000209 | Ga0209233_100020974 | 275 |
| 577 | 3300025292 | Ga0209676_1002466 | Ga0209676_10024668 | 275 |
| 578 | 3300025297 | Ga0209758_1000554 | Ga0209758_100055451 | 275 |
| 579 | 3300025297 | Ga0209758_1004764 | Ga0209758_10047645 | 275 |
| 580 | 3300025298 | Ga0209050_1010473 | Ga0209050_10104735 | 275 |
| 581 | 3300025303 | Ga0209051_1000459 | Ga0209051_100045924 | 275 |
| 582 | 3300025304 | Ga0209257_1002585 | Ga0209257_100258511 | 275 |
| 583 | 3300025913 | Ga0207695_10000024 | Ga0207695_10000024206 | 275 |
| 584 | 3300025914 | Ga0207671_10000718 | Ga0207671_1000071841 | 275 |
| 585 | 3300025914 | Ga0207671_10064787 | Ga0207671_100647874 | 275 |
| 586 | 3300026041 | Ga0207639_10092724 | Ga0207639_100927243 | 275 |
| 587 | 3300026041 | Ga0207639_10387256 | Ga0207639_103872562 | 275 |
| 588 | 3300026078 | Ga0207702_10145723 | Ga0207702_101457232 | 275 |
| 589 | 3300027111 | Ga0209281_1000053 | Ga0209281_1000053208 | 275 |
| 590 | 3300027312 | Ga0209371_1001029 | Ga0209371_100102923 | 275 |
| 591 | 3300027666 | Ga0209282_1000102 | Ga0209282_100010221 | 275 |
| 592 | 3300028379 | Ga0268266_10241232 | Ga0268266_102412321 | 275 |
| 593 | 3300028794 | Ga0307515_10000070 | Ga0307515_10000070169 | 275 |
| 594 | 3300030500 | Ga0268256_1001309 | Ga0268256_10013094 | 275 |
| 595 | 3300031456 | Ga0307513_10008189 | Ga0307513_100081896 | 275 |
| 596 | 3300037418 | Ga0395900_0011881 | Ga0395900_0011881_2823_3668 | 275 |
| 597 | 3300037418 | Ga0395900_0217756 | Ga0395900_0217756_389_1234 | 275 |
| 598 | 3300037471 | Ga0395905_0018071 | Ga0395905_0018071_739_1584 | 275 |
| 599 | 3300038443 | Ga0395901_0007884 | Ga0395901_0007884_4815_5660 | 275 |
| 600 | 3300038443 | Ga0395901_0030144 | Ga0395901_0030144_4041_4886 | 275 |
| 601 | 3300044658 | Ga0466972_0168153 | Ga0466972_0168153_26_871 | 275 |
| 602 | 3300044735 | Ga0466968_0060343 | Ga0466968_0060343_514_1359 | 275 |
| 603 | 3300044901 | Ga0466960_0114492 | Ga0466960_0114492_186_1031 | 275 |
| 604 | 3300046501 | Ga0495607_0102276 | Ga0495607_0102276_503_1348 | 275 |
| 605 | 3300046501 | Ga0495607_0105419 | Ga0495607_0105419_383_1216 | 275 |
| 606 | 3300046506 | Ga0495583_0004487 | Ga0495583_0004487_4587_5414 | 275 |
| 607 | 3300046507 | Ga0495606_0076436 | Ga0495606_0076436_1075_1902 | 275 |
| 608 | 3300046522 | Ga0495643_0048138 | Ga0495643_0048138_1280_2125 | 275 |
| 609 | 3300046524 | Ga0495648_0165350 | Ga0495648_0165350_39_884 | 275 |
| 610 | 3300046530 | Ga0495654_0000092 | Ga0495654_0000092_69092_69937 | 275 |
| 611 | 3300046558 | Ga0495633_0009132 | Ga0495633_0009132_3936_4763 | 275 |
| 612 | 3300046558 | Ga0495633_0126357 | Ga0495633_0126357_276_1103 | 275 |
| 613 | 3300046660 | Ga0495625_0051172 | Ga0495625_0051172_538_1365 | 275 |
| 614 | 3300046691 | Ga0495670_0203564 | Ga0495670_0203564_99_926 | 275 |
| 615 | 3300047469 | Ga0495673_0137288 | Ga0495673_0137288_71_898 | 275 |
| 616 | 3300048905 | Ga0496102_0020221 | Ga0496102_0020221_4131_4958 | 275 |
| 617 | 3300048914 | Ga0496111_0000236 | Ga0496111_0000236_9132_9977 | 275 |
| 618 | 3300048916 | Ga0496113_0090953 | Ga0496113_0090953_64_891 | 275 |
| 619 | 3300048919 | Ga0496116_0055212 | Ga0496116_0055212_530_1357 | 275 |
| 620 | 3300048920 | Ga0496117_0005581 | Ga0496117_0005581_2902_3729 | 275 |
| 621 | 3300048921 | Ga0496118_0002790 | Ga0496118_0002790_14652_15479 | 275 |
| 622 | 3300048921 | Ga0496118_0013692 | Ga0496118_0013692_4592_5422 | 275 |
| 623 | 3300048921 | Ga0496118_0052275 | Ga0496118_0052275_136_963 | 275 |
| 624 | 3300048922 | Ga0496119_0018528 | Ga0496119_0018528_1254_2081 | 275 |
| 625 | 3300048922 | Ga0496119_0030665 | Ga0496119_0030665_938_1783 | 275 |
| 626 | 3300048923 | Ga0496120_0000781 | Ga0496120_0000781_36173_37018 | 275 |
| 627 | 3300048924 | Ga0496121_0001948 | Ga0496121_0001948_12109_12948 | 275 |
| 628 | 3300048924 | Ga0496121_0004987 | Ga0496121_0004987_14579_15406 | 275 |
| 629 | 3300048924 | Ga0496121_0096399 | Ga0496121_0096399_915_1760 | 275 |
| 630 | 3300048925 | Ga0496122_0000160 | Ga0496122_0000160_104327_105172 | 275 |
| 631 | 3300048925 | Ga0496122_0019960 | Ga0496122_0019960_4972_5799 | 275 |
| 632 | 3300048925 | Ga0496122_0030419 | Ga0496122_0030419_3433_4260 | 275 |
| 633 | 3300048925 | Ga0496122_0041368 | Ga0496122_0041368_337_1182 | 275 |
| 634 | 3300048926 | Ga0496123_0000034 | Ga0496123_0000034_134005_134850 | 275 |
| 635 | 3300048926 | Ga0496123_0009397 | Ga0496123_0009397_3287_4114 | 275 |
| 636 | 3300048927 | Ga0496124_0000349 | Ga0496124_0000349_36297_37130 | 275 |
| 637 | 3300048927 | Ga0496124_0008594 | Ga0496124_0008594_9038_9865 | 275 |
| 638 | 3300048927 | Ga0496124_0037757 | Ga0496124_0037757_2659_3504 | 275 |
| 639 | 3300048927 | Ga0496124_0072319 | Ga0496124_0072319_1473_2300 | 275 |
| 640 | 3300048928 | Ga0496125_0025328 | Ga0496125_0025328_4379_5206 | 275 |
| 641 | 3300048929 | Ga0496126_0253397 | Ga0496126_0253397_190_1023 | 275 |
| 642 | 3300048929 | Ga0496126_0403878 | Ga0496126_0403878_145_972 | 275 |
| 643 | 3300049570 | Ga0501033_0000742 | Ga0501033_0000742_24501_25331 | 275 |
| 644 | 3300049571 | Ga0501034_0024556 | Ga0501034_0024556_2594_3478 | 275 |
| 645 | 3300049583 | Ga0501067_0168292 | Ga0501067_0168292_198_1076 | 275 |
| 646 | 3300049822 | Ga0501035_0000950 | Ga0501035_0000950_14441_15271 | 275 |
| 647 | 3300050491 | nmdc:mga00v17_556_c1 | nmdc:mga00v17_556_c1_16371_17210 | 275 |
| 648 | 3300053087 | Ga0500643_021878 | Ga0500643_021878_650_1483 | 275 |
| 649 | 3300053121 | Ga0500607_159938 | Ga0500607_159938_105_938 | 275 |
| 650 | 3300053125 | Ga0500618_000227 | Ga0500618_000227_26898_27743 | 275 |
| 651 | 3300053125 | Ga0500618_007584 | Ga0500618_007584_1507_2352 | 275 |
| 652 | 3300053140 | Ga0500573_0001776 | Ga0500573_0001776_5610_6440 | 275 |
| 653 | 3300053140 | Ga0500573_0012488 | Ga0500573_0012488_3882_4712 | 275 |
| 654 | 3300053153 | Ga0500616_0001544 | Ga0500616_0001544_13260_14093 | 275 |
| 655 | 3300053161 | Ga0500634_0000112 | Ga0500634_0000112_339_1172 | 275 |
| 656 | iso_pu_bacteria | 2847686936 | 2847688045 | 275 |
| 657 | iso_pu_bacteria | 2871495908 | 2871498448 | 275 |
| 658 | iso_pu_bacteria | 2874102143 | 2874103817 | 275 |
| 659 | iso_pu_bacteria | 2874123672 | 2874127563 | 275 |
| 660 | iso_pu_bacteria | 2876369609 | 2876372266 | 275 |
| 661 | iso_pu_bacteria | 2876392853 | 2876399477 | 275 |
| 662 | iso_pu_bacteria | 2878760144 | 2878762667 | 275 |
| 663 | iso_pu_bacteria | 2878767105 | 2878769633 | 275 |
| 664 | iso_pu_bacteria | 2881147464 | 2881153654 | 275 |
| 665 | iso_pu_bacteria | 2881161766 | 2881162809 | 275 |
| 666 | iso_pu_bacteria | 2885305155 | 2885311559 | 275 |
| 667 | iso_pu_bacteria | 2885326080 | 2885327065 | 275 |
| 668 | iso_pu_bacteria | 2903540706 | 2903543246 | 275 |
| 669 | iso_pu_bacteria | 2904659560 | 2904666004 | 275 |
| 670 | iso_pu_bacteria | 2906328253 | 2906331212 | 275 |
| 671 | iso_pu_bacteria | 2922158528 | 2922165445 | 275 |
| 672 | iso_pu_bacteria | 2937891427 | 2937891484 | 275 |
| 673 | iso_pu_bacteria | 2937994558 | 2937997095 | 275 |
| 674 | iso_pu_bacteria | 2958115193 | 2958116990 | 275 |
| 675 | iso_pu_bacteria | 2958165035 | 2958167565 | 275 |
| 676 | iso_pu_bacteria | 2961114664 | 2961121348 | 275 |
| 677 | iso_pu_bacteria | 2961163497 | 2961166037 | 275 |
| 678 | iso_pu_bacteria | 2965018300 | 2965020856 | 275 |
| 679 | iso_pu_bacteria | 2965062239 | 2965062816 | 275 |
| 680 | iso_pu_bacteria | 2968091066 | 2968096905 | 275 |
| 681 | iso_pu_bacteria | 2968097103 | 2968102384 | 275 |
| 682 | iso_pu_bacteria | 2968110612 | 2968117501 | 275 |
| 683 | iso_pu_bacteria | 2968128360 | 2968131096 | 275 |
| 684 | iso_pu_bacteria | 2968171901 | 2968174434 | 275 |
| 685 | iso_pu_bacteria | 2970554993 | 2970557525 | 275 |
| 686 | iso_pu_bacteria | 2977858184 | 2977862824 | 275 |
| 687 | iso_pu_bacteria | 2979779861 | 2979785945 | 275 |
| 688 | iso_pu_bacteria | 2987659509 | 2987662044 | 275 |
| 689 | iso_pu_bacteria | 2996341866 | 2996342532 | 275 |
| 690 | iso_pu_bacteria | 3004188549 | 3004191095 | 275 |
| 691 | iso_pu_bacteria | 3004211236 | 3004214644 | 275 |
| 692 | iso_pu_bacteria | 3004218560 | 3004219327 | 275 |
| 693 | iso_pu_bacteria | 8004445564 | 8004450704 | 275 |
| 694 | iso_pu_bacteria | 8004703790 | 8004710872 | 275 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tqs-assembly2.cif.gz_B | structure of the dimethyladenosine transferase (ksga) from coxiella burnetii | 0.9383 | 27 | 273 |
| 4jxj-assembly1.cif.gz_A | crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing | 0.9379 | 28 | 275 |
| 4jxj-assembly1.cif.gz_A | crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing | 0.9342 | 28 | 275 |
| 7pnt-assembly1.cif.gz_c | assembly intermediate of mouse mitochondrial ribosome small subunit without ms37 in complex with rbfa and tfb1m | 0.9288 | 27 | 274 |
| 3tqs-assembly2.cif.gz_B | structure of the dimethyladenosine transferase (ksga) from coxiella burnetii | 0.9237 | 27 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jxjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9637 | 28 | 212 | 3.40.50.150 |
| af_Q54M56_2_236_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9559 | 7 | 214 | 3.40.50.150 |
| 4jxjA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9533 | 28 | 212 | 3.40.50.150 |
| af_Q58435_1_185_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9496 | 20 | 212 | 3.40.50.150 |
| af_Q58435_1_185_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9347 | 20 | 212 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436BH90-F1-model_v4 | 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase | 0.9937 | 165 | 275 |
GO:0000179
GO:0003723 GO:0005829 |
| AF-A0A351T7M2-F1-model_v4 | 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase | 0.9863 | 27 | 204 |
GO:0000179
GO:0003723 GO:0005829 |
| AF-A0A539CV97-F1-model_v4 | Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) | 0.9848 | 1 | 274 |
GO:0003723
GO:0005829 GO:0052908 |
| AF-A0A659YI97-F1-model_v4 | deleted | 0.9818 | 90 | 249 |
|
| AF-A0A539CV97-F1-model_v4 | Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) | 0.9777 | 1 | 274 |
GO:0003723
GO:0005829 GO:0052908 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar