F475763

General Info

Members Datasets Scaffolds Average Seq Length
694 557 366 274

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0009988|Ga0500637_0009988_1639_2601
Length 320
Sequence MPSPIDLLPPLREVIAKHDLLARKSLGQHFLCDLNLTRKIASLAGDLTDCTAFEIGPGPGGLTRALVETDAKKIIAIEKDRRCIAALKDVIEASEGRLEVIEGDALKIDLIPLARSLPLTRRADARHPLPPAGGEGTQEKPLALQSREREGPVAKQREGEGQYAVVANLPYNIGTELLLGWLETIDEYKSLTLMFQAEVADRLAAEPDSKTYGRLSVITQFCCDIERVLDIPARAFTPPPKVDSAVVHLTPRKNRPKDVSFKMMGRVTAAAFGQRRKMLRSSLKPLGGEELLKRAGIKPELRAENLSVADFENLARKFGM

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
10 2512875024 Mesorhizobium loti R88b Isolate Nodule
11 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
12 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
13 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
14 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
15 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
16 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
17 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
18 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
19 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
20 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
21 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
22 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
23 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
24 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
25 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
26 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
27 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
28 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
29 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
30 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
31 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
32 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
33 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
34 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
35 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
36 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
37 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
38 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
39 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
40 2643221558 Rhizobium sp. Root149 Isolate Unclassified
41 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
42 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
43 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
44 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
45 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
46 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
47 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
48 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
49 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
50 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
51 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
52 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
53 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
54 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
55 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
56 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
57 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
58 2791355265 Rhizobium sp. H4 Isolate Nodule
59 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
60 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
61 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
62 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
63 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
64 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
65 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
66 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
67 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
68 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
69 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
70 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
71 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
72 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
73 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
74 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
75 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
76 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
77 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
78 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
79 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
80 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
81 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
82 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
83 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
84 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
85 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
86 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
87 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
88 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
89 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
90 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
91 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
92 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
93 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
94 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
95 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
96 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
97 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
98 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
99 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
100 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
101 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
102 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
103 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
104 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
105 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
106 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
107 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
108 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
109 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
110 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
111 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
112 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
113 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
114 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
115 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
116 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
117 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
118 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
119 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
120 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
121 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
122 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
123 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
124 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
125 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
126 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
127 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
128 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
129 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
130 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
131 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
132 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
133 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
134 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
135 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
136 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
137 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
138 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
139 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
140 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
141 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
142 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
143 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
144 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
145 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
146 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
147 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
148 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
149 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
150 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
151 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
152 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
153 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
154 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
155 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
156 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
157 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
158 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
159 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
160 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
161 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
162 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
163 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
164 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
165 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
166 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
167 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
168 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
169 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
170 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
171 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
172 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
173 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
174 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
175 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
176 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
177 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
178 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
179 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
180 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
181 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
182 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
183 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
184 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
185 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
186 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
187 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
188 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
189 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
190 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
191 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
192 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
193 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
194 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
195 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
196 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
197 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
198 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
199 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
200 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
201 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
202 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
203 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
204 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
205 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
206 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
207 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
208 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
209 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
210 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
211 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
212 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
213 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
214 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
215 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
216 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
217 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
218 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
219 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
220 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
221 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
222 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
223 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
224 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
225 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
226 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
227 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
228 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
229 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
230 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
231 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
232 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
233 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
234 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
235 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
236 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
237 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
238 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
239 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
240 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
241 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
242 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
243 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
244 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
245 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
246 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
247 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
248 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
249 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
250 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
251 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
252 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
253 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
254 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
255 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
256 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
257 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
258 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
259 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
260 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
261 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
262 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
263 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
264 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
265 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
266 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
267 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
268 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
269 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
270 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
271 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
272 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
273 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
274 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
275 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
276 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
277 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
278 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
279 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
280 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
281 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
282 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
283 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
284 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
285 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
286 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
287 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
288 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
289 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
290 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
291 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
292 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
293 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
294 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
295 3004167301 Mesorhizobium loti 582 Isolate Unclassified
296 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
297 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
298 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
299 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
300 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
301 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
302 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
303 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
304 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
305 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
306 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
307 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
308 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
309 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
310 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
311 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
312 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
313 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
314 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
315 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
316 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
317 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
318 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
319 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
320 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
321 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
322 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
323 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
324 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
325 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
326 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
327 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
328 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
329 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
330 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
331 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
332 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
333 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
334 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
335 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
336 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
337 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
338 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
339 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
340 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
341 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
342 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
343 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
344 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
345 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
346 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
347 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
348 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
349 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
350 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
351 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
352 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
353 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
354 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
355 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
356 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
357 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
358 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
359 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
360 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
361 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
362 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
363 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
364 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
365 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
366 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
367 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
368 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
369 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
370 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
371 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
372 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
373 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
374 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
375 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
376 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
377 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
378 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
379 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
380 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
381 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
382 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
383 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
384 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
385 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
386 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
387 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
388 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
389 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
390 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
391 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
392 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
393 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
394 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
396 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
397 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
398 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
399 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
400 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
420 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
421 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
422 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
423 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
424 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
428 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
429 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
430 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
431 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
432 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
433 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
434 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
435 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
436 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
437 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
438 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
439 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
440 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
441 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
442 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
443 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
444 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
445 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
446 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
447 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
448 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
449 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
450 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
451 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
452 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
453 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
454 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
455 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
456 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
457 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
458 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
459 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
460 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
461 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
462 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
463 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
464 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
465 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
466 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
467 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
468 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
469 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
470 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
471 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
472 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
473 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
474 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
475 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
476 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
477 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
478 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
479 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
480 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
481 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
482 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
483 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
484 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
485 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
486 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
487 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
488 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
489 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
490 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
491 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
492 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
494 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
495 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
496 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
497 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
498 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
499 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
500 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
501 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
502 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
503 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
504 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
505 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
506 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
507 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
509 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
510 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
511 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
512 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
513 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
514 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
515 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
516 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
517 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
518 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
519 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
520 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
521 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
522 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
523 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
524 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
525 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
526 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
527 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
528 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
529 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
530 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
531 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
532 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
533 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
534 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
535 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
536 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
537 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
538 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
539 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
540 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
541 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
542 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
543 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
544 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
545 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
546 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
547 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
548 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
549 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
550 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
551 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
552 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
553 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
554 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
555 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
556 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
557 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.74
Metatranscriptomes 0
Isolates 47.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.24
Nodule 35.45
Rhizoplane 2.45
Rhizosphere 32.85
Stem 0
Stem Tuber 0
Unclassified 18.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001214 3300001979 Bacteria 11651
2 JGI24740J21852_10004386 3300001979 Bacteria 6067
3 JGI24740J21852_10052704 3300001979 Bacteria 1157
4 JGI25155J39150_1000032 3300002704 Bacteria 105511
5 JGI25156J39149_1000129 3300002705 Bacteria 54812
6 JGI25162J39368_1000676 3300002737 Bacteria 23903
7 JGI25162J39368_1001230 3300002737 Bacteria 14797
8 JGI25154J39366_1000324 3300002738 Bacteria 27739
9 JGI25154J39366_1001340 3300002738 Bacteria 9024
10 JGI25157J39369_1000061 3300002741 Bacteria 105511
11 JGI25151J46595_10000192 3300003187 Bacteria 75239
12 JGI25406J46586_10006486 3300003203 Bacteria 5384
13 JGI25165J46597_1000028 3300003214 Bacteria 325146
14 JGI25165J46597_1001649 3300003214 Bacteria 10326
15 JGI25165J46597_1001657 3300003214 Bacteria 10216
16 JGI25153J46596_10016299 3300003215 Bacteria 2984
17 rootH1_10095545 3300003323 Bacteria 1152
18 Ga0055542_1001417 3300003762 Bacteria 12078
19 Ga0055536_1001177 3300003781 Bacteria 16274
20 Ga0055540_1001974 3300003792 Bacteria 11464
21 Ga0055531_10003014 3300003794 Bacteria 10927
22 Ga0058692_1001868 3300003856 Bacteria 7390
23 Ga0065165_1002531 3300005262 Bacteria 15197
24 Ga0070683_100183995 3300005329 Bacteria 1983
25 Ga0070670_100001700 3300005331 Bacteria 17910
26 Ga0070670_100080028 3300005331 Bacteria 2808
27 Ga0068869_100052973 3300005334 Bacteria 2948
28 Ga0070680_100172908 3300005336 Bacteria 1818
29 Ga0070660_100019894 3300005339 Bacteria 4925
30 Ga0070660_100474035 3300005339 Bacteria 1040
31 Ga0070661_100159659 3300005344 Bacteria 1707
32 Ga0070668_100008467 3300005347 Bacteria 7639
33 Ga0070669_100046389 3300005353 Bacteria 3169
34 Ga0070675_100093086 3300005354 Bacteria 2528
35 Ga0070674_100006650 3300005356 Bacteria 6760
36 Ga0070667_100023391 3300005367 Bacteria 5126
37 Ga0070681_10006925 3300005458 Bacteria 11038
38 Ga0070681_10007314 3300005458 Bacteria 10782
39 Ga0068867_100138010 3300005459 Bacteria 1903
40 Ga0068867_100181272 3300005459 Bacteria 1675
41 Ga0068853_100256899 3300005539 Bacteria 1605
42 Ga0068853_100314655 3300005539 Bacteria 1450
43 Ga0070672_100083788 3300005543 Bacteria 2559
44 Ga0070696_100057745 3300005546 Bacteria 2709
45 Ga0070665_100029356 3300005548 Bacteria 5536
46 Ga0068855_100029275 3300005563 Bacteria 6586
47 Ga0068855_100514237 3300005563 Bacteria 1300
48 Ga0068856_100241901 3300005614 Bacteria 1820
49 Ga0068856_100278244 3300005614 Bacteria 1690
50 Ga0068852_100065931 3300005616 Bacteria 3160
51 Ga0068852_100089570 3300005616 Bacteria 2750
52 Ga0068864_100101980 3300005618 Bacteria 2546
53 Ga0068861_100395306 3300005719 Bacteria 1225
54 Ga0068860_100035203 3300005843 Bacteria 4804
55 Ga0068862_100007560 3300005844 Bacteria 9007
56 Ga0068862_100026297 3300005844 Bacteria 4891
57 Ga0081539_10001131 3300005985 Bacteria 48406
58 Ga0075365_10005167 3300006038 Bacteria 7016
59 Ga0075368_10023034 3300006042 Bacteria 2375
60 Ga0075363_100022794 3300006048 Bacteria 3168
61 Ga0075363_100290793 3300006048 Bacteria 947
62 Ga0075364_10003667 3300006051 Bacteria 8756
63 Ga0075364_10025065 3300006051 Bacteria 3794
64 Ga0075364_10066637 3300006051 Bacteria 2365
65 Ga0075364_10238721 3300006051 Bacteria 1234
66 Ga0075367_10034225 3300006178 Bacteria 2933
67 Ga0075367_10051599 3300006178 Bacteria 2431
68 Ga0075367_10067879 3300006178 Bacteria 2138
69 Ga0075367_10110435 3300006178 Bacteria 1687
70 Ga0075369_10074628 3300006186 Bacteria 1496
71 Ga0075369_10175854 3300006186 Bacteria 984
72 Ga0075370_10025852 3300006353 Bacteria 3249
73 Ga0075370_10097326 3300006353 Bacteria 1701
74 Ga0075428_100416352 3300006844 Bacteria 1440
75 Ga0075430_100183521 3300006846 Bacteria 1740
76 Ga0075430_100185697 3300006846 Bacteria 1729
77 Ga0075431_100206251 3300006847 Bacteria 2009
78 Ga0075433_10252023 3300006852 Bacteria 1566
79 Ga0075429_100560990 3300006880 Bacteria 1001
80 Ga0079104_1000032 3300006946 Bacteria 203094
81 Ga0099826_10001725 3300006948 Bacteria 13474
82 Ga0105240_10000032 3300009093 Bacteria 283907
83 Ga0105240_10013259 3300009093 Bacteria 11335
84 Ga0105240_10142359 3300009093 Bacteria 2866
85 Ga0105240_10250849 3300009093 Bacteria 2047
86 Ga0111539_10119641 3300009094 Bacteria 3086
87 Ga0114129_10312268 3300009147 Unclassified 2092
88 Ga0105241_10093597 3300009174 Bacteria 2375
89 Ga0105241_10476011 3300009174 Bacteria 1109
90 Ga0105242_10546590 3300009176 Bacteria 1110
91 Ga0105248_10360355 3300009177 Bacteria 1637
92 Ga0105237_10000754 3300009545 Bacteria 44371
93 Ga0105237_10697015 3300009545 Bacteria 1022
94 Ga0105238_10321139 3300009551 Bacteria 1534
95 Ga0105238_10553860 3300009551 Bacteria 1154
96 Ga0105249_10212467 3300009553 Bacteria 1899
97 Ga0105239_10058313 3300010375 Bacteria 4236
98 Ga0105239_10067623 3300010375 Bacteria 3925
99 Ga0105239_10199662 3300010375 Bacteria 2240
100 Ga0105239_10393531 3300010375 Bacteria 1568
101 Ga0105239_10554858 3300010375 Bacteria 1308
102 Ga0157373_10012663 3300013100 Bacteria 6202
103 Ga0157371_10017171 3300013102 Bacteria 5381
104 Ga0157370_10000972 3300013104 Bacteria 36292
105 Ga0157370_10068924 3300013104 Bacteria 3342
106 Ga0157370_10425196 3300013104 Bacteria 1222
107 Ga0157369_10057945 3300013105 Bacteria 4179
108 Ga0157374_10226926 3300013296 Bacteria 1834
109 Ga0157372_10220544 3300013307 Bacteria 2198
110 Ga0182008_10029256 3300014497 Bacteria 2784
111 Ga0182007_10019077 3300015262 Bacteria 2472
112 Ga0182005_1005393 3300015265 Bacteria 3999
113 Ga0213872_10000693 3300021361 Bacteria 25305
114 Ga0213872_10008428 3300021361 Bacteria 4991
115 Ga0213874_10029116 3300021377 Bacteria 1583
116 Ga0213876_10000134 3300021384 Bacteria 80875
117 Ga0209435_100042 3300025206 Bacteria 105563
118 Ga0209437_100033 3300025233 Bacteria 512520
119 Ga0209437_100075 3300025233 Bacteria 297202
120 Ga0209437_107205 3300025233 Bacteria 1821
121 Ga0209646_1000145 3300025246 Bacteria 105563
122 Ga0209026_1000120 3300025250 Bacteria 130091
123 Ga0209026_1000160 3300025250 Bacteria 105563
124 Ga0209677_101323 3300025253 Bacteria 10926
125 Ga0209148_1000056 3300025254 Bacteria 363380
126 Ga0209759_1000177 3300025256 Bacteria 105563
127 Ga0209759_1000368 3300025256 Bacteria 56484
128 Ga0209233_1000056 3300025261 Bacteria 438104
129 Ga0209233_1000064 3300025261 Bacteria 392156
130 Ga0209233_1000087 3300025261 Bacteria 325225
131 Ga0209233_1000209 3300025261 Bacteria 115124
132 Ga0209233_1009458 3300025261 Bacteria 2964
133 Ga0209455_1000137 3300025272 Bacteria 142099
134 Ga0209676_1002466 3300025292 Bacteria 13070
135 Ga0209025_1000077 3300025294 Bacteria 271958
136 Ga0209758_1000554 3300025297 Bacteria 59218
137 Ga0209758_1003923 3300025297 Bacteria 12985
138 Ga0209758_1004764 3300025297 Bacteria 11008
139 Ga0209050_1010473 3300025298 Bacteria 4564
140 Ga0209051_1000459 3300025303 Bacteria 53735
141 Ga0209257_1002585 3300025304 Bacteria 17600
142 Ga0207707_10010344 3300025912 Bacteria 8095
143 Ga0207707_10028728 3300025912 Bacteria 4859
144 Ga0207695_10000024 3300025913 Bacteria 632311
145 Ga0207695_10003143 3300025913 Bacteria 23591
146 Ga0207695_10015043 3300025913 Bacteria 9131
147 Ga0207671_10000718 3300025914 Bacteria 42274
148 Ga0207671_10064787 3300025914 Bacteria 2717
149 Ga0207660_10077156 3300025917 Bacteria 2438
150 Ga0207660_10110648 3300025917 Bacteria 2067
151 Ga0207657_10090293 3300025919 Bacteria 2557
152 Ga0207681_10140543 3300025923 Bacteria 1797
153 Ga0207650_10025936 3300025925 Bacteria 4178
154 Ga0207659_10044372 3300025926 Bacteria 3128
155 Ga0207711_10262745 3300025941 Bacteria 1587
156 Ga0207689_10065924 3300025942 Bacteria 2978
157 Ga0207667_10020984 3300025949 Bacteria 7245
158 Ga0207667_10222472 3300025949 Bacteria 1934
159 Ga0207712_10059712 3300025961 Bacteria 2700
160 Ga0207668_10001888 3300025972 Bacteria 12260
161 Ga0207640_10043430 3300025981 Bacteria 2873
162 Ga0207658_10016989 3300025986 Bacteria 5008
163 Ga0207639_10092724 3300026041 Bacteria 2421
164 Ga0207639_10387256 3300026041 Bacteria 1257
165 Ga0207702_10145723 3300026078 Bacteria 2149
166 Ga0207648_10079288 3300026089 Bacteria 2864
167 Ga0207648_10083342 3300026089 Bacteria 2789
168 Ga0207648_10092376 3300026089 Bacteria 2646
169 Ga0209281_1000053 3300027111 Bacteria 309587
170 Ga0209371_1001029 3300027312 Bacteria 21140
171 Ga0209282_1000102 3300027666 Bacteria 57412
172 Ga0209813_10028846 3300027866 Bacteria 1621
173 Ga0207428_10142070 3300027907 Bacteria 1831
174 Ga0268266_10044390 3300028379 Bacteria 3800
175 Ga0268266_10241232 3300028379 Bacteria 1668
176 Ga0268266_10246104 3300028379 Bacteria 1652
177 Ga0268265_10048603 3300028380 Bacteria 3185
178 Ga0268264_10021248 3300028381 Bacteria 5303
179 Ga0307515_10000070 3300028794 Bacteria 239322
180 Ga0265338_10030725 3300028800 Bacteria 5282
181 Ga0268256_1001309 3300030500 Bacteria 15327
182 Ga0265331_10002627 3300031250 Bacteria 12061
183 Ga0265331_10028764 3300031250 Bacteria 2778
184 Ga0265327_10000190 3300031251 Bacteria 130086
185 Ga0265316_10027899 3300031344 Bacteria 4667
186 Ga0265316_10057177 3300031344 Bacteria 3043
187 Ga0307513_10008189 3300031456 Bacteria 13404
188 Ga0307516_10000004 3300031730 Bacteria 367451
189 Ga0307413_10128578 3300031824 Bacteria 1730
190 Ga0307410_10120870 3300031852 Bacteria 1910
191 Ga0307407_10194377 3300031903 Bacteria 1355
192 Ga0307416_100227722 3300032002 Bacteria 1794
193 Ga0395899_0000213 3300037312 Bacteria 83403
194 Ga0395899_0141708 3300037312 Bacteria 1710
195 Ga0395899_0511327 3300037312 Bacteria 778
196 Ga0395900_0000121 3300037418 Bacteria 135026
197 Ga0395900_0011881 3300037418 Bacteria 8903
198 Ga0395900_0217756 3300037418 Bacteria 1926
199 Ga0395900_0246857 3300037418 Bacteria 1788
200 Ga0395900_0280327 3300037418 Bacteria 1659
201 Ga0395898_0000247 3300037466 Bacteria 135026
202 Ga0395898_0085187 3300037466 Bacteria 3046
203 Ga0395898_0603117 3300037466 Bacteria 1041
204 Ga0395905_0000112 3300037471 Bacteria 135010
205 Ga0395905_0018071 3300037471 Bacteria 6694
206 Ga0395905_0055874 3300037471 Bacteria 3695
207 Ga0436364_1313619 3300037853 Bacteria 1395
208 Ga0395901_0000078 3300038443 Bacteria 135026
209 Ga0395901_0007884 3300038443 Bacteria 10743
210 Ga0395901_0030144 3300038443 Bacteria 5588
211 Ga0395901_0064543 3300038443 Bacteria 3812
212 Ga0400483_138427 3300039062 Bacteria 1445
213 Ga0400483_157157 3300039062 Bacteria 2691
214 Ga0400483_178012 3300039062 Bacteria 2457
215 Ga0436365_0881464 3300039437 Bacteria 1800
216 Ga0436365_1830840 3300039437 Bacteria 45078
217 Ga0436361_0187236 3300039447 Bacteria 14656
218 Ga0436361_0206950 3300039447 Bacteria 229672
219 Ga0436363_1297661 3300039450 Bacteria 5607
220 Ga0451855_1869378 3300041511 Bacteria 973
221 Ga0466972_0168153 3300044658 Bacteria 1029
222 Ga0453684_0061971 3300044712 Bacteria 4795
223 Ga0466968_0060343 3300044735 Bacteria 1635
224 Ga0466960_0114492 3300044901 Bacteria 1405
225 Ga0451576_0002273 3300045051 Bacteria 29322
226 Ga0495638_0002756 3300046460 Bacteria 14121
227 Ga0495607_0102276 3300046501 Bacteria 1533
228 Ga0495607_0105419 3300046501 Bacteria 1503
229 Ga0495583_0004487 3300046506 Bacteria 9971
230 Ga0495606_0011595 3300046507 Bacteria 7167
231 Ga0495606_0076436 3300046507 Bacteria 2093
232 Ga0495610_0021290 3300046512 Bacteria 3570
233 Ga0495637_0066954 3300046520 Bacteria 1459
234 Ga0495643_0048138 3300046522 Bacteria 2306
235 Ga0495648_0165350 3300046524 Bacteria 1139
236 Ga0495654_0000092 3300046530 Bacteria 101504
237 Ga0495597_0032202 3300046542 Bacteria 2380
238 Ga0495633_0009132 3300046558 Bacteria 5504
239 Ga0495633_0126357 3300046558 Bacteria 1183
240 Ga0495656_0161522 3300046615 Bacteria 1089
241 Ga0495668_0046834 3300046616 Bacteria 2402
242 Ga0495625_0051172 3300046660 Bacteria 2962
243 Ga0495669_0000001 3300046684 Bacteria 291866
244 Ga0495613_0000964 3300046689 Bacteria 22013
245 Ga0495670_0203564 3300046691 Bacteria 1049
246 Ga0495660_0067953 3300046810 Bacteria 1897
247 Ga0495673_0137288 3300047469 Bacteria 956
248 Ga0496102_0020221 3300048905 Bacteria 5881
249 Ga0496107_0173742 3300048910 Bacteria 1599
250 Ga0496110_0370540 3300048913 Bacteria 1305
251 Ga0496111_0000236 3300048914 Bacteria 26454
252 Ga0496111_0431528 3300048914 Bacteria 973
253 Ga0496112_0010289 3300048915 Bacteria 8481
254 Ga0496113_0090953 3300048916 Bacteria 2352
255 Ga0496116_0000036 3300048919 Bacteria 388508
256 Ga0496116_0000123 3300048919 Bacteria 161733
257 Ga0496116_0055212 3300048919 Bacteria 2610
258 Ga0496117_0005581 3300048920 Bacteria 13162
259 Ga0496117_0013040 3300048920 Bacteria 7276
260 Ga0496118_0002790 3300048921 Bacteria 22870
261 Ga0496118_0003518 3300048921 Bacteria 19619
262 Ga0496118_0013692 3300048921 Bacteria 7654
263 Ga0496118_0052275 3300048921 Bacteria 3118
264 Ga0496119_0000208 3300048922 Bacteria 83742
265 Ga0496119_0018528 3300048922 Bacteria 5175
266 Ga0496119_0030665 3300048922 Bacteria 3620
267 Ga0496120_0000781 3300048923 Bacteria 46067
268 Ga0496121_0001948 3300048924 Bacteria 32895
269 Ga0496121_0004987 3300048924 Bacteria 17381
270 Ga0496121_0096399 3300048924 Bacteria 2295
271 Ga0496121_0340326 3300048924 Bacteria 1003
272 Ga0496122_0000160 3300048925 Bacteria 159236
273 Ga0496122_0004196 3300048925 Bacteria 18127
274 Ga0496122_0006797 3300048925 Bacteria 12992
275 Ga0496122_0019960 3300048925 Bacteria 6092
276 Ga0496122_0030419 3300048925 Bacteria 4523
277 Ga0496122_0041368 3300048925 Bacteria 3645
278 Ga0496122_0078027 3300048925 Bacteria 2322
279 Ga0496123_0000034 3300048926 Bacteria 274836
280 Ga0496123_0004429 3300048926 Bacteria 14773
281 Ga0496123_0009397 3300048926 Bacteria 8809
282 Ga0496124_0000349 3300048927 Bacteria 84498
283 Ga0496124_0006016 3300048927 Bacteria 13378
284 Ga0496124_0008594 3300048927 Bacteria 10654
285 Ga0496124_0037757 3300048927 Bacteria 4198
286 Ga0496124_0072319 3300048927 Bacteria 2856
287 Ga0496124_0282378 3300048927 Bacteria 1209
288 Ga0496124_0316671 3300048927 Bacteria 1119
289 Ga0496125_0025328 3300048928 Bacteria 5435
290 Ga0496126_0000156 3300048929 Bacteria 158537
291 Ga0496126_0036343 3300048929 Bacteria 4606
292 Ga0496126_0233016 3300048929 Bacteria 1542
293 Ga0496126_0253397 3300048929 Bacteria 1466
294 Ga0496126_0403878 3300048929 Bacteria 1107
295 Ga0501031_0002553 3300049568 Bacteria 11599
296 Ga0501032_0000025 3300049569 Bacteria 138521
297 Ga0501032_0206680 3300049569 Bacteria 1281
298 Ga0501033_0000229 3300049570 Bacteria 54036
299 Ga0501033_0000742 3300049570 Bacteria 29975
300 Ga0501033_0330678 3300049570 Bacteria 1069
301 Ga0501034_0000189 3300049571 Bacteria 115780
302 Ga0501034_0001654 3300049571 Bacteria 28764
303 Ga0501034_0024556 3300049571 Bacteria 6131
304 Ga0501034_0150335 3300049571 Bacteria 2305
305 Ga0501034_0435433 3300049571 Bacteria 1230
306 Ga0501036_0001402 3300049572 Bacteria 18518
307 Ga0501037_0000176 3300049573 Bacteria 60011
308 Ga0501038_0000862 3300049574 Bacteria 26891
309 Ga0501039_0000003 3300049575 Bacteria 357424
310 Ga0501043_0000051 3300049579 Bacteria 106957
311 Ga0501043_0168340 3300049579 Bacteria 1710
312 Ga0501043_0185702 3300049579 Bacteria 1619
313 Ga0501046_0042431 3300049580 Bacteria 3628
314 Ga0501047_0018334 3300049581 Bacteria 6708
315 Ga0501047_0025612 3300049581 Bacteria 5671
316 Ga0501047_0029991 3300049581 Bacteria 5244
317 Ga0501047_0050464 3300049581 Bacteria 4018
318 Ga0501047_0180447 3300049581 Bacteria 1978
319 Ga0501067_0168292 3300049583 Bacteria 1221
320 Ga0501071_0144515 3300049587 Bacteria 1773
321 Ga0501072_0133088 3300049588 Bacteria 1983
322 Ga0501080_0011665 3300049742 Bacteria 8049
323 Ga0501083_0016175 3300049744 Bacteria 5223
324 Ga0501035_0000102 3300049822 Bacteria 106915
325 Ga0501035_0000950 3300049822 Bacteria 30620
326 Ga0501044_0020712 3300049823 Bacteria 7019
327 Ga0501044_0105376 3300049823 Bacteria 2832
328 Ga0501044_0282309 3300049823 Bacteria 1594
329 nmdc:mga03n38_106237_c1 3300050490 Bacteria 1361
330 nmdc:mga00v17_206289_c1 3300050491 Bacteria 1271
331 nmdc:mga00v17_21259_c1 3300050491 Bacteria 3729
332 nmdc:mga00v17_261276_c1 3300050491 Bacteria 1123
333 nmdc:mga00v17_556_c1 3300050491 Bacteria 20858
334 nmdc:mga0yw44_19023_c1 3300050492 Bacteria 3778
335 nmdc:mga0yw44_26440_c1 3300050492 Bacteria 3315
336 nmdc:mga0k408_49705_c1 3300050493 Bacteria 2427
337 nmdc:mga06z11_24472_c1 3300050494 Bacteria 2849
338 nmdc:mga07m45_24675_c1 3300050496 Bacteria 3295
339 nmdc:mga05p37_100388_c1 3300050507 Bacteria 3564
340 nmdc:mga09592_564724_c1 3300050508 Bacteria 977
341 nmdc:mga0qj67_84686_c1 3300050509 Bacteria 2542
342 nmdc:mga08y16_62367_c1 3300050511 Bacteria 3893
343 nmdc:mga0n895_8900_c1 3300050512 Bacteria 8746
344 nmdc:mga0a205_336780_c1 3300050515 Bacteria 1378
345 Ga0495655_0018261 3300053083 Bacteria 1539
346 Ga0500643_021878 3300053087 Bacteria 2068
347 Ga0500562_000800 3300053108 Bacteria 7686
348 Ga0500572_001733 3300053111 Bacteria 5661
349 Ga0500595_004093 3300053119 Bacteria 6617
350 Ga0500607_159938 3300053121 Bacteria 1031
351 Ga0500608_067653 3300053122 Bacteria 1702
352 Ga0500618_000227 3300053125 Bacteria 44231
353 Ga0500618_007584 3300053125 Bacteria 3082
354 Ga0500652_006919 3300053131 Bacteria 3681
355 Ga0500573_0001776 3300053140 Bacteria 10485
356 Ga0500573_0012488 3300053140 Bacteria 4770
357 Ga0500616_0001544 3300053153 Bacteria 21664
358 Ga0500616_0006086 3300053153 Bacteria 7991
359 Ga0500620_000690 3300053155 Bacteria 5782
360 Ga0500627_0163785 3300053158 Bacteria 1003
361 Ga0500633_0075135 3300053160 Bacteria 1214
362 Ga0500634_0000112 3300053161 Bacteria 30260
363 Ga0500634_0068617 3300053161 Bacteria 1862
364 Ga0500636_0067626 3300053177 Bacteria 2075
365 Ga0500637_0009988 3300053178 Bacteria 4854
366 Ga0501082_0000811 3300060353 Bacteria 27462

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100172908 Ga0070680_1001729082 196
2 3300005546 Ga0070696_100057745 Ga0070696_1000577452 196
3 3300025917 Ga0207660_10110648 Ga0207660_101106482 196
4 3300026089 Ga0207648_10083342 Ga0207648_100833422 196
5 3300006852 Ga0075433_10252023 Ga0075433_102520232 210
6 3300009094 Ga0111539_10119641 Ga0111539_101196411 210
7 3300027907 Ga0207428_10142070 Ga0207428_101420703 210
8 3300050511 nmdc:mga08y16_62367_c1 nmdc:mga08y16_62367_c1_10_693 210
9 3300050512 nmdc:mga0n895_8900_c1 nmdc:mga0n895_8900_c1_1246_1929 210
10 3300050515 nmdc:mga0a205_336780_c1 nmdc:mga0a205_336780_c1_344_1027 210
11 iso_pu_bacteria 2844533157 2844533647 216
12 3300031852 Ga0307410_10120870 Ga0307410_101208702 226
13 3300032002 Ga0307416_100227722 Ga0307416_1002277222 226
14 3300046615 Ga0495656_0161522 Ga0495656_0161522_25_708 227
15 3300037312 Ga0395899_0511327 Ga0395899_0511327_73_765 229
16 iso_pu_bacteria 2938014810 2938015505 229
17 3300037466 Ga0395898_0603117 Ga0395898_0603117_14_715 230
18 iso_pu_bacteria 2924754689 2924756390 233
19 3300009147 Ga0114129_10312268 Ga0114129_103122682 241
20 3300006844 Ga0075428_100416352 Ga0075428_1004163522 242
21 3300006846 Ga0075430_100185697 Ga0075430_1001856971 242
22 3300006847 Ga0075431_100206251 Ga0075431_1002062512 242
23 3300050507 nmdc:mga05p37_100388_c1 nmdc:mga05p37_100388_c1_652_1437 242
24 3300049571 Ga0501034_0435433 Ga0501034_0435433_167_1003 246
25 3300049581 Ga0501047_0050464 Ga0501047_0050464_214_1050 246
26 3300001979 JGI24740J21852_10004386 JGI24740J21852_100043861 249
27 3300005563 Ga0068855_100514237 Ga0068855_1005142372 249
28 3300005616 Ga0068852_100089570 Ga0068852_1000895703 249
29 3300006038 Ga0075365_10005167 Ga0075365_100051676 249
30 3300006048 Ga0075363_100022794 Ga0075363_1000227943 249
31 3300006051 Ga0075364_10025065 Ga0075364_100250653 249
32 3300006178 Ga0075367_10034225 Ga0075367_100342252 249
33 3300006353 Ga0075370_10025852 Ga0075370_100258522 249
34 3300013296 Ga0157374_10226926 Ga0157374_102269262 249
35 3300048929 Ga0496126_0233016 Ga0496126_0233016_457_1296 249
36 3300050490 nmdc:mga03n38_106237_c1 nmdc:mga03n38_106237_c1_250_1089 249
37 3300050491 nmdc:mga00v17_21259_c1 nmdc:mga00v17_21259_c1_1420_2259 249
38 3300050492 nmdc:mga0yw44_19023_c1 nmdc:mga0yw44_19023_c1_2177_3016 249
39 3300050494 nmdc:mga06z11_24472_c1 nmdc:mga06z11_24472_c1_1443_2282 249
40 3300050496 nmdc:mga07m45_24675_c1 nmdc:mga07m45_24675_c1_2132_2971 249
41 3300039062 Ga0400483_138427 Ga0400483_138427_11_847 254
42 3300005354 Ga0070675_100093086 Ga0070675_1000930863 257
43 3300005356 Ga0070674_100006650 Ga0070674_1000066505 257
44 3300005543 Ga0070672_100083788 Ga0070672_1000837881 257
45 3300005548 Ga0070665_100029356 Ga0070665_1000293563 257
46 3300010375 Ga0105239_10554858 Ga0105239_105548582 257
47 3300025919 Ga0207657_10090293 Ga0207657_100902932 257
48 3300025926 Ga0207659_10044372 Ga0207659_100443723 257
49 3300028379 Ga0268266_10246104 Ga0268266_102461042 257
50 3300003187 JGI25151J46595_10000192 JGI25151J46595_1000019253 258
51 3300025294 Ga0209025_1000077 Ga0209025_1000077223 258
52 3300025297 Ga0209758_1003923 Ga0209758_10039234 258
53 3300046512 Ga0495610_0021290 Ga0495610_0021290_2380_3177 258
54 3300005614 Ga0068856_100241901 Ga0068856_1002419012 260
55 3300026089 Ga0207648_10079288 Ga0207648_100792882 260
56 3300013102 Ga0157371_10017171 Ga0157371_100171713 261
57 3300013105 Ga0157369_10057945 Ga0157369_100579452 261
58 3300048919 Ga0496116_0000036 Ga0496116_0000036_288031_288861 261
59 3300048925 Ga0496122_0006797 Ga0496122_0006797_5933_6763 261
60 3300048925 Ga0496122_0078027 Ga0496122_0078027_262_1092 261
61 3300048927 Ga0496124_0282378 Ga0496124_0282378_306_1136 261
62 3300053111 Ga0500572_001733 Ga0500572_001733_4471_5304 261
63 3300053177 Ga0500636_0067626 Ga0500636_0067626_504_1337 261
64 iso_pu_bacteria 2876377896 2876379667 261
65 3300037312 Ga0395899_0000213 Ga0395899_0000213_52389_53183 262
66 3300037418 Ga0395900_0000121 Ga0395900_0000121_104012_104806 262
67 3300037466 Ga0395898_0000247 Ga0395898_0000247_30221_31015 262
68 3300037471 Ga0395905_0000112 Ga0395905_0000112_30205_30999 262
69 3300038443 Ga0395901_0000078 Ga0395901_0000078_104012_104806 262
70 3300048919 Ga0496116_0000123 Ga0496116_0000123_145280_146101 262
71 3300048920 Ga0496117_0013040 Ga0496117_0013040_3351_4172 262
72 3300048921 Ga0496118_0003518 Ga0496118_0003518_4255_5076 262
73 3300048927 Ga0496124_0316671 Ga0496124_0316671_95_910 262
74 3300048929 Ga0496126_0000156 Ga0496126_0000156_87592_88422 262
75 3300053160 Ga0500633_0075135 Ga0500633_0075135_47_895 262
76 3300050493 nmdc:mga0k408_49705_c1 nmdc:mga0k408_49705_c1_1552_2361 264
77 3300010375 Ga0105239_10058313 Ga0105239_100583134 265
78 3300031344 Ga0265316_10027899 Ga0265316_100278994 265
79 iso_pu_bacteria 2854681122 2854683558 265
80 3300006846 Ga0075430_100183521 Ga0075430_1001835212 266
81 3300009093 Ga0105240_10013259 Ga0105240_100132597 266
82 3300009551 Ga0105238_10553860 Ga0105238_105538602 266
83 3300021377 Ga0213874_10029116 Ga0213874_100291162 266
84 3300021384 Ga0213876_10000134 Ga0213876_1000013467 266
85 3300025913 Ga0207695_10003143 Ga0207695_100031437 266
86 3300031903 Ga0307407_10194377 Ga0307407_101943772 266
87 3300037853 Ga0436364_1313619 Ga0436364_1313619_402_1235 266
88 3300039437 Ga0436365_0881464 Ga0436365_0881464_922_1755 266
89 3300039437 Ga0436365_1830840 Ga0436365_1830840_25452_26285 266
90 3300039450 Ga0436363_1297661 Ga0436363_1297661_3143_3976 266
91 3300049587 Ga0501071_0144515 Ga0501071_0144515_394_1233 266
92 3300049588 Ga0501072_0133088 Ga0501072_0133088_916_1758 266
93 3300049742 Ga0501080_0011665 Ga0501080_0011665_5301_6143 266
94 3300049744 Ga0501083_0016175 Ga0501083_0016175_3316_4158 266
95 3300050509 nmdc:mga0qj67_84686_c1 nmdc:mga0qj67_84686_c1_1429_2262 266
96 3300060353 Ga0501082_0000811 Ga0501082_0000811_6192_7034 266
97 iso_pu_bacteria 2842333319 2842333655 266
98 iso_pu_bacteria 2899259804 2899261802 266
99 iso_pu_bacteria 2965119406 2965120111 266
100 iso_pu_bacteria 3000017691 3000018631 266
101 3300005458 Ga0070681_10006925 Ga0070681_100069255 267
102 3300005458 Ga0070681_10007314 Ga0070681_100073144 267
103 3300005539 Ga0068853_100256899 Ga0068853_1002568992 267
104 3300005563 Ga0068855_100029275 Ga0068855_1000292753 267
105 3300005616 Ga0068852_100065931 Ga0068852_1000659312 267
106 3300009177 Ga0105248_10360355 Ga0105248_103603552 267
107 3300010375 Ga0105239_10067623 Ga0105239_100676234 267
108 3300013104 Ga0157370_10068924 Ga0157370_100689243 267
109 3300013307 Ga0157372_10220544 Ga0157372_102205443 267
110 3300014497 Ga0182008_10029256 Ga0182008_100292563 267
111 3300025912 Ga0207707_10010344 Ga0207707_100103446 267
112 3300025912 Ga0207707_10028728 Ga0207707_100287284 267
113 3300025913 Ga0207695_10015043 Ga0207695_100150434 267
114 3300025917 Ga0207660_10077156 Ga0207660_100771562 267
115 3300025941 Ga0207711_10262745 Ga0207711_102627452 267
116 3300025949 Ga0207667_10020984 Ga0207667_100209843 267
117 3300031730 Ga0307516_10000004 Ga0307516_100000046 267
118 3300039447 Ga0436361_0187236 Ga0436361_0187236_10797_11630 267
119 3300046460 Ga0495638_0002756 Ga0495638_0002756_4813_5643 267
120 3300046507 Ga0495606_0011595 Ga0495606_0011595_2812_3678 267
121 3300048915 Ga0496112_0010289 Ga0496112_0010289_3672_4511 267
122 3300053108 Ga0500562_000800 Ga0500562_000800_1714_2541 267
123 3300053161 Ga0500634_0068617 Ga0500634_0068617_832_1665 267
124 iso_pu_bacteria 2643221550 2643773604 267
125 iso_pu_bacteria 2821443989 2821449371 267
126 3300005331 Ga0070670_100080028 Ga0070670_1000800284 268
127 3300005334 Ga0068869_100052973 Ga0068869_1000529732 268
128 3300005347 Ga0070668_100008467 Ga0070668_1000084674 268
129 3300005353 Ga0070669_100046389 Ga0070669_1000463893 268
130 3300005367 Ga0070667_100023391 Ga0070667_1000233913 268
131 3300005459 Ga0068867_100138010 Ga0068867_1001380102 268
132 3300005618 Ga0068864_100101980 Ga0068864_1001019802 268
133 3300005719 Ga0068861_100395306 Ga0068861_1003953062 268
134 3300005843 Ga0068860_100035203 Ga0068860_1000352034 268
135 3300005844 Ga0068862_100007560 Ga0068862_10000756012 268
136 3300005844 Ga0068862_100026297 Ga0068862_1000262973 268
137 3300021361 Ga0213872_10000693 Ga0213872_100006937 268
138 3300025923 Ga0207681_10140543 Ga0207681_101405433 268
139 3300025925 Ga0207650_10025936 Ga0207650_100259364 268
140 3300025942 Ga0207689_10065924 Ga0207689_100659245 268
141 3300025961 Ga0207712_10059712 Ga0207712_100597123 268
142 3300025972 Ga0207668_10001888 Ga0207668_100018884 268
143 3300025986 Ga0207658_10016989 Ga0207658_100169892 268
144 3300028380 Ga0268265_10048603 Ga0268265_100486035 268
145 3300028381 Ga0268264_10021248 Ga0268264_100212489 268
146 3300031251 Ga0265327_10000190 Ga0265327_1000019040 268
147 3300039447 Ga0436361_0206950 Ga0436361_0206950_145540_146376 268
148 3300046684 Ga0495669_0000001 Ga0495669_0000001_49839_50675 268
149 3300048914 Ga0496111_0431528 Ga0496111_0431528_24_851 268
150 3300048925 Ga0496122_0004196 Ga0496122_0004196_9068_9895 268
151 3300048926 Ga0496123_0004429 Ga0496123_0004429_11580_12407 268
152 3300048927 Ga0496124_0006016 Ga0496124_0006016_11733_12560 268
153 3300049579 Ga0501043_0168340 Ga0501043_0168340_578_1405 268
154 3300049581 Ga0501047_0029991 Ga0501047_0029991_38_865 268
155 3300053119 Ga0500595_004093 Ga0500595_004093_3649_4479 268
156 3300053122 Ga0500608_067653 Ga0500608_067653_374_1201 268
157 3300053153 Ga0500616_0006086 Ga0500616_0006086_4361_5194 268
158 iso_pu_bacteria 2522572158 2523102558 268
159 iso_pu_bacteria 2643221551 2643775444 268
160 iso_pu_bacteria 2643221555 2643793890 268
161 iso_pu_bacteria 2643221564 2643837779 268
162 iso_pu_bacteria 2765235802 2765465211 268
163 iso_pu_bacteria 2767802442 2770197357 268
164 iso_pu_bacteria 2904578770 2904581381 268
165 iso_pu_bacteria 2919119836 2919122617 268
166 3300005329 Ga0070683_100183995 Ga0070683_1001839952 269
167 3300009551 Ga0105238_10321139 Ga0105238_103211392 269
168 3300028800 Ga0265338_10030725 Ga0265338_100307252 269
169 3300037312 Ga0395899_0141708 Ga0395899_0141708_729_1562 269
170 3300037418 Ga0395900_0246857 Ga0395900_0246857_717_1550 269
171 3300037466 Ga0395898_0085187 Ga0395898_0085187_160_993 269
172 3300037471 Ga0395905_0055874 Ga0395905_0055874_1566_2399 269
173 3300038443 Ga0395901_0064543 Ga0395901_0064543_2333_3166 269
174 3300044712 Ga0453684_0061971 Ga0453684_0061971_1519_2388 269
175 3300048910 Ga0496107_0173742 Ga0496107_0173742_334_1179 269
176 3300049581 Ga0501047_0025612 Ga0501047_0025612_3460_4362 269
177 3300053158 Ga0500627_0163785 Ga0500627_0163785_177_992 269
178 iso_pu_bacteria 2503198000 2503203294 269
179 iso_pu_bacteria 2996310559 2996313323 269
180 3300021361 Ga0213872_10008428 Ga0213872_100084282 270
181 3300028379 Ga0268266_10044390 Ga0268266_100443903 270
182 3300031250 Ga0265331_10002627 Ga0265331_1000262711 270
183 3300031250 Ga0265331_10028764 Ga0265331_100287644 270
184 3300039062 Ga0400483_157157 Ga0400483_157157_210_1049 270
185 3300039062 Ga0400483_178012 Ga0400483_178012_321_1160 270
186 3300045051 Ga0451576_0002273 Ga0451576_0002273_4280_5134 270
187 3300046689 Ga0495613_0000964 Ga0495613_0000964_16272_17123 270
188 3300049571 Ga0501034_0000189 Ga0501034_0000189_56387_57235 270
189 3300053131 Ga0500652_006919 Ga0500652_006919_1472_2311 270
190 iso_pu_bacteria 2508501123 2509116056 270
191 iso_pu_bacteria 2508501127 2509141470 270
192 iso_pu_bacteria 2509276018 2509371832 270
193 iso_pu_bacteria 2509276022 2509397725 270
194 iso_pu_bacteria 2510065059 2510318981 270
195 iso_pu_bacteria 2512875016 2512929817 270
196 iso_pu_bacteria 2512875024 2512964586 270
197 iso_pu_bacteria 2513237087 2513590219 270
198 iso_pu_bacteria 2513237164 2514033300 270
199 iso_pu_bacteria 2513237305 2514420483 270
200 iso_pu_bacteria 2513237351 2514588177 270
201 iso_pu_bacteria 2588253730 2588515409 270
202 iso_pu_bacteria 2597489875 2597815013 270
203 iso_pu_bacteria 2597490356 2599106086 270
204 iso_pu_bacteria 2643221595 2643985341 270
205 iso_pu_bacteria 2643221627 2644155023 270
206 iso_pu_bacteria 2671180139 2671692764 270
207 iso_pu_bacteria 2687453392 2688600132 270
208 iso_pu_bacteria 2721755686 2723577412 270
209 iso_pu_bacteria 2756170246 2756673305 270
210 iso_pu_bacteria 2791355123 2792749115 270
211 iso_pu_bacteria 2841734538 2841741125 270
212 iso_pu_bacteria 2844002411 2844005766 270
213 iso_pu_bacteria 2844009547 2844015444 270
214 iso_pu_bacteria 2846952575 2846955880 270
215 iso_pu_bacteria 2847670302 2847671814 270
216 iso_pu_bacteria 2848858292 2848862299 270
217 iso_pu_bacteria 2856314179 2856318456 270
218 iso_pu_bacteria 2856320880 2856324408 270
219 iso_pu_bacteria 2856328259 2856333387 270
220 iso_pu_bacteria 2856334872 2856335712 270
221 iso_pu_bacteria 2856342000 2856345456 270
222 iso_pu_bacteria 2856349417 2856350409 270
223 iso_pu_bacteria 2856356410 2856362074 270
224 iso_pu_bacteria 2857367948 2857375518 270
225 iso_pu_bacteria 2869162929 2869165012 270
226 iso_pu_bacteria 2869169390 2869175763 270
227 iso_pu_bacteria 2869234852 2869240244 270
228 iso_pu_bacteria 2869242130 2869248585 270
229 iso_pu_bacteria 2869249662 2869256484 270
230 iso_pu_bacteria 2869256925 2869260184 270
231 iso_pu_bacteria 2869264136 2869264435 270
232 iso_pu_bacteria 2869271264 2869276513 270
233 iso_pu_bacteria 2869278585 2869281594 270
234 iso_pu_bacteria 2871451962 2871456680 270
235 iso_pu_bacteria 2871459585 2871462212 270
236 iso_pu_bacteria 2871466892 2871470002 270
237 iso_pu_bacteria 2871474448 2871478512 270
238 iso_pu_bacteria 2871481445 2871488446 270
239 iso_pu_bacteria 2871488783 2871493934 270
240 iso_pu_bacteria 2874109183 2874111271 270
241 iso_pu_bacteria 2874116593 2874120114 270
242 iso_pu_bacteria 2874131515 2874132698 270
243 iso_pu_bacteria 2874139085 2874140742 270
244 iso_pu_bacteria 2874162495 2874163468 270
245 iso_pu_bacteria 2874168670 2874175451 270
246 iso_pu_bacteria 2876363079 2876366620 270
247 iso_pu_bacteria 2876386047 2876388113 270
248 iso_pu_bacteria 2876399893 2876406245 270
249 iso_pu_bacteria 2876406927 2876411932 270
250 iso_pu_bacteria 2876420981 2876424469 270
251 iso_pu_bacteria 2878035449 2878037792 270
252 iso_pu_bacteria 2878738818 2878742523 270
253 iso_pu_bacteria 2878753008 2878756510 270
254 iso_pu_bacteria 2878774303 2878775917 270
255 iso_pu_bacteria 2878781027 2878783626 270
256 iso_pu_bacteria 2878788777 2878793530 270
257 iso_pu_bacteria 2881155292 2881157451 270
258 iso_pu_bacteria 2881845957 2881847017 270
259 iso_pu_bacteria 2881853255 2881857060 270
260 iso_pu_bacteria 2881861095 2881867287 270
261 iso_pu_bacteria 2882632389 2882634377 270
262 iso_pu_bacteria 2882912400 2882915271 270
263 iso_pu_bacteria 2885312484 2885316396 270
264 iso_pu_bacteria 2885318864 2885321161 270
265 iso_pu_bacteria 2885342637 2885349999 270
266 iso_pu_bacteria 2885350715 2885356052 270
267 iso_pu_bacteria 2888337043 2888341306 270
268 iso_pu_bacteria 2888343758 2888348490 270
269 iso_pu_bacteria 2903448605 2903452796 270
270 iso_pu_bacteria 2903492973 2903502562 270
271 iso_pu_bacteria 2903513507 2903518240 270
272 iso_pu_bacteria 2903521522 2903524487 270
273 iso_pu_bacteria 2903528002 2903530118 270
274 iso_pu_bacteria 2906370794 2906375479 270
275 iso_pu_bacteria 2906386501 2906386883 270
276 iso_pu_bacteria 2906408224 2906411685 270
277 iso_pu_bacteria 2906414383 2906418493 270
278 iso_pu_bacteria 2922151315 2922154110 270
279 iso_pu_bacteria 2922172374 2922176873 270
280 iso_pu_bacteria 2924741084 2924743055 270
281 iso_pu_bacteria 2924748358 2924751453 270
282 iso_pu_bacteria 2924762789 2924764629 270
283 iso_pu_bacteria 2924776078 2924780323 270
284 iso_pu_bacteria 2924784321 2924788095 270
285 iso_pu_bacteria 2937822353 2937829281 270
286 iso_pu_bacteria 2937836603 2937840500 270
287 iso_pu_bacteria 2937848649 2937852405 270
288 iso_pu_bacteria 2937861824 2937862744 270
289 iso_pu_bacteria 2937877337 2937882845 270
290 iso_pu_bacteria 2937972304 2937973182 270
291 iso_pu_bacteria 2937980651 2937986440 270
292 iso_pu_bacteria 2958034702 2958037555 270
293 iso_pu_bacteria 2958041894 2958047266 270
294 iso_pu_bacteria 2958064165 2958068678 270
295 iso_pu_bacteria 2958071322 2958071375 270
296 iso_pu_bacteria 2958084443 2958089970 270
297 iso_pu_bacteria 2958108152 2958112382 270
298 iso_pu_bacteria 2958122699 2958126408 270
299 iso_pu_bacteria 2958144490 2958148992 270
300 iso_pu_bacteria 2961127735 2961135143 270
301 iso_pu_bacteria 2961136820 2961143484 270
302 iso_pu_bacteria 2961170736 2961172799 270
303 iso_pu_bacteria 2961183825 2961190646 270
304 iso_pu_bacteria 2963644680 2963649414 270
305 iso_pu_bacteria 2965025482 2965030659 270
306 iso_pu_bacteria 2965040258 2965046029 270
307 iso_pu_bacteria 2965047637 2965053313 270
308 iso_pu_bacteria 2965089291 2965095116 270
309 iso_pu_bacteria 2965102966 2965107272 270
310 iso_pu_bacteria 2967996073 2967998011 270
311 iso_pu_bacteria 2968003550 2968008662 270
312 iso_pu_bacteria 2968016561 2968019611 270
313 iso_pu_bacteria 2968083720 2968084577 270
314 iso_pu_bacteria 2968138860 2968146102 270
315 iso_pu_bacteria 2970469710 2970472932 270
316 iso_pu_bacteria 2970489779 2970492078 270
317 iso_pu_bacteria 2970503327 2970505393 270
318 iso_pu_bacteria 2970510686 2970512514 270
319 iso_pu_bacteria 2970524798 2970529707 270
320 iso_pu_bacteria 2970532167 2970535252 270
321 iso_pu_bacteria 2970540015 2970545087 270
322 iso_pu_bacteria 2970547951 2970551110 270
323 iso_pu_bacteria 2970593180 2970596197 270
324 iso_pu_bacteria 2970619444 2970624992 270
325 iso_pu_bacteria 2970627176 2970627372 270
326 iso_pu_bacteria 2977821940 2977825691 270
327 iso_pu_bacteria 2977828996 2977832260 270
328 iso_pu_bacteria 2977864932 2977869569 270
329 iso_pu_bacteria 2977872689 2977873749 270
330 iso_pu_bacteria 2977907340 2977914993 270
331 iso_pu_bacteria 2977915119 2977915314 270
332 iso_pu_bacteria 2977922695 2977927225 270
333 iso_pu_bacteria 2977935797 2977937007 270
334 iso_pu_bacteria 2977950692 2977954377 270
335 iso_pu_bacteria 2977957713 2977960054 270
336 iso_pu_bacteria 2977986579 2977989923 270
337 iso_pu_bacteria 2979764755 2979770064 270
338 iso_pu_bacteria 2979772303 2979779447 270
339 iso_pu_bacteria 2979793036 2979794270 270
340 iso_pu_bacteria 2979808191 2979810114 270
341 iso_pu_bacteria 2987645492 2987648775 270
342 iso_pu_bacteria 2987666974 2987667433 270
343 iso_pu_bacteria 2987673487 2987674016 270
344 iso_pu_bacteria 2996348954 2996351948 270
345 iso_pu_bacteria 2996386984 2996392344 270
346 iso_pu_bacteria 3000135777 3000141853 270
347 iso_pu_bacteria 3004167301 3004170901 270
348 iso_pu_bacteria 3004195979 3004199916 270
349 iso_pu_bacteria 3004232784 3004238116 270
350 iso_pu_bacteria 3004239961 3004240345 270
351 iso_pu_bacteria 3004248173 3004252837 270
352 iso_pu_bacteria 3004268573 3004273132 270
353 iso_pu_bacteria 3004275668 3004278646 270
354 iso_pu_bacteria 3004289098 3004295124 270
355 iso_pu_bacteria 3004334049 3004339398 270
356 iso_pu_bacteria 637000159 637079561 270
357 iso_pu_bacteria 649633066 649874609 270
358 iso_pu_bacteria 8004300914 8004301768 270
359 iso_pu_bacteria 8004312739 8004321170 270
360 iso_pu_bacteria 8004361976 8004365565 270
361 iso_pu_bacteria 8004374579 8004378099 270
362 iso_pu_bacteria 8004395343 8004401866 270
363 iso_pu_bacteria 8004633249 8004634181 270
364 iso_pu_bacteria 8004695233 8004700628 270
365 iso_pu_bacteria 8004727605 8004731419 270
366 iso_pu_bacteria 8055617313 8055622703 270
367 3300025981 Ga0207640_10043430 Ga0207640_100434303 271
368 iso_pu_bacteria 2510461069 2510839677 271
369 iso_pu_bacteria 2510917026 2511174517 271
370 iso_pu_bacteria 2582581299 2585231481 271
371 iso_pu_bacteria 2582581308 2585278917 271
372 iso_pu_bacteria 2582581315 2585325469 271
373 iso_pu_bacteria 2582581316 2585329626 271
374 iso_pu_bacteria 2585427527 2585530714 271
375 iso_pu_bacteria 2585427530 2585554894 271
376 iso_pu_bacteria 2585427633 2585995130 271
377 iso_pu_bacteria 2585427634 2585999677 271
378 iso_pu_bacteria 2599185156 2599333754 271
379 iso_pu_bacteria 2599185210 2599602583 271
380 iso_pu_bacteria 2599185236 2599722027 271
381 iso_pu_bacteria 2600254933 2600375279 271
382 iso_pu_bacteria 2600255279 2601608664 271
383 iso_pu_bacteria 2600255308 2601745438 271
384 iso_pu_bacteria 2615840626 2616305810 271
385 iso_pu_bacteria 2615840698 2616553948 271
386 iso_pu_bacteria 2643221558 2643809994 271
387 iso_pu_bacteria 2643221634 2644196528 271
388 iso_pu_bacteria 2643221643 2644242896 271
389 iso_pu_bacteria 2667528174 2671115297 271
390 iso_pu_bacteria 2738541317 2738946530 271
391 iso_pu_bacteria 2775507049 2776912788 271
392 iso_pu_bacteria 2791355265 2793353582 271
393 iso_pu_bacteria 2818991453 2819639239 271
394 iso_pu_bacteria 2818991461 2819684102 271
395 iso_pu_bacteria 2821123053 2821124297 271
396 iso_pu_bacteria 2837678835 2837681212 271
397 iso_pu_bacteria 2838029111 2838031436 271
398 iso_pu_bacteria 2838736955 2838741210 271
399 iso_pu_bacteria 2841840854 2841844893 271
400 iso_pu_bacteria 2842140634 2842144615 271
401 iso_pu_bacteria 2842475841 2842477969 271
402 iso_pu_bacteria 2842482326 2842482863 271
403 iso_pu_bacteria 2842502639 2842504778 271
404 iso_pu_bacteria 2842509118 2842509738 271
405 iso_pu_bacteria 2842922631 2842924808 271
406 iso_pu_bacteria 2854896431 2854897195 271
407 iso_pu_bacteria 2854916844 2854918185 271
408 iso_pu_bacteria 2857531043 2857531877 271
409 iso_pu_bacteria 2891048133 2891051624 271
410 iso_pu_bacteria 2899803654 2899803788 271
411 iso_pu_bacteria 2913308742 2913310947 271
412 iso_pu_bacteria 2919166419 2919167379 271
413 iso_pu_bacteria 2919171160 2919171408 271
414 iso_pu_bacteria 2919408235 2919409318 271
415 iso_pu_bacteria 2924733363 2924735385 271
416 iso_pu_bacteria 2933594066 2933595079 271
417 iso_pu_bacteria 2995392953 2995393784 271
418 iso_pu_bacteria 8005682033 8005684559 271
419 iso_pu_bacteria 8018150411 8018152543 271
420 iso_pu_bacteria 8055431914 8055434205 271
421 3300005344 Ga0070661_100159659 Ga0070661_1001596592 272
422 3300053178 Ga0500637_0009988 Ga0500637_0009988_1639_2601 272
423 3300003203 JGI25406J46586_10006486 JGI25406J46586_100064866 273
424 3300005339 Ga0070660_100019894 Ga0070660_1000198942 273
425 3300005985 Ga0081539_10001131 Ga0081539_1000113140 273
426 3300006042 Ga0075368_10023034 Ga0075368_100230344 273
427 3300006051 Ga0075364_10238721 Ga0075364_102387212 273
428 3300006178 Ga0075367_10051599 Ga0075367_100515992 273
429 3300006353 Ga0075370_10097326 Ga0075370_100973262 273
430 3300009176 Ga0105242_10546590 Ga0105242_105465902 273
431 3300027866 Ga0209813_10028846 Ga0209813_100288461 273
432 3300037418 Ga0395900_0280327 Ga0395900_0280327_609_1439 273
433 3300048922 Ga0496119_0000208 Ga0496119_0000208_37609_38472 273
434 3300048929 Ga0496126_0036343 Ga0496126_0036343_1198_2079 273
435 3300049568 Ga0501031_0002553 Ga0501031_0002553_9155_10006 273
436 3300049569 Ga0501032_0000025 Ga0501032_0000025_67494_68345 273
437 3300049569 Ga0501032_0206680 Ga0501032_0206680_314_1141 273
438 3300049570 Ga0501033_0000229 Ga0501033_0000229_16934_17785 273
439 3300049570 Ga0501033_0330678 Ga0501033_0330678_202_1026 273
440 3300049571 Ga0501034_0001654 Ga0501034_0001654_20638_21489 273
441 3300049572 Ga0501036_0001402 Ga0501036_0001402_16921_17772 273
442 3300049573 Ga0501037_0000176 Ga0501037_0000176_31028_31879 273
443 3300049574 Ga0501038_0000862 Ga0501038_0000862_25112_25963 273
444 3300049575 Ga0501039_0000003 Ga0501039_0000003_97777_98628 273
445 3300049579 Ga0501043_0000051 Ga0501043_0000051_16932_17783 273
446 3300049579 Ga0501043_0185702 Ga0501043_0185702_391_1218 273
447 3300049580 Ga0501046_0042431 Ga0501046_0042431_727_1578 273
448 3300049581 Ga0501047_0180447 Ga0501047_0180447_876_1727 273
449 3300049822 Ga0501035_0000102 Ga0501035_0000102_89173_90024 273
450 3300049823 Ga0501044_0020712 Ga0501044_0020712_2252_3103 273
451 3300049823 Ga0501044_0282309 Ga0501044_0282309_529_1356 273
452 3300050491 nmdc:mga00v17_261276_c1 nmdc:mga00v17_261276_c1_134_970 273
453 3300003762 Ga0055542_1001417 Ga0055542_10014176 274
454 3300005339 Ga0070660_100474035 Ga0070660_1004740351 274
455 3300005459 Ga0068867_100181272 Ga0068867_1001812722 274
456 3300006048 Ga0075363_100290793 Ga0075363_1002907932 274
457 3300006051 Ga0075364_10066637 Ga0075364_100666374 274
458 3300006178 Ga0075367_10067879 Ga0075367_100678792 274
459 3300006186 Ga0075369_10074628 Ga0075369_100746282 274
460 3300006186 Ga0075369_10175854 Ga0075369_101758541 274
461 3300006880 Ga0075429_100560990 Ga0075429_1005609902 274
462 3300009093 Ga0105240_10142359 Ga0105240_101423594 274
463 3300009093 Ga0105240_10250849 Ga0105240_102508492 274
464 3300009174 Ga0105241_10093597 Ga0105241_100935972 274
465 3300009553 Ga0105249_10212467 Ga0105249_102124672 274
466 3300010375 Ga0105239_10393531 Ga0105239_103935313 274
467 3300013104 Ga0157370_10425196 Ga0157370_104251962 274
468 3300025254 Ga0209148_1000056 Ga0209148_1000056234 274
469 3300025261 Ga0209233_1009458 Ga0209233_10094582 274
470 3300025272 Ga0209455_1000137 Ga0209455_1000137129 274
471 3300025949 Ga0207667_10222472 Ga0207667_102224722 274
472 3300026089 Ga0207648_10092376 Ga0207648_100923762 274
473 3300031344 Ga0265316_10057177 Ga0265316_100571772 274
474 3300031824 Ga0307413_10128578 Ga0307413_101285782 274
475 3300041511 Ga0451855_1869378 Ga0451855_1869378_94_933 274
476 3300046520 Ga0495637_0066954 Ga0495637_0066954_68_907 274
477 3300046542 Ga0495597_0032202 Ga0495597_0032202_139_978 274
478 3300046616 Ga0495668_0046834 Ga0495668_0046834_816_1655 274
479 3300046810 Ga0495660_0067953 Ga0495660_0067953_215_1054 274
480 3300048913 Ga0496110_0370540 Ga0496110_0370540_236_1069 274
481 3300048924 Ga0496121_0340326 Ga0496121_0340326_137_976 274
482 3300049571 Ga0501034_0150335 Ga0501034_0150335_659_1519 274
483 3300049581 Ga0501047_0018334 Ga0501047_0018334_2523_3383 274
484 3300049823 Ga0501044_0105376 Ga0501044_0105376_1830_2690 274
485 3300050491 nmdc:mga00v17_206289_c1 nmdc:mga00v17_206289_c1_348_1187 274
486 3300050492 nmdc:mga0yw44_26440_c1 nmdc:mga0yw44_26440_c1_2331_3167 274
487 3300050508 nmdc:mga09592_564724_c1 nmdc:mga09592_564724_c1_83_937 274
488 3300053083 Ga0495655_0018261 Ga0495655_0018261_428_1267 274
489 3300053155 Ga0500620_000690 Ga0500620_000690_889_1737 274
490 iso_pu_bacteria 2513237090 2513609081 274
491 iso_pu_bacteria 2599185301 2599937998 274
492 iso_pu_bacteria 2693429783 2694633679 274
493 iso_pu_bacteria 2693429784 2694639982 274
494 iso_pu_bacteria 2856364286 2856364609 274
495 iso_pu_bacteria 2857349434 2857355865 274
496 iso_pu_bacteria 2869285874 2869292718 274
497 iso_pu_bacteria 2871429161 2871429531 274
498 iso_pu_bacteria 2874146452 2874146994 274
499 iso_pu_bacteria 2874155637 2874157026 274
500 iso_pu_bacteria 2876413966 2876414465 274
501 iso_pu_bacteria 2878745973 2878746297 274
502 iso_pu_bacteria 2889010040 2889012970 274
503 iso_pu_bacteria 2889016732 2889022162 274
504 iso_pu_bacteria 2903492973 2903500639 274
505 iso_pu_bacteria 2906308376 2906308430 274
506 iso_pu_bacteria 2906321335 2906321978 274
507 iso_pu_bacteria 2906354277 2906355772 274
508 iso_pu_bacteria 2922130491 2922137674 274
509 iso_pu_bacteria 2922185730 2922193034 274
510 iso_pu_bacteria 2937813078 2937814357 274
511 iso_pu_bacteria 2958041894 2958046732 274
512 iso_pu_bacteria 2958100919 2958105461 274
513 iso_pu_bacteria 2958130278 2958137389 274
514 iso_pu_bacteria 2958172287 2958177389 274
515 iso_pu_bacteria 2958179912 2958180234 274
516 iso_pu_bacteria 2961077736 2961078066 274
517 iso_pu_bacteria 2968117919 2968118284 274
518 iso_pu_bacteria 2977843712 2977844864 274
519 iso_pu_bacteria 2977942078 2977943844 274
520 iso_pu_bacteria 2977971508 2977972511 274
521 iso_pu_bacteria 2979742915 2979751392 274
522 iso_pu_bacteria 2987636660 2987639679 274
523 iso_pu_bacteria 2987652177 2987658667 274
524 iso_pu_bacteria 3004203850 3004207252 274
525 iso_pu_bacteria 8004387939 8004388462 274
526 iso_pu_bacteria 8004640170 8004641754 274
527 iso_pu_bacteria 8004714634 8004714686 274
528 3300001979 JGI24740J21852_10001214 JGI24740J21852_1000121413 275
529 3300001979 JGI24740J21852_10052704 JGI24740J21852_100527042 275
530 3300002704 JGI25155J39150_1000032 JGI25155J39150_100003244 275
531 3300002705 JGI25156J39149_1000129 JGI25156J39149_100012944 275
532 3300002737 JGI25162J39368_1000676 JGI25162J39368_10006766 275
533 3300002737 JGI25162J39368_1001230 JGI25162J39368_10012308 275
534 3300002738 JGI25154J39366_1000324 JGI25154J39366_100032424 275
535 3300002738 JGI25154J39366_1001340 JGI25154J39366_10013404 275
536 3300002741 JGI25157J39369_1000061 JGI25157J39369_100006144 275
537 3300003214 JGI25165J46597_1000028 JGI25165J46597_1000028190 275
538 3300003214 JGI25165J46597_1001649 JGI25165J46597_10016496 275
539 3300003214 JGI25165J46597_1001657 JGI25165J46597_10016576 275
540 3300003215 JGI25153J46596_10016299 JGI25153J46596_100162993 275
541 3300003323 rootH1_10095545 rootH1_100955451 275
542 3300003781 Ga0055536_1001177 Ga0055536_100117714 275
543 3300003792 Ga0055540_1001974 Ga0055540_10019749 275
544 3300003794 Ga0055531_10003014 Ga0055531_100030149 275
545 3300003856 Ga0058692_1001868 Ga0058692_10018686 275
546 3300005262 Ga0065165_1002531 Ga0065165_100253114 275
547 3300005331 Ga0070670_100001700 Ga0070670_10000170013 275
548 3300005539 Ga0068853_100314655 Ga0068853_1003146551 275
549 3300005614 Ga0068856_100278244 Ga0068856_1002782442 275
550 3300006051 Ga0075364_10003667 Ga0075364_100036676 275
551 3300006178 Ga0075367_10110435 Ga0075367_101104352 275
552 3300006946 Ga0079104_1000032 Ga0079104_100003299 275
553 3300006948 Ga0099826_10001725 Ga0099826_100017259 275
554 3300009093 Ga0105240_10000032 Ga0105240_10000032205 275
555 3300009174 Ga0105241_10476011 Ga0105241_104760111 275
556 3300009545 Ga0105237_10000754 Ga0105237_1000075416 275
557 3300009545 Ga0105237_10697015 Ga0105237_106970152 275
558 3300010375 Ga0105239_10199662 Ga0105239_101996621 275
559 3300013100 Ga0157373_10012663 Ga0157373_100126635 275
560 3300013104 Ga0157370_10000972 Ga0157370_1000097213 275
561 3300015262 Ga0182007_10019077 Ga0182007_100190772 275
562 3300015265 Ga0182005_1005393 Ga0182005_10053932 275
563 3300025206 Ga0209435_100042 Ga0209435_10004245 275
564 3300025233 Ga0209437_100033 Ga0209437_100033289 275
565 3300025233 Ga0209437_100075 Ga0209437_100075219 275
566 3300025233 Ga0209437_107205 Ga0209437_1072052 275
567 3300025246 Ga0209646_1000145 Ga0209646_100014545 275
568 3300025250 Ga0209026_1000120 Ga0209026_1000120105 275
569 3300025250 Ga0209026_1000160 Ga0209026_100016045 275
570 3300025253 Ga0209677_101323 Ga0209677_10132311 275
571 3300025256 Ga0209759_1000177 Ga0209759_100017745 275
572 3300025256 Ga0209759_1000368 Ga0209759_100036838 275
573 3300025261 Ga0209233_1000056 Ga0209233_100005645 275
574 3300025261 Ga0209233_1000064 Ga0209233_1000064133 275
575 3300025261 Ga0209233_1000087 Ga0209233_1000087192 275
576 3300025261 Ga0209233_1000209 Ga0209233_100020974 275
577 3300025292 Ga0209676_1002466 Ga0209676_10024668 275
578 3300025297 Ga0209758_1000554 Ga0209758_100055451 275
579 3300025297 Ga0209758_1004764 Ga0209758_10047645 275
580 3300025298 Ga0209050_1010473 Ga0209050_10104735 275
581 3300025303 Ga0209051_1000459 Ga0209051_100045924 275
582 3300025304 Ga0209257_1002585 Ga0209257_100258511 275
583 3300025913 Ga0207695_10000024 Ga0207695_10000024206 275
584 3300025914 Ga0207671_10000718 Ga0207671_1000071841 275
585 3300025914 Ga0207671_10064787 Ga0207671_100647874 275
586 3300026041 Ga0207639_10092724 Ga0207639_100927243 275
587 3300026041 Ga0207639_10387256 Ga0207639_103872562 275
588 3300026078 Ga0207702_10145723 Ga0207702_101457232 275
589 3300027111 Ga0209281_1000053 Ga0209281_1000053208 275
590 3300027312 Ga0209371_1001029 Ga0209371_100102923 275
591 3300027666 Ga0209282_1000102 Ga0209282_100010221 275
592 3300028379 Ga0268266_10241232 Ga0268266_102412321 275
593 3300028794 Ga0307515_10000070 Ga0307515_10000070169 275
594 3300030500 Ga0268256_1001309 Ga0268256_10013094 275
595 3300031456 Ga0307513_10008189 Ga0307513_100081896 275
596 3300037418 Ga0395900_0011881 Ga0395900_0011881_2823_3668 275
597 3300037418 Ga0395900_0217756 Ga0395900_0217756_389_1234 275
598 3300037471 Ga0395905_0018071 Ga0395905_0018071_739_1584 275
599 3300038443 Ga0395901_0007884 Ga0395901_0007884_4815_5660 275
600 3300038443 Ga0395901_0030144 Ga0395901_0030144_4041_4886 275
601 3300044658 Ga0466972_0168153 Ga0466972_0168153_26_871 275
602 3300044735 Ga0466968_0060343 Ga0466968_0060343_514_1359 275
603 3300044901 Ga0466960_0114492 Ga0466960_0114492_186_1031 275
604 3300046501 Ga0495607_0102276 Ga0495607_0102276_503_1348 275
605 3300046501 Ga0495607_0105419 Ga0495607_0105419_383_1216 275
606 3300046506 Ga0495583_0004487 Ga0495583_0004487_4587_5414 275
607 3300046507 Ga0495606_0076436 Ga0495606_0076436_1075_1902 275
608 3300046522 Ga0495643_0048138 Ga0495643_0048138_1280_2125 275
609 3300046524 Ga0495648_0165350 Ga0495648_0165350_39_884 275
610 3300046530 Ga0495654_0000092 Ga0495654_0000092_69092_69937 275
611 3300046558 Ga0495633_0009132 Ga0495633_0009132_3936_4763 275
612 3300046558 Ga0495633_0126357 Ga0495633_0126357_276_1103 275
613 3300046660 Ga0495625_0051172 Ga0495625_0051172_538_1365 275
614 3300046691 Ga0495670_0203564 Ga0495670_0203564_99_926 275
615 3300047469 Ga0495673_0137288 Ga0495673_0137288_71_898 275
616 3300048905 Ga0496102_0020221 Ga0496102_0020221_4131_4958 275
617 3300048914 Ga0496111_0000236 Ga0496111_0000236_9132_9977 275
618 3300048916 Ga0496113_0090953 Ga0496113_0090953_64_891 275
619 3300048919 Ga0496116_0055212 Ga0496116_0055212_530_1357 275
620 3300048920 Ga0496117_0005581 Ga0496117_0005581_2902_3729 275
621 3300048921 Ga0496118_0002790 Ga0496118_0002790_14652_15479 275
622 3300048921 Ga0496118_0013692 Ga0496118_0013692_4592_5422 275
623 3300048921 Ga0496118_0052275 Ga0496118_0052275_136_963 275
624 3300048922 Ga0496119_0018528 Ga0496119_0018528_1254_2081 275
625 3300048922 Ga0496119_0030665 Ga0496119_0030665_938_1783 275
626 3300048923 Ga0496120_0000781 Ga0496120_0000781_36173_37018 275
627 3300048924 Ga0496121_0001948 Ga0496121_0001948_12109_12948 275
628 3300048924 Ga0496121_0004987 Ga0496121_0004987_14579_15406 275
629 3300048924 Ga0496121_0096399 Ga0496121_0096399_915_1760 275
630 3300048925 Ga0496122_0000160 Ga0496122_0000160_104327_105172 275
631 3300048925 Ga0496122_0019960 Ga0496122_0019960_4972_5799 275
632 3300048925 Ga0496122_0030419 Ga0496122_0030419_3433_4260 275
633 3300048925 Ga0496122_0041368 Ga0496122_0041368_337_1182 275
634 3300048926 Ga0496123_0000034 Ga0496123_0000034_134005_134850 275
635 3300048926 Ga0496123_0009397 Ga0496123_0009397_3287_4114 275
636 3300048927 Ga0496124_0000349 Ga0496124_0000349_36297_37130 275
637 3300048927 Ga0496124_0008594 Ga0496124_0008594_9038_9865 275
638 3300048927 Ga0496124_0037757 Ga0496124_0037757_2659_3504 275
639 3300048927 Ga0496124_0072319 Ga0496124_0072319_1473_2300 275
640 3300048928 Ga0496125_0025328 Ga0496125_0025328_4379_5206 275
641 3300048929 Ga0496126_0253397 Ga0496126_0253397_190_1023 275
642 3300048929 Ga0496126_0403878 Ga0496126_0403878_145_972 275
643 3300049570 Ga0501033_0000742 Ga0501033_0000742_24501_25331 275
644 3300049571 Ga0501034_0024556 Ga0501034_0024556_2594_3478 275
645 3300049583 Ga0501067_0168292 Ga0501067_0168292_198_1076 275
646 3300049822 Ga0501035_0000950 Ga0501035_0000950_14441_15271 275
647 3300050491 nmdc:mga00v17_556_c1 nmdc:mga00v17_556_c1_16371_17210 275
648 3300053087 Ga0500643_021878 Ga0500643_021878_650_1483 275
649 3300053121 Ga0500607_159938 Ga0500607_159938_105_938 275
650 3300053125 Ga0500618_000227 Ga0500618_000227_26898_27743 275
651 3300053125 Ga0500618_007584 Ga0500618_007584_1507_2352 275
652 3300053140 Ga0500573_0001776 Ga0500573_0001776_5610_6440 275
653 3300053140 Ga0500573_0012488 Ga0500573_0012488_3882_4712 275
654 3300053153 Ga0500616_0001544 Ga0500616_0001544_13260_14093 275
655 3300053161 Ga0500634_0000112 Ga0500634_0000112_339_1172 275
656 iso_pu_bacteria 2847686936 2847688045 275
657 iso_pu_bacteria 2871495908 2871498448 275
658 iso_pu_bacteria 2874102143 2874103817 275
659 iso_pu_bacteria 2874123672 2874127563 275
660 iso_pu_bacteria 2876369609 2876372266 275
661 iso_pu_bacteria 2876392853 2876399477 275
662 iso_pu_bacteria 2878760144 2878762667 275
663 iso_pu_bacteria 2878767105 2878769633 275
664 iso_pu_bacteria 2881147464 2881153654 275
665 iso_pu_bacteria 2881161766 2881162809 275
666 iso_pu_bacteria 2885305155 2885311559 275
667 iso_pu_bacteria 2885326080 2885327065 275
668 iso_pu_bacteria 2903540706 2903543246 275
669 iso_pu_bacteria 2904659560 2904666004 275
670 iso_pu_bacteria 2906328253 2906331212 275
671 iso_pu_bacteria 2922158528 2922165445 275
672 iso_pu_bacteria 2937891427 2937891484 275
673 iso_pu_bacteria 2937994558 2937997095 275
674 iso_pu_bacteria 2958115193 2958116990 275
675 iso_pu_bacteria 2958165035 2958167565 275
676 iso_pu_bacteria 2961114664 2961121348 275
677 iso_pu_bacteria 2961163497 2961166037 275
678 iso_pu_bacteria 2965018300 2965020856 275
679 iso_pu_bacteria 2965062239 2965062816 275
680 iso_pu_bacteria 2968091066 2968096905 275
681 iso_pu_bacteria 2968097103 2968102384 275
682 iso_pu_bacteria 2968110612 2968117501 275
683 iso_pu_bacteria 2968128360 2968131096 275
684 iso_pu_bacteria 2968171901 2968174434 275
685 iso_pu_bacteria 2970554993 2970557525 275
686 iso_pu_bacteria 2977858184 2977862824 275
687 iso_pu_bacteria 2979779861 2979785945 275
688 iso_pu_bacteria 2987659509 2987662044 275
689 iso_pu_bacteria 2996341866 2996342532 275
690 iso_pu_bacteria 3004188549 3004191095 275
691 iso_pu_bacteria 3004211236 3004214644 275
692 iso_pu_bacteria 3004218560 3004219327 275
693 iso_pu_bacteria 8004445564 8004450704 275
694 iso_pu_bacteria 8004703790 8004710872 275

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00398

RrnaAD

Ribosomal RNA adenine dimethylase

20

318

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.9383 27 273
4jxj-assembly1.cif.gz_A crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing 0.9379 28 275
4jxj-assembly1.cif.gz_A crystal structure of ribosomal rna small subunit methyltransferase a from rickettsia bellii determined by iodide sad phasing 0.9342 28 275
7pnt-assembly1.cif.gz_c assembly intermediate of mouse mitochondrial ribosome small subunit without ms37 in complex with rbfa and tfb1m 0.9288 27 274
3tqs-assembly2.cif.gz_B structure of the dimethyladenosine transferase (ksga) from coxiella burnetii 0.9237 27 273
ID Description Score Start End Superfamily
4jxjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9637 28 212 3.40.50.150
af_Q54M56_2_236_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9559 7 214 3.40.50.150
4jxjA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9533 28 212 3.40.50.150
af_Q58435_1_185_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9496 20 212 3.40.50.150
af_Q58435_1_185_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9347 20 212 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A436BH90-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.9937 165 275 GO:0000179
GO:0003723
GO:0005829
AF-A0A351T7M2-F1-model_v4 16S rRNA (Adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase 0.9863 27 204 GO:0000179
GO:0003723
GO:0005829
AF-A0A539CV97-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9848 1 274 GO:0003723
GO:0005829
GO:0052908
AF-A0A659YI97-F1-model_v4 deleted 0.9818 90 249
AF-A0A539CV97-F1-model_v4 Ribosomal RNA small subunit methyltransferase A (EC 2.1.1.182) (16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase) (16S rRNA dimethyladenosine transferase) (16S rRNA dimethylase) (S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase) 0.9777 1 274 GO:0003723
GO:0005829
GO:0052908

Feature Viewer

pLDDT pTM Quality
94.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map