F475757

General Info

Members Datasets Scaffolds Average Seq Length
694 511 1388 210

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0228677|Ga0496126_0228677_197_940
Length 247
Sequence VLESERQRSAGSITQDKKMNILSRYLPFVAAMALVVVASNILVQFPMQGQVGGLALADVLTWGAFTYPFSFLVTDLANRRYGPAVARKVVFVGFMTAVICSILVPPFLFHHGLIEFETAADRLVRIAAASGAAFLTAQLLDVTVFNRLRRQSWWRAPIIGTLVGSVFDTIVFFGIAFSAAFAFAGPNDSFALETAPLMGVLPVETMRWVSWALGDLSVKLIIAVVALIPYRLLAARWSQPAAAAVTP

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
95 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
96 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
102 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
109 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
110 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
115 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
116 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
123 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
124 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
125 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
126 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
132 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
146 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
147 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
148 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
179 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
180 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
183 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
184 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
185 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
186 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
187 2512875024
188 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
189 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
190 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
191 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
192 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
193 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
194 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
195 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
196 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
197 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
198 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
199 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
200 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
201 2643221609 Acidovorax sp. Root217 Isolate Unclassified
202 2643221611 Acidovorax sp. Root219 Isolate Unclassified
203 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
204 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
205 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
206 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
207 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
208 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
209 2738543012 Acidovorax sp. CF301 Isolate Unclassified
210 2738543024 Aminobacter sp. AP02 Isolate Unclassified
211 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
212 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
213 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
214 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
215 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
216 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
217 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
218 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
219 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
220 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
221 2816332133 Acidovorax radicis 2721A Isolate Unclassified
222 2818991457 Xanthomonas translucens 569 Isolate Unclassified
223 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
224 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
225 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
226 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
227 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
228 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
229 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
230 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
231 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
232 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
233 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
234 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
235 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
236 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
237 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
238 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
239 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
240 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
241 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
242 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
243 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
244 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
245 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
246 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
247 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
248 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
249 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
250 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
251 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
252 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
253 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
254 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
255 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
256 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
257 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
258 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
259 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
260 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
261 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
262 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
263 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
264 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
265 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
266 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
267 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
268 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
269 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
270 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
271 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
272 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
273 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
274 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
275 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
276 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
277 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
278 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
279 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
280 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
281 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
282 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
283 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
284 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
285 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
286 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
287 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
288 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
289 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
290 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
291 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
292 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
293 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
294 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
295 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
296 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
297 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
298 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
299 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
300 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
301 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
302 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
303 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
304 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
305 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
306 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
307 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
308 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
309 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
310 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
311 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
312 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
313 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
314 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
315 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
316 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
317 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
318 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
319 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
320 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
321 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
322 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
323 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
324 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
325 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
326 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
327 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
328 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
329 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
330 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
331 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
332 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
333 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
334 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
335 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
336 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
337 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
338 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
339 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
340 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
341 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
342 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
343 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
344 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
345 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
346 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
347 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
348 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
349 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
350 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
351 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
352 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
353 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
354 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
355 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
356 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
357 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
358 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
359 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
360 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
361 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
362 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
363 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
364 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
365 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
366 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
367 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
368 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
369 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
370 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
371 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
372 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
373 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
374 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
375 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
376 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
377 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
378 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
379 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
380 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
381 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
382 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
383 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
384 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
385 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
386 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
387 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
388 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
389 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
390 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
391 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
392 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
393 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
394 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
395 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
396 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
397 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
398 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
399 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
400 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
401 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
402 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
403 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
404 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
405 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
406 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
407 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
408 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
409 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
410 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
411 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
412 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
413 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
414 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
415 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
416 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
417 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
418 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
419 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
420 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
421 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
422 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
423 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
424 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
425 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
426 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
427 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
428 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
429 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
430 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
431 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
432 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
433 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
434 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
435 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
436 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
437 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
438 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
439 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
440 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
441 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
442 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
443 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
444 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
445 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
446 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
447 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
448 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
449 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
450 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
451 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
452 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
453 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
454 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
455 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
456 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
457 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
458 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
459 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
460 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
461 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
462 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
463 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
464 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
465 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
466 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
467 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
468 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
469 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
470 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
471 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
472 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
473 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
474 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
475 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
476 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
477 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
478 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
479 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
480 3004167301 Mesorhizobium loti 582 Isolate Unclassified
481 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
482 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
483 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
484 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
485 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
486 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
487 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
488 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
489 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
490 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
491 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
492 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
493 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
494 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
495 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
496 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
497 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
498 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
499 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
500 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
501 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
502 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
503 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
504 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
505 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
506 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
507 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
508 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
509 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
510 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
511 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 52.02
Metatranscriptomes 0.14
Isolates 47.84

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 9.37
Nodule 34.01
Rhizoplane 1.73
Rhizosphere 34.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0228677 3300048929 Bacteria 1559
2 JGI24735J21928_10063571 3300002067 Bacteria 1059
3 JGI25156J39149_1005065 3300002705 Bacteria 3885
4 JGI25157J39369_1001464 3300002741 Bacteria 8760
5 JGI25152J39213_1001154 3300002773 Bacteria 12233
6 JGI25150J39212_1000897 3300002774 Bacteria 9767
7 JGI25151J46595_10002149 3300003187 Bacteria 12245
8 JGI25406J46586_10087442 3300003203 Bacteria 945
9 JGI25165J46597_1000097 3300003214 Bacteria 161115
10 JGI25153J46596_10001944 3300003215 Bacteria 12245
11 rootH2_10013913 3300003320 Bacteria 17202
12 Ga0055542_1000343 3300003762 Bacteria 49207
13 Ga0055536_1001880 3300003781 Bacteria 12214
14 Ga0055536_1002862 3300003781 Bacteria 9504
15 Ga0055536_1003048 3300003781 Bacteria 9153
16 Ga0055534_1001814 3300003784 Bacteria 7998
17 Ga0055528_1000045 3300003790 Bacteria 101917
18 Ga0055530_10000720 3300003791 Bacteria 27764
19 Ga0055530_10001111 3300003791 Bacteria 21038
20 Ga0055531_10004051 3300003794 Bacteria 9081
21 Ga0055531_10006197 3300003794 Bacteria 6831
22 Ga0055531_10012885 3300003794 Bacteria 3895
23 Ga0065165_1067642 3300005262 Bacteria 958
24 Ga0070660_100252845 3300005339 Bacteria 1437
25 Ga0070668_100032286 3300005347 Bacteria 3984
26 Ga0070663_100014455 3300005455 Bacteria 5067
27 Ga0070678_100134949 3300005456 Bacteria 1967
28 Ga0070678_100384186 3300005456 Bacteria 1215
29 Ga0068867_100302024 3300005459 Bacteria 1320
30 Ga0068853_100070115 3300005539 Bacteria 3050
31 Ga0068853_100303777 3300005539 Bacteria 1475
32 Ga0068853_100348353 3300005539 Bacteria 1377
33 Ga0070665_100025937 3300005548 Bacteria 5902
34 Ga0070665_100027124 3300005548 Bacteria 5769
35 Ga0070665_100038607 3300005548 Bacteria 4800
36 Ga0070665_100082334 3300005548 Bacteria 3223
37 Ga0068856_100390397 3300005614 Bacteria 1411
38 Ga0081539_10000618 3300005985 Bacteria 71969
39 Ga0075365_10038806 3300006038 Bacteria 3098
40 Ga0075365_10075952 3300006038 Bacteria 2268
41 Ga0075365_10107664 3300006038 Bacteria 1914
42 Ga0075365_10124842 3300006038 Bacteria 1778
43 Ga0075368_10011792 3300006042 Bacteria 3187
44 Ga0075368_10097896 3300006042 Bacteria 1203
45 Ga0075364_10068051 3300006051 Bacteria 2341
46 Ga0075364_10103978 3300006051 Bacteria 1892
47 Ga0075364_10334277 3300006051 Bacteria 1032
48 Ga0075364_10381947 3300006051 Bacteria 961
49 Ga0075362_10131761 3300006177 Bacteria 1190
50 Ga0075370_10146486 3300006353 Bacteria 1382
51 Ga0105251_10000624 3300009011 Bacteria 32544
52 Ga0105244_10047565 3300009036 Bacteria 2199
53 Ga0105240_10298517 3300009093 Bacteria 1843
54 Ga0105240_10446017 3300009093 Bacteria 1449
55 Ga0105243_10002836 3300009148 Bacteria 14385
56 Ga0105248_10331418 3300009177 Bacteria 1714
57 Ga0105237_10391292 3300009545 Bacteria 1395
58 Ga0105238_10005971 3300009551 Bacteria 12074
59 Ga0105239_10151493 3300010375 Bacteria 2588
60 Ga0105239_10173392 3300010375 Bacteria 2412
61 Ga0105239_11057206 3300010375 Bacteria 934
62 Ga0157371_10004416 3300013102 Bacteria 12287
63 Ga0157371_10079423 3300013102 Bacteria 2324
64 Ga0157370_10021264 3300013104 Bacteria 6468
65 Ga0157370_10177475 3300013104 Bacteria 1980
66 Ga0157370_10719328 3300013104 Bacteria 911
67 Ga0157369_10115097 3300013105 Bacteria 2856
68 Ga0163162_10270450 3300013306 Bacteria 1831
69 Ga0182008_10000410 3300014497 Bacteria 33147
70 Ga0182008_10006554 3300014497 Bacteria 6500
71 Ga0182008_10020298 3300014497 Bacteria 3423
72 Ga0182006_1007235 3300015261 Bacteria 5098
73 Ga0182006_1071230 3300015261 Bacteria 1289
74 Ga0182007_10000025 3300015262 Bacteria 172058
75 Ga0182005_1000321 3300015265 Bacteria 28521
76 Ga0182005_1007836 3300015265 Bacteria 3179
77 Ga0163161_10009634 3300017792 Bacteria 6682
78 Ga0163161_10014626 3300017792 Bacteria 5464
79 Ga0163161_10071279 3300017792 Bacteria 2542
80 Ga0163161_10294452 3300017792 Bacteria 1277
81 Ga0207425_1000015 3300025245 Bacteria 466368
82 Ga0209026_1000041 3300025250 Bacteria 275745
83 Ga0209148_1000069 3300025254 Bacteria 334444
84 Ga0209148_1023955 3300025254 Bacteria 968
85 Ga0209759_1000183 3300025256 Bacteria 102218
86 Ga0209129_1000126 3300025258 Bacteria 133335
87 Ga0209233_1000030 3300025261 Bacteria 636702
88 Ga0209565_1000037 3300025263 Bacteria 289371
89 Ga0209455_1000161 3300025272 Bacteria 117353
90 Ga0209673_1000494 3300025273 Bacteria 65078
91 Ga0209675_1000020 3300025291 Bacteria 335854
92 Ga0209676_1000149 3300025292 Bacteria 167854
93 Ga0209676_1000307 3300025292 Bacteria 96239
94 Ga0209676_1001356 3300025292 Bacteria 24217
95 Ga0209025_1000002 3300025294 Bacteria 1393142
96 Ga0209564_1001178 3300025295 Bacteria 30336
97 Ga0209758_1000003 3300025297 Bacteria 1398533
98 Ga0209758_1015262 3300025297 Bacteria 3998
99 Ga0209050_1000670 3300025298 Bacteria 51926
100 Ga0209050_1000711 3300025298 Bacteria 49107
101 Ga0209050_1092148 3300025298 Bacteria 618
102 Ga0209256_1008529 3300025299 Bacteria 4728
103 Ga0209256_1020166 3300025299 Bacteria 2092
104 Ga0209051_1002509 3300025303 Bacteria 13036
105 Ga0209257_1000587 3300025304 Bacteria 60909
106 Ga0209257_1002459 3300025304 Bacteria 18363
107 Ga0209257_1005642 3300025304 Bacteria 8658
108 Ga0207655_1038564 3300025728 Bacteria 2086
109 Ga0207713_1000414 3300025735 Bacteria 45438
110 Ga0207713_1034073 3300025735 Bacteria 2216
111 Ga0207647_10004907 3300025904 Bacteria 9870
112 Ga0207647_10146162 3300025904 Bacteria 1383
113 Ga0207645_10101894 3300025907 Bacteria 1853
114 Ga0207705_10194435 3300025909 Bacteria 1535
115 Ga0207671_10069128 3300025914 Bacteria 2633
116 Ga0207657_10250862 3300025919 Bacteria 1411
117 Ga0207681_10332763 3300025923 Bacteria 1211
118 Ga0207694_10049376 3300025924 Bacteria 3257
119 Ga0207650_10003991 3300025925 Bacteria 10099
120 Ga0207709_10001693 3300025935 Bacteria 14835
121 Ga0207709_10128753 3300025935 Bacteria 1721
122 Ga0207669_10081778 3300025937 Bacteria 2071
123 Ga0207691_10120612 3300025940 Bacteria 2324
124 Ga0207668_10008328 3300025972 Bacteria 6175
125 Ga0207668_10827243 3300025972 Bacteria 821
126 Ga0207640_10123618 3300025981 Bacteria 1859
127 Ga0207658_10339190 3300025986 Bacteria 1306
128 Ga0207639_10065985 3300026041 Bacteria 2811
129 Ga0207639_10268492 3300026041 Bacteria 1495
130 Ga0207678_10021848 3300026067 Bacteria 5612
131 Ga0207678_10229115 3300026067 Bacteria 1591
132 Ga0207678_10538997 3300026067 Bacteria 1020
133 Ga0207702_10238358 3300026078 Bacteria 1703
134 Ga0207702_10644640 3300026078 Bacteria 1041
135 Ga0207648_10157187 3300026089 Bacteria 2007
136 Ga0207674_10446912 3300026116 Bacteria 1249
137 Ga0207683_10046296 3300026121 Bacteria 3806
138 Ga0207683_10471893 3300026121 Bacteria 1158
139 Ga0207698_10034184 3300026142 Bacteria 3703
140 Ga0209371_1000028 3300027312 Bacteria 429688
141 Ga0207428_10471184 3300027907 Bacteria 914
142 Ga0268266_10026079 3300028379 Bacteria 4972
143 Ga0268266_10027038 3300028379 Bacteria 4882
144 Ga0268266_10133134 3300028379 Bacteria 2225
145 Ga0268256_1000030 3300030500 Bacteria 429688
146 Ga0316176_1131576 3300030732 Bacteria 6425
147 Ga0307513_10346337 3300031456 Bacteria 1235
148 Ga0316576_10005596 3300031727 Bacteria 7705
149 Ga0307412_10001530 3300031911 Bacteria 12785
150 Ga0307412_10391156 3300031911 Bacteria 1129
151 Ga0307414_10015807 3300032004 Bacteria 4568
152 Ga0307414_11177704 3300032004 Bacteria 709
153 Ga0316593_10080616 3300032168 Bacteria 1136
154 Ga0316582_0022209 3300036647 Bacteria 3764
155 Ga0316584_0023028 3300036712 Bacteria 4548
156 Ga0316584_0185161 3300036712 Bacteria 1541
157 Ga0395899_0000288 3300037312 Bacteria 64881
158 Ga0395900_0000246 3300037418 Bacteria 85104
159 Ga0395900_0212060 3300037418 Bacteria 1955
160 Ga0395898_0000447 3300037466 Bacteria 85103
161 Ga0395905_0000228 3300037471 Bacteria 85103
162 Ga0395901_0000167 3300038443 Bacteria 85844
163 Ga0237819_00157 3300038705 Bacteria 25288
164 Ga0400483_067089 3300039062 Bacteria 1473
165 Ga0400483_120563 3300039062 Bacteria 2197
166 Ga0400483_286820 3300039062 Bacteria 1252
167 Ga0439465_0029885 3300041413 Bacteria 1732
168 Ga0439465_0165604 3300041413 Bacteria 794
169 Ga0451791_0318194 3300041451 Bacteria 788
170 Ga0451793_0572447 3300041452 Bacteria 1932
171 Ga0451853_1166652 3300041512 Bacteria 926
172 Ga0439432_104077 3300042006 Bacteria 847
173 Ga0450911_001349 3300042115 Bacteria 5763
174 Ga0450901_002218 3300042533 Bacteria 2133
175 Ga0451576_0001111 3300045051 Bacteria 49021
176 Ga0466967_0249041 3300045976 Bacteria 1697
177 Ga0495627_001587 3300046453 Bacteria 12824
178 Ga0495638_0001256 3300046460 Bacteria 23839
179 Ga0495638_0008810 3300046460 Bacteria 7127
180 Ga0495638_0009777 3300046460 Bacteria 6698
181 Ga0495610_0004528 3300046512 Bacteria 10236
182 Ga0495610_0143480 3300046512 Bacteria 1025
183 Ga0495631_0002564 3300046518 Bacteria 10170
184 Ga0495632_0130696 3300046519 Bacteria 1169
185 Ga0495643_0000877 3300046522 Bacteria 32012
186 Ga0495643_0246857 3300046522 Bacteria 835
187 Ga0495663_0001107 3300046525 Bacteria 8715
188 Ga0495663_0002303 3300046525 Bacteria 5778
189 Ga0495663_0065768 3300046525 Bacteria 1146
190 Ga0495633_0002272 3300046558 Bacteria 13745
191 Ga0495633_0005045 3300046558 Bacteria 8230
192 Ga0495633_0009205 3300046558 Bacteria 5477
193 Ga0495633_0017021 3300046558 Bacteria 3728
194 Ga0495668_0056553 3300046616 Bacteria 2165
195 Ga0495625_0010787 3300046660 Bacteria 7520
196 Ga0495625_0014692 3300046660 Bacteria 6236
197 Ga0495625_0369914 3300046660 Bacteria 902
198 Ga0495661_0184512 3300046665 Bacteria 1103
199 Ga0495670_0045873 3300046691 Bacteria 2182
200 Ga0495672_0000594 3300047320 Bacteria 40835
201 Ga0495681_0066745 3300047470 Bacteria 1641
202 Ga0495686_0004506 3300047472 Bacteria 11432
203 Ga0495686_0013240 3300047472 Bacteria 5730
204 Ga0496101_0732079 3300048904 Bacteria 781
205 Ga0496102_0128447 3300048905 Bacteria 2371
206 Ga0496103_0450275 3300048906 Bacteria 826
207 Ga0496110_0631382 3300048913 Bacteria 970
208 Ga0496112_0029566 3300048915 Bacteria 5299
209 Ga0496113_0105427 3300048916 Bacteria 2189
210 Ga0496115_0400350 3300048918 Bacteria 1114
211 Ga0496116_0004528 3300048919 Bacteria 13214
212 Ga0496116_0063715 3300048919 Bacteria 2373
213 Ga0496116_0194849 3300048919 Bacteria 1068
214 Ga0496117_0000766 3300048920 Bacteria 50647
215 Ga0496117_0005061 3300048920 Bacteria 14119
216 Ga0496117_0005724 3300048920 Bacteria 12919
217 Ga0496117_0010530 3300048920 Bacteria 8408
218 Ga0496117_0091173 3300048920 Bacteria 1961
219 Ga0496117_0104066 3300048920 Bacteria 1787
220 Ga0496118_0001226 3300048921 Bacteria 39410
221 Ga0496118_0007714 3300048921 Bacteria 11309
222 Ga0496118_0011562 3300048921 Bacteria 8600
223 Ga0496118_0027028 3300048921 Bacteria 4867
224 Ga0496118_0046638 3300048921 Bacteria 3368
225 Ga0496118_0124789 3300048921 Bacteria 1669
226 Ga0496118_0152587 3300048921 Bacteria 1443
227 Ga0496118_0186187 3300048921 Bacteria 1247
228 Ga0496119_0004946 3300048922 Bacteria 13024
229 Ga0496119_0005471 3300048922 Bacteria 12153
230 Ga0496119_0014983 3300048922 Bacteria 6016
231 Ga0496119_0095835 3300048922 Bacteria 1675
232 Ga0496119_0149609 3300048922 Bacteria 1252
233 Ga0496120_0000710 3300048923 Bacteria 48861
234 Ga0496120_0001433 3300048923 Bacteria 28743
235 Ga0496120_0012040 3300048923 Bacteria 5908
236 Ga0496120_0033672 3300048923 Bacteria 3076
237 Ga0496121_0010731 3300048924 Bacteria 10271
238 Ga0496121_0031613 3300048924 Bacteria 4831
239 Ga0496121_0104612 3300048924 Bacteria 2174
240 Ga0496121_0312942 3300048924 Bacteria 1060
241 Ga0496122_0001314 3300048925 Bacteria 40765
242 Ga0496122_0005726 3300048925 Bacteria 14646
243 Ga0496122_0007516 3300048925 Bacteria 12086
244 Ga0496122_0014079 3300048925 Bacteria 7763
245 Ga0496122_0041375 3300048925 Bacteria 3644
246 Ga0496122_0222731 3300048925 Bacteria 1080
247 Ga0496123_0001741 3300048926 Bacteria 28741
248 Ga0496123_0001850 3300048926 Bacteria 27764
249 Ga0496123_0009539 3300048926 Bacteria 8727
250 Ga0496123_0011019 3300048926 Bacteria 7898
251 Ga0496123_0016006 3300048926 Bacteria 6115
252 Ga0496123_0102126 3300048926 Bacteria 1665
253 Ga0496123_0168653 3300048926 Bacteria 1157
254 Ga0496124_0002020 3300048927 Bacteria 27594
255 Ga0496124_0002516 3300048927 Bacteria 23840
256 Ga0496124_0011683 3300048927 Bacteria 8761
257 Ga0496124_0012975 3300048927 Bacteria 8170
258 Ga0496124_0014923 3300048927 Bacteria 7479
259 Ga0496124_0018965 3300048927 Bacteria 6421
260 Ga0496124_0065113 3300048927 Bacteria 3040
261 Ga0496124_0102967 3300048927 Bacteria 2309
262 Ga0496124_0221733 3300048927 Bacteria 1421
263 Ga0496124_0380286 3300048927 Bacteria 987
264 Ga0496125_0007630 3300048928 Bacteria 11474
265 Ga0496125_0014995 3300048928 Bacteria 7525
266 Ga0496125_0043331 3300048928 Bacteria 3821
267 Ga0496125_0076705 3300048928 Bacteria 2579
268 Ga0496125_0128381 3300048928 Bacteria 1791
269 Ga0496125_0172579 3300048928 Bacteria 1451
270 Ga0496126_0007716 3300048929 Bacteria 11743
271 Ga0496126_0030251 3300048929 Bacteria 5132
272 Ga0496126_0106247 3300048929 Bacteria 2450
273 Ga0496126_0134762 3300048929 Bacteria 2131
274 Ga0496126_0442553 3300048929 Bacteria 1047
275 Ga0501031_0000009 3300049568 Bacteria 155116
276 Ga0501031_0008288 3300049568 Bacteria 6760
277 Ga0501031_0221305 3300049568 Bacteria 1232
278 Ga0501032_0000001 3300049569 Bacteria 422097
279 Ga0501032_0000017 3300049569 Bacteria 158303
280 Ga0501032_0176365 3300049569 Bacteria 1400
281 Ga0501032_0214037 3300049569 Bacteria 1255
282 Ga0501033_0000029 3300049570 Bacteria 158294
283 Ga0501033_0000830 3300049570 Bacteria 28206
284 Ga0501033_0042254 3300049570 Bacteria 3399
285 Ga0501033_0076391 3300049570 Bacteria 2459
286 Ga0501033_0250400 3300049570 Bacteria 1255
287 Ga0501034_0000036 3300049571 Bacteria 239274
288 Ga0501034_0000102 3300049571 Bacteria 158302
289 Ga0501034_0002441 3300049571 Bacteria 22430
290 Ga0501034_0020962 3300049571 Bacteria 6672
291 Ga0501034_0036943 3300049571 Bacteria 4946
292 Ga0501034_0151988 3300049571 Bacteria 2290
293 Ga0501034_0197763 3300049571 Bacteria 1969
294 Ga0501036_0000011 3300049572 Bacteria 158302
295 Ga0501036_0000180 3300049572 Bacteria 41669
296 Ga0501036_0332318 3300049572 Bacteria 1269
297 Ga0501036_0339041 3300049572 Bacteria 1255
298 Ga0501037_0000015 3300049573 Bacteria 161311
299 Ga0501037_0000017 3300049573 Bacteria 157276
300 Ga0501037_0240301 3300049573 Bacteria 1269
301 Ga0501037_0244969 3300049573 Bacteria 1255
302 Ga0501038_0000016 3300049574 Bacteria 159150
303 Ga0501038_0000036 3300049574 Bacteria 124766
304 Ga0501038_0050902 3300049574 Bacteria 3577
305 Ga0501038_0051255 3300049574 Bacteria 3563
306 Ga0501038_0204354 3300049574 Bacteria 1584
307 Ga0501039_0000011 3300049575 Bacteria 245124
308 Ga0501039_0000023 3300049575 Bacteria 158026
309 Ga0501039_0232977 3300049575 Bacteria 1447
310 Ga0501040_0000834 3300049576 Bacteria 19287
311 Ga0501040_0027503 3300049576 Bacteria 3830
312 Ga0501041_0224799 3300049577 Bacteria 1178
313 Ga0501041_0247463 3300049577 Bacteria 1121
314 Ga0501042_0017279 3300049578 Bacteria 4973
315 Ga0501043_0000105 3300049579 Bacteria 78189
316 Ga0501043_0000423 3300049579 Bacteria 38075
317 Ga0501043_0034960 3300049579 Bacteria 3953
318 Ga0501043_0106929 3300049579 Bacteria 2197
319 Ga0501043_0199602 3300049579 Bacteria 1553
320 Ga0501043_0313633 3300049579 Bacteria 1196
321 Ga0501046_0028177 3300049580 Bacteria 4577
322 Ga0501046_0035873 3300049580 Bacteria 3993
323 Ga0501047_0002449 3300049581 Bacteria 17717
324 Ga0501047_0168051 3300049581 Bacteria 2063
325 Ga0501047_0168293 3300049581 Bacteria 2061
326 Ga0501047_0419037 3300049581 Bacteria 1170
327 Ga0501048_0007590 3300049582 Bacteria 8224
328 Ga0501067_0004819 3300049583 Bacteria 7483
329 Ga0501069_0024053 3300049585 Bacteria 3323
330 Ga0501070_0003968 3300049586 Bacteria 12731
331 Ga0501070_0014269 3300049586 Bacteria 6687
332 Ga0501070_0074163 3300049586 Bacteria 2817
333 Ga0501070_0328424 3300049586 Bacteria 1243
334 Ga0501070_0451183 3300049586 Bacteria 1037
335 Ga0501080_0026665 3300049742 Bacteria 5369
336 Ga0501080_0098648 3300049742 Bacteria 2711
337 Ga0501081_0425675 3300049743 Bacteria 985
338 Ga0501035_0000028 3300049822 Bacteria 179195
339 Ga0501035_0000038 3300049822 Bacteria 158818
340 Ga0501035_0004286 3300049822 Bacteria 13543
341 Ga0501035_0154073 3300049822 Bacteria 1992
342 Ga0501035_0341040 3300049822 Bacteria 1255
343 Ga0501044_0000046 3300049823 Bacteria 146812
344 Ga0501044_0193889 3300049823 Bacteria 1992
345 Ga0501044_0376478 3300049823 Bacteria 1335
346 Ga0501044_0388549 3300049823 Bacteria 1310
347 Ga0501044_0415708 3300049823 Bacteria 1255
348 Ga0501044_0448629 3300049823 Bacteria 1197
349 Ga0501045_0101258 3300049824 Bacteria 2132
350 Ga0501045_0163642 3300049824 Bacteria 1656
351 nmdc:mga03n38_130683_c1 3300050490 Bacteria 1244
352 nmdc:mga03n38_421492_c1 3300050490 Bacteria 738
353 nmdc:mga00v17_66825_c1 3300050491 Bacteria 2220
354 nmdc:mga0yw44_102809_c1 3300050492 Bacteria 1822
355 nmdc:mga0yw44_108245_c1 3300050492 Bacteria 1778
356 nmdc:mga0yw44_109893_c1 3300050492 Bacteria 1765
357 nmdc:mga0yw44_493364_c1 3300050492 Bacteria 831
358 Ga0500568_0000104 3300053139 Bacteria 78075
359 Ga0500616_0021793 3300053153 Bacteria 3585
360 Ga0500620_000291 3300053155 Bacteria 9633
361 Ga0500611_042639 3300053727 Bacteria 1004
362 Ga0501084_0492626 3300054114 Bacteria 1036
363 2503199581 2503198000 Bacteria 6884444
364 2509142784 2508501127 Bacteria 7037543
365 2510319136 2510065059 Bacteria 6847884
366 2511392276 2511231027 Bacteria 5013807
367 2512933015 2512875016 Bacteria 6529530
368 2512961038 2512875024 Bacteria 7195110
369 2513611227 2513237090 Bacteria 7096802
370 2514035120 2513237164 Bacteria 7563725
371 2514417216 2513237305 Bacteria 7293571
372 2514587153 2513237351 Bacteria 6968952
373 2578459910 2576861471 Bacteria 4648976
374 2588519068 2588253730 Bacteria 6881675
375 2597811390 2597489875 Bacteria 7010078
376 2599939086 2599185301 Bacteria 6161860
377 2643771414 2643221550 Bacteria 4619371
378 2643776927 2643221551 Bacteria 3750538
379 2643795375 2643221555 Bacteria 3749717
380 2643836893 2643221564 Bacteria 4193379
381 2643986106 2643221595 Bacteria 6565519
382 2644057688 2643221609 Bacteria 6756331
383 2644072225 2643221611 Bacteria 6820941
384 2644130833 2643221623 Bacteria 5239945
385 2644153671 2643221627 Bacteria 6761570
386 2688596831 2687453392 Bacteria 6880454
387 2694634237 2693429783 Bacteria 7019804
388 2694637988 2693429784 Bacteria 7241525
389 2723573951 2721755686 Bacteria 7343952
390 2739241965 2738543012 Bacteria 7115078
391 2739309813 2738543024 Bacteria 5603683
392 2747950457 2747842428 Bacteria 4689383
393 2748017465 2747842501 Bacteria 5293829
394 2756677364 2756170246 Bacteria 7451806
395 2757570381 2757320392 Bacteria 3737298
396 2765467890 2765235802 Bacteria 5618596
397 2765577382 2765235840 Bacteria 4663337
398 2770198610 2767802442 Bacteria 5747986
399 2776270072 2775506902 Bacteria 6208009
400 2776281265 2775506904 Bacteria 5954060
401 2792748418 2791355123 Bacteria 8049106
402 2816470733 2816332133 Bacteria 7249298
403 2819662285 2818991457 Bacteria 5323295
404 2834580570 2834578030 Bacteria 3530182
405 2837653946 2837651117 Bacteria 3772164
406 2837679863 2837678835 Bacteria 5252418
407 2839997925 2839993093 Bacteria 5512535
408 2840765557 2840764183 Bacteria 6358399
409 2840882122 2840878972 Bacteria 5483153
410 2841737318 2841734538 Bacteria 6784580
411 2842392387 2842391507 Bacteria 4486072
412 2842721845 2842718218 Bacteria 4560148
413 2842761143 2842757796 Bacteria 3981385
414 2842875845 2842871566 Bacteria 4827117
415 2844009145 2844002411 Bacteria 7168230
416 2844012174 2844009547 Bacteria 6728125
417 2847674595 2847670302 Bacteria 6165597
418 2847690712 2847686936 Bacteria 6278406
419 2848699828 2848694841 Bacteria 9205737
420 2852653385 2852649853 Bacteria 4036942
421 2852688013 2852684882 Bacteria 5463342
422 2856317519 2856314179 Bacteria 6477897
423 2856328868 2856328259 Bacteria 6528202
424 2856334946 2856334872 Bacteria 7037011
425 2856343876 2856342000 Bacteria 7176905
426 2856350381 2856349417 Bacteria 6230045
427 2856360397 2856356410 Bacteria 6297484
428 2856366697 2856364286 Bacteria 6939991
429 2857356618 2857349434 Bacteria 7926032
430 2857371448 2857367948 Bacteria 6965560
431 2857445786 2857442823 Bacteria 4562550
432 2869165135 2869162929 Bacteria 6399702
433 2869173578 2869169390 Bacteria 6659796
434 2869240128 2869234852 Bacteria 6654993
435 2869250569 2869249662 Bacteria 6868783
436 2869258959 2869256925 Bacteria 6981691
437 2869265294 2869264136 Bacteria 6880765
438 2869274841 2869271264 Bacteria 6908218
439 2869285821 2869278585 Bacteria 7077053
440 2869287892 2869285874 Bacteria 6901219
441 2871435840 2871429161 Bacteria 6547891
442 2871440893 2871435913 Bacteria 6880295
443 2871448677 2871444079 Bacteria 6423508
444 2871463881 2871459585 Bacteria 6866887
445 2871472534 2871466892 Bacteria 6923287
446 2871479379 2871474448 Bacteria 6806570
447 2871487786 2871481445 Bacteria 6700002
448 2871489887 2871488783 Bacteria 6929816
449 2871498001 2871495908 Bacteria 6935695
450 2874105991 2874102143 Bacteria 6342645
451 2874111133 2874109183 Bacteria 6517025
452 2874117375 2874116593 Bacteria 6674494
453 2874128795 2874123672 Bacteria 7238285
454 2874133706 2874131515 Bacteria 6820270
455 2874141865 2874139085 Bacteria 7021506
456 2874151525 2874146452 Bacteria 7533118
457 2874159157 2874155637 Bacteria 6724144
458 2874167586 2874162495 Bacteria 6174670
459 2874175708 2874168670 Bacteria 8062617
460 2874224240 2874220319 Bacteria 4594709
461 2876364737 2876363079 Bacteria 6544991
462 2876370400 2876369609 Bacteria 6807521
463 2876384093 2876377896 Bacteria 6565995
464 2876386681 2876386047 Bacteria 6698674
465 2876396207 2876392853 Bacteria 6660880
466 2876405904 2876399893 Bacteria 6927900
467 2876410487 2876406927 Bacteria 6191900
468 2876417576 2876413966 Bacteria 6831344
469 2878038557 2878035449 Bacteria 6555736
470 2878735831 2878730984 Bacteria 6380721
471 2878739396 2878738818 Bacteria 7136951
472 2878749403 2878745973 Bacteria 6867388
473 2878754417 2878753008 Bacteria 6922523
474 2878762223 2878760144 Bacteria 6823465
475 2878769190 2878767105 Bacteria 6898628
476 2878777202 2878774303 Bacteria 6108671
477 2881149402 2881147464 Bacteria 7779814
478 2881160610 2881155292 Bacteria 6461656
479 2881166304 2881161766 Bacteria 7127907
480 2881848358 2881845957 Bacteria 6611900
481 2881856994 2881853255 Bacteria 6698367
482 2881861635 2881861095 Bacteria 7128710
483 2882634075 2882632389 Bacteria 8154593
484 2882919351 2882912400 Bacteria 6801539
485 2885307732 2885305155 Bacteria 7348390
486 2885313272 2885312484 Bacteria 6415165
487 2885321662 2885318864 Bacteria 6729568
488 2885332314 2885326080 Bacteria 7134805
489 2885337897 2885334103 Bacteria 7216818
490 2885343328 2885342637 Bacteria 7011821
491 2885354159 2885350715 Bacteria 6787678
492 2888337950 2888337043 Bacteria 6629336
493 2888345249 2888343758 Bacteria 6611049
494 2888354541 2888350351 Bacteria 7372807
495 2889016145 2889010040 Bacteria 6749192
496 2889018815 2889016732 Bacteria 6700763
497 2894654154 2894652903 Bacteria 4587256
498 2898795398 2898795034 Bacteria 4294459
499 2903449277 2903448605 Bacteria 7357801
500 2903493634 2903492973 Bacteria 13473544
501 2903497622 2903492973 Bacteria 13473544
502 2903522527 2903521522 Bacteria 6525694
503 2903528906 2903528002 Bacteria 6586099
504 2903542799 2903540706 Bacteria 7062119
505 2904580420 2904578770 Bacteria 5302906
506 2904662983 2904659560 Bacteria 6685615
507 2906310441 2906308376 Bacteria 6841989
508 2906324506 2906321335 Bacteria 6579571
509 2906333305 2906328253 Bacteria 6585166
510 2906364320 2906363423 Bacteria 6856682
511 2906375084 2906370794 Bacteria 6881062
512 2906385263 2906378014 Bacteria 6911440
513 2906390821 2906386501 Bacteria 5977019
514 2906396860 2906393657 Bacteria 6790866
515 2906405639 2906401398 Bacteria 6693206
516 2906413438 2906408224 Bacteria 6162342
517 2906417584 2906414383 Bacteria 6580790
518 2919092082 2919089067 Bacteria 4560942
519 2919119905 2919119836 Bacteria 5208557
520 2919132924 2919130084 Bacteria 5301837
521 2919135335 2919134579 Bacteria 4480386
522 2919679106 2919679072 Bacteria 4629602
523 2922135973 2922130491 Bacteria 7173936
524 2922154823 2922151315 Bacteria 6902399
525 2922163824 2922158528 Bacteria 6573167
526 2922173307 2922172374 Bacteria 6167644
527 2922193583 2922185730 Bacteria 7113964
528 2924714560 2924710171 Bacteria 6752351
529 2924726354 2924718760 Bacteria 6331356
530 2924731970 2924726620 Bacteria 6271473
531 2924736337 2924733363 Bacteria 7574837
532 2924741312 2924741084 Bacteria 6661321
533 2924748791 2924748358 Bacteria 6154725
534 2924757031 2924754689 Bacteria 6774424
535 2924769308 2924762789 Bacteria 6561353
536 2924776917 2924776078 Bacteria 7492003
537 2924790195 2924784321 Bacteria 7416538
538 2928498716 2928496128 Bacteria 4631123
539 2928526605 2928521798 Bacteria 4960112
540 2929199436 2929195423 Bacteria 5325372
541 2931382355 2931380184 Bacteria 4455911
542 2937612963 2937610967 Bacteria 4618818
543 2937817269 2937813078 Bacteria 7783518
544 2937828378 2937822353 Bacteria 7290551
545 2937837552 2937836603 Bacteria 6811263
546 2937855455 2937848649 Bacteria 6983481
547 2937865533 2937861824 Bacteria 6660327
548 2937875721 2937868953 Bacteria 6639878
549 2937883483 2937877337 Bacteria 7246526
550 2937896664 2937891427 Bacteria 6357007
551 2937973538 2937972304 Bacteria 7532020
552 2937984642 2937980651 Bacteria 6517427
553 2937996650 2937994558 Bacteria 7036190
554 2938022494 2938014810 Bacteria 6700592
555 2939592313 2939589442 Bacteria 4214238
556 2939625272 2939622612 Bacteria 4698046
557 2939629541 2939626828 Bacteria 4695272
558 2941477620 2941475908 Bacteria 4145589
559 2954013404 2954011201 Bacteria 4762601
560 2958041837 2958034702 Bacteria 6989922
561 2958046681 2958041894 Bacteria 13082850
562 2958050368 2958041894 Bacteria 13082850
563 2958070092 2958064165 Bacteria 7158582
564 2958073617 2958071322 Bacteria 6815895
565 2958090650 2958084443 Bacteria 7312792
566 2958094850 2958092219 Bacteria 6861151
567 2958108056 2958100919 Bacteria 6800575
568 2958112166 2958108152 Bacteria 6681128
569 2958116125 2958115193 Bacteria 6923548
570 2958125909 2958122699 Bacteria 7280457
571 2958132296 2958130278 Bacteria 6897202
572 2958139968 2958137437 Bacteria 6050276
573 2958148652 2958144490 Bacteria 6677056
574 2958161136 2958158011 Bacteria 6058449
575 2958167121 2958165035 Bacteria 6906348
576 2958176883 2958172287 Bacteria 6716688
577 2958182110 2958179912 Bacteria 6874908
578 2961051004 2961047084 Bacteria 4594415
579 2961065775 2961064222 Bacteria 4749990
580 2961079954 2961077736 Bacteria 7079850
581 2961118009 2961114664 Bacteria 6680456
582 2961133779 2961127735 Bacteria 7196641
583 2961143519 2961136820 Bacteria 6775228
584 2961165590 2961163497 Bacteria 6901077
585 2961171847 2961170736 Bacteria 7072258
586 2961185097 2961183825 Bacteria 6688536
587 2963646193 2963644680 Bacteria 6530403
588 2965020413 2965018300 Bacteria 6883036
589 2965025658 2965025482 Bacteria 6532201
590 2965035783 2965032056 Bacteria 6887443
591 2965047210 2965040258 Bacteria 6855979
592 2965052195 2965047637 Bacteria 6623551
593 2965069854 2965062239 Bacteria 7412989
594 2965092233 2965089291 Bacteria 6866420
595 2965104423 2965102966 Bacteria 6800987
596 2965118481 2965110997 Bacteria 6693150
597 2965122179 2965119406 Bacteria 6956431
598 2967996954 2967996073 Bacteria 6787468
599 2968005015 2968003550 Bacteria 6929263
600 2968016666 2968016561 Bacteria 7022047
601 2968085340 2968083720 Bacteria 7351627
602 2968091458 2968091066 Bacteria 6052692
603 2968101985 2968097103 Bacteria 6107094
604 2968114070 2968110612 Bacteria 6814636
605 2968123261 2968117919 Bacteria 6536078
606 2968129080 2968128360 Bacteria 6270294
607 2968146224 2968138860 Bacteria 6605449
608 2968173992 2968171901 Bacteria 6894245
609 2970470008 2970469710 Bacteria 6969209
610 2970492614 2970489779 Bacteria 6517260
611 2970504445 2970503327 Bacteria 7099517
612 2970515198 2970510686 Bacteria 7006402
613 2970526963 2970524798 Bacteria 6840927
614 2970536248 2970532167 Bacteria 6553173
615 2970540101 2970540015 Bacteria 6977556
616 2970554830 2970547951 Bacteria 6931819
617 2970557078 2970554993 Bacteria 6814252
618 2970600438 2970593180 Bacteria 7073582
619 2970627042 2970619444 Bacteria 6986144
620 2970633221 2970627176 Bacteria 6680862
621 2974310343 2974307012 Bacteria 4172388
622 2977251074 2977247770 Bacteria 4160543
623 2977823634 2977821940 Bacteria 6906439
624 2977831502 2977828996 Bacteria 7007971
625 2977847558 2977843712 Bacteria 6753583
626 2977857618 2977851361 Bacteria 6694324
627 2977860137 2977858184 Bacteria 6215359
628 2977871037 2977864932 Bacteria 7534097
629 2977876898 2977872689 Bacteria 7270173
630 2977906326 2977898635 Bacteria 6675551
631 2977911209 2977907340 Bacteria 6577984
632 2977919982 2977915119 Bacteria 6829656
633 2977928837 2977922695 Bacteria 6956781
634 2977940505 2977935797 Bacteria 6252826
635 2977943050 2977942078 Bacteria 7570577
636 2977952222 2977950692 Bacteria 6893264
637 2977965054 2977957713 Bacteria 6877875
638 2977972903 2977971508 Bacteria 7472917
639 2977991814 2977986579 Bacteria 6581278
640 2979714672 2979710463 Bacteria 6785254
641 2979745288 2979742915 Bacteria 7301278
642 2979772617 2979772303 Bacteria 6618277
643 2979781577 2979779861 Bacteria 6219781
644 2979799670 2979793036 Bacteria 6808957
645 2979809082 2979808191 Bacteria 7179355
646 2984514433 2984514374 Bacteria 4172479
647 2987606606 2987605356 Bacteria 4187822
648 2987643898 2987636660 Bacteria 8088555
649 2987648917 2987645492 Bacteria 6117018
650 2987657330 2987652177 Bacteria 6969023
651 2987661598 2987659509 Bacteria 6966464
652 2987672484 2987666974 Bacteria 6509233
653 2987677756 2987673487 Bacteria 6884027
654 2990714148 2990710928 Bacteria 5002431
655 2996315701 2996310559 Bacteria 6357320
656 2996341317 2996336353 Bacteria 5511628
657 2996347805 2996341866 Bacteria 6643098
658 2996353063 2996348954 Bacteria 7239054
659 2996389681 2996386984 Bacteria 6978667
660 3000141347 3000135777 Bacteria 6891109
661 3000408230 3000405567 Bacteria 3779330
662 3002141233 3002141150 Bacteria 5254435
663 3004174342 3004167301 Bacteria 8330599
664 3004190647 3004188549 Bacteria 6952365
665 3004201227 3004195979 Bacteria 6776956
666 3004208047 3004203850 Bacteria 7307914
667 3004211482 3004211236 Bacteria 7417683
668 3004224969 3004218560 Bacteria 7421728
669 3004238819 3004232784 Bacteria 6662140
670 3004243388 3004239961 Bacteria 6892290
671 3004254868 3004248173 Bacteria 6563236
672 3004270599 3004268573 Bacteria 7043476
673 3004279745 3004275668 Bacteria 7114440
674 3004336227 3004334049 Bacteria 8449246
675 637076096 637000159 Bacteria 7596297
676 649871390 649633066 Bacteria 6690028
677 8002290209 8002285264 Bacteria 6717907
678 8004301340 8004300914 Bacteria 6132239
679 8004315101 8004312739 Bacteria 7444653
680 8004367892 8004361976 Bacteria 6858373
681 8004375993 8004374579 Bacteria 6898112
682 8004389680 8004387939 Bacteria 7049250
683 8004448748 8004445564 Bacteria 6322258
684 8004637974 8004633249 Bacteria 6723080
685 8004645532 8004640170 Bacteria 6723001
686 8004703333 8004695233 Bacteria 6731676
687 8004704490 8004703790 Bacteria 8006957
688 8004718077 8004714634 Bacteria 6776161
689 8004732935 8004727605 Bacteria 6643904
690 8021622836 8021622325 Bacteria 4844743
691 8021628579 8021626552 Bacteria 4665214
692 8021651606 8021648035 Bacteria 4772378
693 8054565391 8054563764 Bacteria 5592885
694 8055618812 8055617313 Bacteria 7548464
695 Ga0496126_0228677
696 JGI24735J21928_10063571
697 JGI25156J39149_1005065
698 JGI25157J39369_1001464
699 JGI25152J39213_1001154
700 JGI25150J39212_1000897
701 JGI25151J46595_10002149
702 JGI25406J46586_10087442
703 JGI25165J46597_1000097
704 JGI25153J46596_10001944
705 rootH2_10013913
706 Ga0055542_1000343
707 Ga0055536_1001880
708 Ga0055536_1002862
709 Ga0055536_1003048
710 Ga0055534_1001814
711 Ga0055528_1000045
712 Ga0055530_10000720
713 Ga0055530_10001111
714 Ga0055531_10004051
715 Ga0055531_10006197
716 Ga0055531_10012885
717 Ga0065165_1067642
718 Ga0070660_100252845
719 Ga0070668_100032286
720 Ga0070663_100014455
721 Ga0070678_100134949
722 Ga0070678_100384186
723 Ga0068867_100302024
724 Ga0068853_100070115
725 Ga0068853_100303777
726 Ga0068853_100348353
727 Ga0070665_100025937
728 Ga0070665_100027124
729 Ga0070665_100038607
730 Ga0070665_100082334
731 Ga0068856_100390397
732 Ga0081539_10000618
733 Ga0075365_10038806
734 Ga0075365_10075952
735 Ga0075365_10107664
736 Ga0075365_10124842
737 Ga0075368_10011792
738 Ga0075368_10097896
739 Ga0075364_10068051
740 Ga0075364_10103978
741 Ga0075364_10334277
742 Ga0075364_10381947
743 Ga0075362_10131761
744 Ga0075370_10146486
745 Ga0105251_10000624
746 Ga0105244_10047565
747 Ga0105240_10298517
748 Ga0105240_10446017
749 Ga0105243_10002836
750 Ga0105248_10331418
751 Ga0105237_10391292
752 Ga0105238_10005971
753 Ga0105239_10151493
754 Ga0105239_10173392
755 Ga0105239_11057206
756 Ga0157371_10004416
757 Ga0157371_10079423
758 Ga0157370_10021264
759 Ga0157370_10177475
760 Ga0157370_10719328
761 Ga0157369_10115097
762 Ga0163162_10270450
763 Ga0182008_10000410
764 Ga0182008_10006554
765 Ga0182008_10020298
766 Ga0182006_1007235
767 Ga0182006_1071230
768 Ga0182007_10000025
769 Ga0182005_1000321
770 Ga0182005_1007836
771 Ga0163161_10009634
772 Ga0163161_10014626
773 Ga0163161_10071279
774 Ga0163161_10294452
775 Ga0207425_1000015
776 Ga0209026_1000041
777 Ga0209148_1000069
778 Ga0209148_1023955
779 Ga0209759_1000183
780 Ga0209129_1000126
781 Ga0209233_1000030
782 Ga0209565_1000037
783 Ga0209455_1000161
784 Ga0209673_1000494
785 Ga0209675_1000020
786 Ga0209676_1000149
787 Ga0209676_1000307
788 Ga0209676_1001356
789 Ga0209025_1000002
790 Ga0209564_1001178
791 Ga0209758_1000003
792 Ga0209758_1015262
793 Ga0209050_1000670
794 Ga0209050_1000711
795 Ga0209050_1092148
796 Ga0209256_1008529
797 Ga0209256_1020166
798 Ga0209051_1002509
799 Ga0209257_1000587
800 Ga0209257_1002459
801 Ga0209257_1005642
802 Ga0207655_1038564
803 Ga0207713_1000414
804 Ga0207713_1034073
805 Ga0207647_10004907
806 Ga0207647_10146162
807 Ga0207645_10101894
808 Ga0207705_10194435
809 Ga0207671_10069128
810 Ga0207657_10250862
811 Ga0207681_10332763
812 Ga0207694_10049376
813 Ga0207650_10003991
814 Ga0207709_10001693
815 Ga0207709_10128753
816 Ga0207669_10081778
817 Ga0207691_10120612
818 Ga0207668_10008328
819 Ga0207668_10827243
820 Ga0207640_10123618
821 Ga0207658_10339190
822 Ga0207639_10065985
823 Ga0207639_10268492
824 Ga0207678_10021848
825 Ga0207678_10229115
826 Ga0207678_10538997
827 Ga0207702_10238358
828 Ga0207702_10644640
829 Ga0207648_10157187
830 Ga0207674_10446912
831 Ga0207683_10046296
832 Ga0207683_10471893
833 Ga0207698_10034184
834 Ga0209371_1000028
835 Ga0207428_10471184
836 Ga0268266_10026079
837 Ga0268266_10027038
838 Ga0268266_10133134
839 Ga0268256_1000030
840 Ga0316176_1131576
841 Ga0307513_10346337
842 Ga0316576_10005596
843 Ga0307412_10001530
844 Ga0307412_10391156
845 Ga0307414_10015807
846 Ga0307414_11177704
847 Ga0316593_10080616
848 Ga0316582_0022209
849 Ga0316584_0023028
850 Ga0316584_0185161
851 Ga0395899_0000288
852 Ga0395900_0000246
853 Ga0395900_0212060
854 Ga0395898_0000447
855 Ga0395905_0000228
856 Ga0395901_0000167
857 Ga0237819_00157
858 Ga0400483_067089
859 Ga0400483_120563
860 Ga0400483_286820
861 Ga0439465_0029885
862 Ga0439465_0165604
863 Ga0451791_0318194
864 Ga0451793_0572447
865 Ga0451853_1166652
866 Ga0439432_104077
867 Ga0450911_001349
868 Ga0450901_002218
869 Ga0451576_0001111
870 Ga0466967_0249041
871 Ga0495627_001587
872 Ga0495638_0001256
873 Ga0495638_0008810
874 Ga0495638_0009777
875 Ga0495610_0004528
876 Ga0495610_0143480
877 Ga0495631_0002564
878 Ga0495632_0130696
879 Ga0495643_0000877
880 Ga0495643_0246857
881 Ga0495663_0001107
882 Ga0495663_0002303
883 Ga0495663_0065768
884 Ga0495633_0002272
885 Ga0495633_0005045
886 Ga0495633_0009205
887 Ga0495633_0017021
888 Ga0495668_0056553
889 Ga0495625_0010787
890 Ga0495625_0014692
891 Ga0495625_0369914
892 Ga0495661_0184512
893 Ga0495670_0045873
894 Ga0495672_0000594
895 Ga0495681_0066745
896 Ga0495686_0004506
897 Ga0495686_0013240
898 Ga0496101_0732079
899 Ga0496102_0128447
900 Ga0496103_0450275
901 Ga0496110_0631382
902 Ga0496112_0029566
903 Ga0496113_0105427
904 Ga0496115_0400350
905 Ga0496116_0004528
906 Ga0496116_0063715
907 Ga0496116_0194849
908 Ga0496117_0000766
909 Ga0496117_0005061
910 Ga0496117_0005724
911 Ga0496117_0010530
912 Ga0496117_0091173
913 Ga0496117_0104066
914 Ga0496118_0001226
915 Ga0496118_0007714
916 Ga0496118_0011562
917 Ga0496118_0027028
918 Ga0496118_0046638
919 Ga0496118_0124789
920 Ga0496118_0152587
921 Ga0496118_0186187
922 Ga0496119_0004946
923 Ga0496119_0005471
924 Ga0496119_0014983
925 Ga0496119_0095835
926 Ga0496119_0149609
927 Ga0496120_0000710
928 Ga0496120_0001433
929 Ga0496120_0012040
930 Ga0496120_0033672
931 Ga0496121_0010731
932 Ga0496121_0031613
933 Ga0496121_0104612
934 Ga0496121_0312942
935 Ga0496122_0001314
936 Ga0496122_0005726
937 Ga0496122_0007516
938 Ga0496122_0014079
939 Ga0496122_0041375
940 Ga0496122_0222731
941 Ga0496123_0001741
942 Ga0496123_0001850
943 Ga0496123_0009539
944 Ga0496123_0011019
945 Ga0496123_0016006
946 Ga0496123_0102126
947 Ga0496123_0168653
948 Ga0496124_0002020
949 Ga0496124_0002516
950 Ga0496124_0011683
951 Ga0496124_0012975
952 Ga0496124_0014923
953 Ga0496124_0018965
954 Ga0496124_0065113
955 Ga0496124_0102967
956 Ga0496124_0221733
957 Ga0496124_0380286
958 Ga0496125_0007630
959 Ga0496125_0014995
960 Ga0496125_0043331
961 Ga0496125_0076705
962 Ga0496125_0128381
963 Ga0496125_0172579
964 Ga0496126_0007716
965 Ga0496126_0030251
966 Ga0496126_0106247
967 Ga0496126_0134762
968 Ga0496126_0442553
969 Ga0501031_0000009
970 Ga0501031_0008288
971 Ga0501031_0221305
972 Ga0501032_0000001
973 Ga0501032_0000017
974 Ga0501032_0176365
975 Ga0501032_0214037
976 Ga0501033_0000029
977 Ga0501033_0000830
978 Ga0501033_0042254
979 Ga0501033_0076391
980 Ga0501033_0250400
981 Ga0501034_0000036
982 Ga0501034_0000102
983 Ga0501034_0002441
984 Ga0501034_0020962
985 Ga0501034_0036943
986 Ga0501034_0151988
987 Ga0501034_0197763
988 Ga0501036_0000011
989 Ga0501036_0000180
990 Ga0501036_0332318
991 Ga0501036_0339041
992 Ga0501037_0000015
993 Ga0501037_0000017
994 Ga0501037_0240301
995 Ga0501037_0244969
996 Ga0501038_0000016
997 Ga0501038_0000036
998 Ga0501038_0050902
999 Ga0501038_0051255
1000 Ga0501038_0204354
1001 Ga0501039_0000011
1002 Ga0501039_0000023
1003 Ga0501039_0232977
1004 Ga0501040_0000834
1005 Ga0501040_0027503
1006 Ga0501041_0224799
1007 Ga0501041_0247463
1008 Ga0501042_0017279
1009 Ga0501043_0000105
1010 Ga0501043_0000423
1011 Ga0501043_0034960
1012 Ga0501043_0106929
1013 Ga0501043_0199602
1014 Ga0501043_0313633
1015 Ga0501046_0028177
1016 Ga0501046_0035873
1017 Ga0501047_0002449
1018 Ga0501047_0168051
1019 Ga0501047_0168293
1020 Ga0501047_0419037
1021 Ga0501048_0007590
1022 Ga0501067_0004819
1023 Ga0501069_0024053
1024 Ga0501070_0003968
1025 Ga0501070_0014269
1026 Ga0501070_0074163
1027 Ga0501070_0328424
1028 Ga0501070_0451183
1029 Ga0501080_0026665
1030 Ga0501080_0098648
1031 Ga0501081_0425675
1032 Ga0501035_0000028
1033 Ga0501035_0000038
1034 Ga0501035_0004286
1035 Ga0501035_0154073
1036 Ga0501035_0341040
1037 Ga0501044_0000046
1038 Ga0501044_0193889
1039 Ga0501044_0376478
1040 Ga0501044_0388549
1041 Ga0501044_0415708
1042 Ga0501044_0448629
1043 Ga0501045_0101258
1044 Ga0501045_0163642
1045 nmdc:mga03n38_130683_c1
1046 nmdc:mga03n38_421492_c1
1047 nmdc:mga00v17_66825_c1
1048 nmdc:mga0yw44_102809_c1
1049 nmdc:mga0yw44_108245_c1
1050 nmdc:mga0yw44_109893_c1
1051 nmdc:mga0yw44_493364_c1
1052 Ga0500568_0000104
1053 Ga0500616_0021793
1054 Ga0500620_000291
1055 Ga0500611_042639
1056 Ga0501084_0492626
1057 2503199581
1058 2509142784
1059 2510319136
1060 2511392276
1061 2512933015
1062 2512961038
1063 2513611227
1064 2514035120
1065 2514417216
1066 2514587153
1067 2578459910
1068 2588519068
1069 2597811390
1070 2599939086
1071 2643771414
1072 2643776927
1073 2643795375
1074 2643836893
1075 2643986106
1076 2644057688
1077 2644072225
1078 2644130833
1079 2644153671
1080 2688596831
1081 2694634237
1082 2694637988
1083 2723573951
1084 2739241965
1085 2739309813
1086 2747950457
1087 2748017465
1088 2756677364
1089 2757570381
1090 2765467890
1091 2765577382
1092 2770198610
1093 2776270072
1094 2776281265
1095 2792748418
1096 2816470733
1097 2819662285
1098 2834580570
1099 2837653946
1100 2837679863
1101 2839997925
1102 2840765557
1103 2840882122
1104 2841737318
1105 2842392387
1106 2842721845
1107 2842761143
1108 2842875845
1109 2844009145
1110 2844012174
1111 2847674595
1112 2847690712
1113 2848699828
1114 2852653385
1115 2852688013
1116 2856317519
1117 2856328868
1118 2856334946
1119 2856343876
1120 2856350381
1121 2856360397
1122 2856366697
1123 2857356618
1124 2857371448
1125 2857445786
1126 2869165135
1127 2869173578
1128 2869240128
1129 2869250569
1130 2869258959
1131 2869265294
1132 2869274841
1133 2869285821
1134 2869287892
1135 2871435840
1136 2871440893
1137 2871448677
1138 2871463881
1139 2871472534
1140 2871479379
1141 2871487786
1142 2871489887
1143 2871498001
1144 2874105991
1145 2874111133
1146 2874117375
1147 2874128795
1148 2874133706
1149 2874141865
1150 2874151525
1151 2874159157
1152 2874167586
1153 2874175708
1154 2874224240
1155 2876364737
1156 2876370400
1157 2876384093
1158 2876386681
1159 2876396207
1160 2876405904
1161 2876410487
1162 2876417576
1163 2878038557
1164 2878735831
1165 2878739396
1166 2878749403
1167 2878754417
1168 2878762223
1169 2878769190
1170 2878777202
1171 2881149402
1172 2881160610
1173 2881166304
1174 2881848358
1175 2881856994
1176 2881861635
1177 2882634075
1178 2882919351
1179 2885307732
1180 2885313272
1181 2885321662
1182 2885332314
1183 2885337897
1184 2885343328
1185 2885354159
1186 2888337950
1187 2888345249
1188 2888354541
1189 2889016145
1190 2889018815
1191 2894654154
1192 2898795398
1193 2903449277
1194 2903493634
1195 2903497622
1196 2903522527
1197 2903528906
1198 2903542799
1199 2904580420
1200 2904662983
1201 2906310441
1202 2906324506
1203 2906333305
1204 2906364320
1205 2906375084
1206 2906385263
1207 2906390821
1208 2906396860
1209 2906405639
1210 2906413438
1211 2906417584
1212 2919092082
1213 2919119905
1214 2919132924
1215 2919135335
1216 2919679106
1217 2922135973
1218 2922154823
1219 2922163824
1220 2922173307
1221 2922193583
1222 2924714560
1223 2924726354
1224 2924731970
1225 2924736337
1226 2924741312
1227 2924748791
1228 2924757031
1229 2924769308
1230 2924776917
1231 2924790195
1232 2928498716
1233 2928526605
1234 2929199436
1235 2931382355
1236 2937612963
1237 2937817269
1238 2937828378
1239 2937837552
1240 2937855455
1241 2937865533
1242 2937875721
1243 2937883483
1244 2937896664
1245 2937973538
1246 2937984642
1247 2937996650
1248 2938022494
1249 2939592313
1250 2939625272
1251 2939629541
1252 2941477620
1253 2954013404
1254 2958041837
1255 2958046681
1256 2958050368
1257 2958070092
1258 2958073617
1259 2958090650
1260 2958094850
1261 2958108056
1262 2958112166
1263 2958116125
1264 2958125909
1265 2958132296
1266 2958139968
1267 2958148652
1268 2958161136
1269 2958167121
1270 2958176883
1271 2958182110
1272 2961051004
1273 2961065775
1274 2961079954
1275 2961118009
1276 2961133779
1277 2961143519
1278 2961165590
1279 2961171847
1280 2961185097
1281 2963646193
1282 2965020413
1283 2965025658
1284 2965035783
1285 2965047210
1286 2965052195
1287 2965069854
1288 2965092233
1289 2965104423
1290 2965118481
1291 2965122179
1292 2967996954
1293 2968005015
1294 2968016666
1295 2968085340
1296 2968091458
1297 2968101985
1298 2968114070
1299 2968123261
1300 2968129080
1301 2968146224
1302 2968173992
1303 2970470008
1304 2970492614
1305 2970504445
1306 2970515198
1307 2970526963
1308 2970536248
1309 2970540101
1310 2970554830
1311 2970557078
1312 2970600438
1313 2970627042
1314 2970633221
1315 2974310343
1316 2977251074
1317 2977823634
1318 2977831502
1319 2977847558
1320 2977857618
1321 2977860137
1322 2977871037
1323 2977876898
1324 2977906326
1325 2977911209
1326 2977919982
1327 2977928837
1328 2977940505
1329 2977943050
1330 2977952222
1331 2977965054
1332 2977972903
1333 2977991814
1334 2979714672
1335 2979745288
1336 2979772617
1337 2979781577
1338 2979799670
1339 2979809082
1340 2984514433
1341 2987606606
1342 2987643898
1343 2987648917
1344 2987657330
1345 2987661598
1346 2987672484
1347 2987677756
1348 2990714148
1349 2996315701
1350 2996341317
1351 2996347805
1352 2996353063
1353 2996389681
1354 3000141347
1355 3000408230
1356 3002141233
1357 3004174342
1358 3004190647
1359 3004201227
1360 3004208047
1361 3004211482
1362 3004224969
1363 3004238819
1364 3004243388
1365 3004254868
1366 3004270599
1367 3004279745
1368 3004336227
1369 637076096
1370 649871390
1371 8002290209
1372 8004301340
1373 8004315101
1374 8004367892
1375 8004375993
1376 8004389680
1377 8004448748
1378 8004637974
1379 8004645532
1380 8004703333
1381 8004704490
1382 8004718077
1383 8004732935
1384 8021622836
1385 8021628579
1386 8021651606
1387 8054565391
1388 8055618812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02592

Vut_1

Putative vitamin uptake transporter

61

234

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.6025 5 218
5kc4-assembly2.cif.gz_E structure of tmribu, orthorhombic crystal form 0.5894 5 218
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.5842 5 206
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.5599 5 206
7pbd-assembly1.cif.gz_D a1b3 gaba-a receptor + gaba 0.5108 44 156
ID Description Score Start End Superfamily
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.8142 43 213 1.10.1760.20
af_P37619_43_201_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7957 43 213 1.10.1760.20
af_A0A1D6H6C6_13_239_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.4047 49 221 1.50.40.10
af_P70600_859_1009_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.3934 29 171 1.20.120.330
af_K7V2D2_6_142_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.3926 53 207 1.10.10.1740
ID Description Score Start End GO Terms
AF-A0A432F5F3-F1-model_v4 VUT family protein 0.9744 1 80 GO:0016020
GO:1990397
AF-A0A432F5F3-F1-model_v4 VUT family protein 0.9511 1 80 GO:0016020
GO:1990397
AF-A0A1Q3KIT9-F1-model_v4 deleted 0.9417 1 223
AF-A0A0Q6EUD8-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9399 1 220 GO:0005886
GO:0022857
GO:1990397
AF-A0A317PGF6-F1-model_v4 Probable queuosine precursor transporter (Q precursor transporter) 0.9369 1 212 GO:0005886
GO:0022857
GO:1990397

Map