F475724

General Info

Members Datasets Scaffolds Average Seq Length
694 397 657 216

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10612207|Ga0105242_106122071
Length 256
Sequence MGSSYEQDNLSRNRQLIKRLIHRHTLFTRPHRGRSIREKTLKLLHIDSSPLGAQSVSRELTRRTVAQWQDSHPGTTVEYLDLAADAPSHLNMDSLGFRLGLDADALTPVQKRENARTEQLLSQFLAADVVVVGAPMYNFSIPSQLKAWIDRVAQAGRTFKYTDQGPVGLAAGKTVIVVSSRGGAYSANPALAFLDHQESYLTAVFGFFGITDVRFVRAEGVAMGDAAKAHAIASAEADIRVHAAEAANEGKVALRA

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
10 2643221652 Acidovorax sp. Root402 Isolate Unclassified
11 2643221658 Variovorax sp. Root411 Isolate Unclassified
12 2643221672 Variovorax sp. Root434 Isolate Unclassified
13 2643221683 Variovorax sp. Root473 Isolate Unclassified
14 2643221717 Acidovorax sp. Root267 Isolate Unclassified
15 2738541277 Variovorax sp. GV051 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
18 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
19 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
20 2842677519 Variovorax sp. R-72495 Isolate Unclassified
21 2842733646 Variovorax sp. R-72446 Isolate Unclassified
22 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
23 2885198086 Variovorax sp. 679 Isolate Unclassified
24 2885211737 Variovorax sp. 553 Isolate Unclassified
25 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
26 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
27 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
28 2904456579 Variovorax sp. 2002 Isolate Unclassified
29 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
30 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
31 2928070936 Variovorax gossypii 1167 Isolate Unclassified
32 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
33 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
34 2929520902 Variovorax beijingensis 502 Isolate Unclassified
35 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
36 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
37 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
38 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
39 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
40 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
41 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
45 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
46 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
47 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
48 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
49 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
50 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
51 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
56 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
57 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
58 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
59 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
60 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
61 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
64 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
65 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
66 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
67 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
68 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
69 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
70 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
71 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
72 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
87 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
119 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
125 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
126 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
127 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
128 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
129 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
130 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
143 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
144 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
145 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
147 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
155 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
156 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
162 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
164 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
167 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
212 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
213 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
214 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
215 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
216 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
217 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
218 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
219 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
220 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
227 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
240 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
241 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
242 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
243 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
244 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
247 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
250 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
251 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
252 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
253 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
254 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
255 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
256 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
257 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
258 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
259 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
260 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
261 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
262 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
263 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
264 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
265 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
266 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
267 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
268 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
269 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
270 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
271 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
274 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
283 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
286 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
287 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
288 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
289 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
290 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
291 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
292 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
293 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
294 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
295 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
296 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
297 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
298 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
299 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
300 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
301 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
309 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
310 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
313 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
314 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
315 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
316 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
319 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
328 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
329 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
330 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
331 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
332 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
338 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
339 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
340 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
341 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
342 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
350 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
351 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
361 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
362 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
363 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
372 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
373 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
374 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
375 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
376 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
377 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
378 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
379 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
380 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
381 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
382 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
383 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
384 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
385 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
386 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
387 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
388 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
389 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
390 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
391 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
392 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
393 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
394 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
395 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.9
Metatranscriptomes 6.77
Isolates 5.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.63
Nodule 0.86
Rhizoplane 4.61
Rhizosphere 62.25
Stem 0
Stem Tuber 0
Unclassified 8.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000392 3300002704 Bacteria 12366
2 JGI25156J39149_1001058 3300002705 Bacteria 12712
3 JGI25154J39366_1000894 3300002738 Bacteria 12712
4 JGI25157J39369_1001038 3300002741 Bacteria 12712
5 JGI25159J45721_1003130 3300002987 Bacteria 5957
6 JGI25159J45721_1007356 3300002987 Bacteria 3166
7 JGI25151J46595_10001260 3300003187 Bacteria 17947
8 JGI25151J46595_10005828 3300003187 Bacteria 6304
9 JGI25151J46595_10007367 3300003187 Bacteria 5405
10 Ga0006770J48903_1041039 3300003305 Bacteria 954
11 Ga0006777J48905_1077401 3300003308 Bacteria 711
12 JGI25160J50197_1011352 3300003354 Bacteria 3166
13 JGI25161J50226_1004040 3300003374 Bacteria 3166
14 Ga0007416J51690_1036082 3300003577 Bacteria 993
15 Ga0007416J51690_1045190 3300003577 Bacteria 1452
16 Ga0007416J51690_1059848 3300003577 Bacteria 703
17 Ga0007429J51699_1020602 3300003579 Bacteria 1326
18 Ga0055535_1000330 3300003761 Bacteria 47889
19 Ga0055542_1000039 3300003762 Bacteria 215126
20 Ga0055526_1001314 3300003771 Bacteria 17813
21 Ga0055526_1008772 3300003771 Bacteria 4980
22 Ga0055537_1000034 3300003773 Bacteria 98043
23 Ga0055537_1000285 3300003773 Bacteria 36115
24 Ga0055537_1000373 3300003773 Bacteria 30435
25 Ga0055537_1011479 3300003773 Bacteria 1795
26 Ga0055524_1000016 3300003775 Bacteria 244926
27 Ga0055536_1001531 3300003781 Bacteria 13863
28 Ga0055536_1004149 3300003781 Bacteria 7508
29 Ga0055534_1000018 3300003784 Bacteria 138136
30 Ga0055534_1001269 3300003784 Bacteria 10294
31 Ga0055528_1000401 3300003790 Bacteria 35131
32 Ga0055528_1000527 3300003790 Bacteria 29607
33 Ga0055528_1024650 3300003790 Bacteria 1795
34 Ga0055528_1025740 3300003790 Bacteria 1715
35 Ga0055530_10000431 3300003791 Bacteria 37213
36 Ga0055530_10015125 3300003791 Bacteria 2539
37 Ga0055530_10028411 3300003791 Bacteria 1510
38 Ga0055540_1000031 3300003792 Bacteria 177859
39 Ga0055540_1000788 3300003792 Bacteria 21446
40 Ga0055540_1001180 3300003792 Bacteria 16115
41 Ga0055540_1008068 3300003792 Bacteria 3846
42 Ga0055531_10002449 3300003794 Bacteria 12423
43 Ga0055543_1004921 3300004625 Bacteria 3518
44 Ga0055543_1005541 3300004625 Bacteria 3204
45 Ga0065714_10015276 3300005288 Bacteria 2255
46 Ga0065714_10105205 3300005288 Bacteria 1570
47 Ga0065714_10188073 3300005288 Bacteria 937
48 Ga0065704_10074000 3300005289 Bacteria 6602
49 Ga0065715_10007212 3300005293 Bacteria 4129
50 Ga0065715_10114105 3300005293 Bacteria 2462
51 Ga0070658_10084151 3300005327 Bacteria 2616
52 Ga0070658_10182318 3300005327 Bacteria 1767
53 Ga0070658_10277299 3300005327 Bacteria 1427
54 Ga0070676_10024726 3300005328 Bacteria 3387
55 Ga0070690_100003807 3300005330 Bacteria 8311
56 Ga0068869_100045046 3300005334 Bacteria 3174
57 Ga0070666_10006291 3300005335 Bacteria 7301
58 Ga0070666_10093364 3300005335 Bacteria 2069
59 Ga0070680_100341375 3300005336 Bacteria 1273
60 Ga0068868_100017362 3300005338 Bacteria 5360
61 Ga0070660_100090762 3300005339 Bacteria 2409
62 Ga0070668_100133658 3300005347 Bacteria 1993
63 Ga0070668_100276798 3300005347 Bacteria 1400
64 Ga0070669_100019979 3300005353 Bacteria 4783
65 Ga0070669_100836294 3300005353 Bacteria 784
66 Ga0070675_100001058 3300005354 Bacteria 19826
67 Ga0070675_100184884 3300005354 Bacteria 1803
68 Ga0070671_100020705 3300005355 Bacteria 5365
69 Ga0070671_100356188 3300005355 Bacteria 1249
70 Ga0070674_100311307 3300005356 Bacteria 1259
71 Ga0070673_100029058 3300005364 Bacteria 4119
72 Ga0070688_100025823 3300005365 Bacteria 3483
73 Ga0070659_100863503 3300005366 Bacteria 789
74 Ga0070667_100013446 3300005367 Bacteria 6766
75 Ga0070667_100048932 3300005367 Bacteria 3560
76 Ga0070708_100703966 3300005445 Bacteria 951
77 Ga0070663_100233939 3300005455 Bacteria 1448
78 Ga0070678_100012066 3300005456 Bacteria 5355
79 Ga0070678_100170557 3300005456 Bacteria 1772
80 Ga0070678_100795132 3300005456 Bacteria 858
81 Ga0070662_100004214 3300005457 Bacteria 9058
82 Ga0070662_100247499 3300005457 Bacteria 1432
83 Ga0070662_100723715 3300005457 Bacteria 843
84 Ga0068867_100055819 3300005459 Bacteria 2921
85 Ga0068867_100072252 3300005459 Bacteria 2582
86 Ga0070698_100755748 3300005471 Bacteria 915
87 Ga0070679_100103958 3300005530 Bacteria 2826
88 Ga0070679_100113030 3300005530 Bacteria 2701
89 Ga0068853_100051727 3300005539 Bacteria 3537
90 Ga0068853_100302366 3300005539 Bacteria 1479
91 Ga0068853_100365169 3300005539 Bacteria 1346
92 Ga0070672_100124366 3300005543 Bacteria 2114
93 Ga0070672_100258777 3300005543 Bacteria 1467
94 Ga0070665_100187817 3300005548 Bacteria 2067
95 Ga0070665_100610418 3300005548 Bacteria 1104
96 Ga0068855_100016751 3300005563 Bacteria 8814
97 Ga0068855_100281364 3300005563 Bacteria 1847
98 Ga0070664_100041366 3300005564 Bacteria 3889
99 Ga0068854_100680502 3300005578 Bacteria 886
100 Ga0068856_100337264 3300005614 Bacteria 1526
101 Ga0068852_100520334 3300005616 Bacteria 1187
102 Ga0068859_100022769 3300005617 Bacteria 6282
103 Ga0068864_100000212 3300005618 Bacteria 52395
104 Ga0068866_10024083 3300005718 Bacteria 2840
105 Ga0068861_100284798 3300005719 Bacteria 1424
106 Ga0068863_100001367 3300005841 Bacteria 24264
107 Ga0068863_100775827 3300005841 Bacteria 955
108 Ga0068858_100002207 3300005842 Bacteria 19715
109 Ga0068860_100059901 3300005843 Bacteria 3619
110 Ga0068862_100220132 3300005844 Bacteria 1718
111 Ga0068862_100295282 3300005844 Bacteria 1489
112 Ga0075365_10008170 3300006038 Bacteria 5918
113 Ga0075365_10447070 3300006038 Bacteria 913
114 Ga0075363_100019632 3300006048 Bacteria 3380
115 Ga0075363_100171268 3300006048 Bacteria 1232
116 Ga0075364_10026087 3300006051 Bacteria 3725
117 Ga0075432_10030376 3300006058 Bacteria 1867
118 Ga0075432_10085254 3300006058 Bacteria 1150
119 Ga0075362_10031575 3300006177 Bacteria 2293
120 Ga0075362_10042960 3300006177 Bacteria 2000
121 Ga0075362_10108518 3300006177 Bacteria 1305
122 Ga0075367_10058598 3300006178 Bacteria 2292
123 Ga0075366_10009650 3300006195 Bacteria 5395
124 Ga0075366_10115852 3300006195 Bacteria 1614
125 Ga0075366_10156024 3300006195 Bacteria 1382
126 Ga0097621_100007144 3300006237 Bacteria 7960
127 Ga0097621_100072548 3300006237 Bacteria 2848
128 Ga0097621_100073271 3300006237 Bacteria 2835
129 Ga0097621_100504052 3300006237 Bacteria 1097
130 Ga0075370_10005901 3300006353 Bacteria 6125
131 Ga0075370_10009157 3300006353 Bacteria 5126
132 Ga0075370_10009692 3300006353 Bacteria 5013
133 Ga0075370_10010505 3300006353 Bacteria 4841
134 Ga0075370_10046297 3300006353 Bacteria 2461
135 Ga0075370_10342967 3300006353 Bacteria 892
136 Ga0068871_100016987 3300006358 Bacteria 5495
137 Ga0068871_100308343 3300006358 Bacteria 1391
138 Ga0075429_100478710 3300006880 Bacteria 1091
139 Ga0068865_100030894 3300006881 Bacteria 3567
140 Ga0097620_100022770 3300006931 Bacteria 6282
141 Ga0099826_10000116 3300006948 Bacteria 36767
142 Ga0099826_10217346 3300006948 Bacteria 1032
143 Ga0105244_10006285 3300009036 Bacteria 7731
144 Ga0105240_10134415 3300009093 Bacteria 2963
145 Ga0105243_10014281 3300009148 Bacteria 6009
146 Ga0105243_10387527 3300009148 Bacteria 1294
147 Ga0105241_10275970 3300009174 Bacteria 1434
148 Ga0105242_10344667 3300009176 Bacteria 1374
149 Ga0105242_10612207 3300009176 Bacteria 1054
150 Ga0105248_10024395 3300009177 Bacteria 6725
151 Ga0105248_10891850 3300009177 Bacteria 1004
152 Ga0105237_10122282 3300009545 Bacteria 2597
153 Ga0105237_10332011 3300009545 Bacteria 1525
154 Ga0105238_10115661 3300009551 Bacteria 2661
155 Ga0105249_10091984 3300009553 Bacteria 2839
156 Ga0105239_10206651 3300010375 Bacteria 2200
157 Ga0105246_10089496 3300011119 Bacteria 2215
158 Ga0105246_10097776 3300011119 Bacteria 2131
159 Ga0157373_10079660 3300013100 Bacteria 2310
160 Ga0157370_10034191 3300013104 Bacteria 4952
161 Ga0157369_10034980 3300013105 Bacteria 5508
162 Ga0157374_10055118 3300013296 Bacteria 3710
163 Ga0157374_10368459 3300013296 Bacteria 1429
164 Ga0157378_10168337 3300013297 Bacteria 2053
165 Ga0163162_10019158 3300013306 Bacteria 6711
166 Ga0163162_10110726 3300013306 Bacteria 2843
167 Ga0163162_10117062 3300013306 Bacteria 2766
168 Ga0163162_10280428 3300013306 Bacteria 1798
169 Ga0163162_10700381 3300013306 Bacteria 1134
170 Ga0157375_10024781 3300013308 Bacteria 5560
171 Ga0157375_10092116 3300013308 Bacteria 3094
172 Ga0157375_10415970 3300013308 Bacteria 1511
173 Ga0163163_10027074 3300014325 Bacteria 5486
174 Ga0157380_10226896 3300014326 Bacteria 1675
175 Ga0182008_10000190 3300014497 Bacteria 48677
176 Ga0182008_10001821 3300014497 Bacteria 13892
177 Ga0182008_10022826 3300014497 Bacteria 3202
178 Ga0182008_10037658 3300014497 Bacteria 2420
179 Ga0182008_10101753 3300014497 Bacteria 1420
180 Ga0157379_10019567 3300014968 Bacteria 5979
181 Ga0157376_10043764 3300014969 Bacteria 3676
182 Ga0157376_10054969 3300014969 Bacteria 3320
183 Ga0157376_10547501 3300014969 Bacteria 1145
184 Ga0182006_1001217 3300015261 Bacteria 16063
185 Ga0182006_1050345 3300015261 Bacteria 1605
186 Ga0182007_10000916 3300015262 Bacteria 16314
187 Ga0182007_10001403 3300015262 Bacteria 12974
188 Ga0182007_10059013 3300015262 Bacteria 1258
189 Ga0163161_10000092 3300017792 Bacteria 90636
190 Ga0163161_10003072 3300017792 Bacteria 11775
191 Ga0163161_10021484 3300017792 Bacteria 4535
192 Ga0163161_10038890 3300017792 Bacteria 3413
193 Ga0163161_10040574 3300017792 Bacteria 3344
194 Ga0163161_10169556 3300017792 Bacteria 1668
195 Ga0206352_11194471 3300020078 Bacteria 714
196 Ga0209435_100001 3300025206 Bacteria 1424171
197 Ga0209672_100647 3300025228 Bacteria 17930
198 Ga0209147_101107 3300025229 Bacteria 11223
199 Ga0209258_100099 3300025242 Bacteria 214924
200 Ga0207425_1000799 3300025245 Bacteria 16016
201 Ga0207425_1003171 3300025245 Bacteria 5378
202 Ga0209646_1000001 3300025246 Bacteria 3092932
203 Ga0209026_1000003 3300025250 Bacteria 1060571
204 Ga0209148_1000103 3300025254 Bacteria 215356
205 Ga0209759_1000001 3300025256 Bacteria 2799452
206 Ga0209129_1000007 3300025258 Bacteria 771325
207 Ga0209129_1000528 3300025258 Bacteria 26713
208 Ga0209129_1001701 3300025258 Bacteria 11876
209 Ga0209565_1000004 3300025263 Bacteria 983150
210 Ga0209565_1000075 3300025263 Bacteria 162259
211 Ga0209565_1000199 3300025263 Bacteria 71613
212 Ga0209565_1002461 3300025263 Bacteria 6648
213 Ga0209565_1005599 3300025263 Bacteria 3629
214 Ga0209673_1000045 3300025273 Bacteria 290531
215 Ga0209673_1000128 3300025273 Bacteria 164482
216 Ga0209673_1000289 3300025273 Bacteria 93941
217 Ga0209673_1001078 3300025273 Bacteria 30774
218 Ga0209673_1004719 3300025273 Bacteria 7177
219 Ga0209130_1000056 3300025284 Bacteria 210851
220 Ga0209130_1000155 3300025284 Bacteria 102476
221 Ga0209130_1000321 3300025284 Bacteria 56239
222 Ga0209130_1001524 3300025284 Bacteria 14876
223 Ga0209675_1000074 3300025291 Bacteria 162260
224 Ga0209675_1000114 3300025291 Bacteria 112118
225 Ga0209675_1000225 3300025291 Bacteria 57878
226 Ga0209675_1008925 3300025291 Bacteria 3604
227 Ga0209675_1037319 3300025291 Bacteria 1093
228 Ga0209676_1000007 3300025292 Bacteria 1029371
229 Ga0209676_1000122 3300025292 Bacteria 195510
230 Ga0209676_1000301 3300025292 Bacteria 99952
231 Ga0209025_1000073 3300025294 Bacteria 282133
232 Ga0209025_1000248 3300025294 Bacteria 126818
233 Ga0209025_1000491 3300025294 Bacteria 75913
234 Ga0209025_1008800 3300025294 Bacteria 7179
235 Ga0209025_1012900 3300025294 Bacteria 5310
236 Ga0209025_1013011 3300025294 Bacteria 5267
237 Ga0209025_1014941 3300025294 Bacteria 4728
238 Ga0209564_1000358 3300025295 Bacteria 85036
239 Ga0209564_1000360 3300025295 Bacteria 84454
240 Ga0209564_1000603 3300025295 Bacteria 56168
241 Ga0209564_1001768 3300025295 Bacteria 20112
242 Ga0209564_1006761 3300025295 Bacteria 6082
243 Ga0209758_1000025 3300025297 Bacteria 586687
244 Ga0209758_1006146 3300025297 Bacteria 8800
245 Ga0209758_1031838 3300025297 Bacteria 2154
246 Ga0209050_1000003 3300025298 Bacteria 1609245
247 Ga0209050_1004524 3300025298 Bacteria 9347
248 Ga0209050_1020992 3300025298 Bacteria 2402
249 Ga0209256_1000001 3300025299 Bacteria 2166974
250 Ga0209256_1000050 3300025299 Bacteria 308622
251 Ga0209256_1000063 3300025299 Bacteria 252716
252 Ga0209256_1018315 3300025299 Bacteria 2282
253 Ga0209256_1047129 3300025299 Bacteria 1062
254 Ga0207426_1000001 3300025302 Bacteria 1341301
255 Ga0207426_1000025 3300025302 Bacteria 532921
256 Ga0207426_1000028 3300025302 Bacteria 483955
257 Ga0207426_1003991 3300025302 Bacteria 7494
258 Ga0209051_1000002 3300025303 Bacteria 1631846
259 Ga0209051_1000003 3300025303 Bacteria 1609245
260 Ga0209051_1000605 3300025303 Bacteria 41859
261 Ga0209051_1000907 3300025303 Bacteria 29475
262 Ga0209257_1000002 3300025304 Bacteria 1767052
263 Ga0209257_1000018 3300025304 Bacteria 836016
264 Ga0209257_1001389 3300025304 Bacteria 29010
265 Ga0209257_1005066 3300025304 Bacteria 9567
266 Ga0209257_1012788 3300025304 Bacteria 3822
267 Ga0207697_10047814 3300025315 Bacteria 1764
268 Ga0207655_1010441 3300025728 Bacteria 5629
269 Ga0207688_10038652 3300025901 Bacteria 2649
270 Ga0207680_10003111 3300025903 Bacteria 7794
271 Ga0207705_10105780 3300025909 Bacteria 2075
272 Ga0207705_10219091 3300025909 Bacteria 1445
273 Ga0207695_10092666 3300025913 Bacteria 3031
274 Ga0207695_10129800 3300025913 Bacteria 2479
275 Ga0207671_10326685 3300025914 Bacteria 1214
276 Ga0207671_10447505 3300025914 Bacteria 1029
277 Ga0207660_10159691 3300025917 Bacteria 1738
278 Ga0207657_10067544 3300025919 Bacteria 3040
279 Ga0207649_10025507 3300025920 Bacteria 3446
280 Ga0207652_10024345 3300025921 Bacteria 5022
281 Ga0207681_10181070 3300025923 Bacteria 1605
282 Ga0207681_10326279 3300025923 Bacteria 1222
283 Ga0207659_10000441 3300025926 Bacteria 24897
284 Ga0207659_10514882 3300025926 Bacteria 1014
285 Ga0207644_10027033 3300025931 Bacteria 3961
286 Ga0207706_10015206 3300025933 Bacteria 6964
287 Ga0207706_10308378 3300025933 Bacteria 1378
288 Ga0207709_10001793 3300025935 Bacteria 14391
289 Ga0207669_10012121 3300025937 Bacteria 4227
290 Ga0207704_10046392 3300025938 Bacteria 2589
291 Ga0207691_10008761 3300025940 Bacteria 9705
292 Ga0207691_10183648 3300025940 Bacteria 1826
293 Ga0207691_10583478 3300025940 Bacteria 947
294 Ga0207711_10011063 3300025941 Bacteria 7500
295 Ga0207711_10550764 3300025941 Bacteria 1076
296 Ga0207711_10611669 3300025941 Bacteria 1017
297 Ga0207689_10075271 3300025942 Bacteria 2775
298 Ga0207667_10022142 3300025949 Bacteria 7030
299 Ga0207651_10007601 3300025960 Bacteria 5784
300 Ga0207651_10300763 3300025960 Bacteria 1334
301 Ga0207640_10252310 3300025981 Bacteria 1370
302 Ga0207658_10058363 3300025986 Bacteria 2871
303 Ga0207658_10060708 3300025986 Bacteria 2822
304 Ga0207658_10482366 3300025986 Bacteria 1102
305 Ga0207677_10000679 3300026023 Bacteria 20130
306 Ga0207703_10001030 3300026035 Bacteria 26749
307 Ga0207639_10089228 3300026041 Bacteria 2463
308 Ga0207639_10168591 3300026041 Bacteria 1852
309 Ga0207708_10154737 3300026075 Bacteria 1808
310 Ga0207702_10636665 3300026078 Bacteria 1048
311 Ga0207648_10025011 3300026089 Bacteria 5322
312 Ga0207648_10053077 3300026089 Bacteria 3544
313 Ga0207676_10000229 3300026095 Bacteria 48726
314 Ga0207674_10856978 3300026116 Bacteria 876
315 Ga0207675_100088642 3300026118 Bacteria 2907
316 Ga0207683_10023200 3300026121 Bacteria 5333
317 Ga0207683_10317661 3300026121 Bacteria 1426
318 Ga0207683_10655236 3300026121 Bacteria 973
319 Ga0207698_10108783 3300026142 Bacteria 2318
320 Ga0207698_10503687 3300026142 Bacteria 1179
321 Ga0209282_1000114 3300027666 Bacteria 51706
322 Ga0209282_1195790 3300027666 Bacteria 935
323 Ga0209813_10068287 3300027866 Bacteria 1150
324 Ga0207428_10569974 3300027907 Bacteria 818
325 Ga0268266_10431527 3300028379 Bacteria 1250
326 Ga0268265_10637837 3300028380 Bacteria 1022
327 Ga0268264_10035668 3300028381 Bacteria 4095
328 Ga0268264_10770368 3300028381 Bacteria 960
329 Ga0307515_10000137 3300028794 Bacteria 173516
330 Ga0316177_1002400 3300030731 Bacteria 7047
331 Ga0316176_1128501 3300030732 Bacteria 5873
332 Ga0314311_1071148 3300030733 Bacteria 5485
333 Ga0316179_1025484 3300030734 Bacteria 1356
334 Ga0316178_1156265 3300030735 Bacteria 4086
335 Ga0316183_1046023 3300030742 Bacteria 4132
336 Ga0316181_1189823 3300030744 Bacteria 1107
337 Ga0316182_1133866 3300030745 Bacteria 1823
338 Ga0316182_1232125 3300030745 Bacteria 1764
339 Ga0265328_10024200 3300031239 Bacteria 2296
340 Ga0307513_10000486 3300031456 Bacteria 57184
341 Ga0307513_10182612 3300031456 Bacteria 1959
342 Ga0307513_10298720 3300031456 Bacteria 1378
343 Ga0307408_100019789 3300031548 Bacteria 4534
344 Ga0307408_100066535 3300031548 Bacteria 2647
345 Ga0307408_100066690 3300031548 Bacteria 2644
346 Ga0307408_100134411 3300031548 Bacteria 1933
347 Ga0307408_100154028 3300031548 Bacteria 1817
348 Ga0265314_10001686 3300031711 Bacteria 24055
349 Ga0307405_10058125 3300031731 Bacteria 2432
350 Ga0307405_10088728 3300031731 Bacteria 2041
351 Ga0307405_10163826 3300031731 Bacteria 1578
352 Ga0307413_10227244 3300031824 Bacteria 1368
353 Ga0307410_10292360 3300031852 Bacteria 1283
354 Ga0307406_10000472 3300031901 Bacteria 23202
355 Ga0307406_10002828 3300031901 Bacteria 9458
356 Ga0307406_10024399 3300031901 Bacteria 3612
357 Ga0307406_10096167 3300031901 Bacteria 2006
358 Ga0307406_10300721 3300031901 Bacteria 1233
359 Ga0307406_10401846 3300031901 Bacteria 1086
360 Ga0307407_10613773 3300031903 Bacteria 811
361 Ga0307412_10072304 3300031911 Bacteria 2356
362 Ga0307412_10093677 3300031911 Bacteria 2107
363 Ga0307412_10221209 3300031911 Bacteria 1451
364 Ga0307412_10956972 3300031911 Bacteria 754
365 Ga0307416_100446914 3300032002 Bacteria 1344
366 Ga0307414_10005033 3300032004 Bacteria 7238
367 Ga0307414_10482077 3300032004 Bacteria 1094
368 Ga0307411_10008361 3300032005 Bacteria 5354
369 Ga0307411_10120110 3300032005 Bacteria 1899
370 Ga0307411_10131201 3300032005 Bacteria 1832
371 Ga0307411_10220623 3300032005 Bacteria 1471
372 Ga0373947_0294808 3300035725 Bacteria 1080
373 Ga0373925_0379145 3300037068 Bacteria 1151
374 Ga0395900_0303793 3300037418 Bacteria 1581
375 Ga0395898_0003968 3300037466 Bacteria 16291
376 Ga0395905_0000180 3300037471 Bacteria 100693
377 Ga0395905_0041095 3300037471 Bacteria 4339
378 Ga0395905_0096760 3300037471 Bacteria 2771
379 Ga0395905_0512419 3300037471 Bacteria 1100
380 Ga0395901_0068022 3300038443 Bacteria 3710
381 Ga0395901_0170687 3300038443 Bacteria 2282
382 Ga0395901_0317819 3300038443 Bacteria 1611
383 Ga0395901_0331416 3300038443 Bacteria 1573
384 Ga0395901_0416513 3300038443 Bacteria 1378
385 Ga0439447_002984 3300041407 Bacteria 6064
386 Ga0439447_052926 3300041407 Bacteria 966
387 Ga0439461_0005148 3300041410 Bacteria 2217
388 Ga0439466_0110151 3300041411 Bacteria 854
389 Ga0439465_0000212 3300041413 Bacteria 15491
390 Ga0451791_0997051 3300041451 Bacteria 866
391 Ga0451795_1633835 3300041456 Bacteria 854
392 Ga0451807_1640364 3300041486 Bacteria 1144
393 Ga0451841_0576698 3300041498 Bacteria 1186
394 Ga0439431_0003405 3300041997 Bacteria 3499
395 Ga0439433_0031582 3300041999 Bacteria 1212
396 Ga0439442_020440 3300042002 Bacteria 1372
397 Ga0439445_0000327 3300042004 Bacteria 9270
398 Ga0439432_002375 3300042006 Bacteria 7102
399 Ga0439432_017821 3300042006 Bacteria 2380
400 Ga0439449_0000783 3300042007 Bacteria 12258
401 Ga0439449_0006225 3300042007 Bacteria 4560
402 Ga0439449_0020305 3300042007 Bacteria 2489
403 Ga0439449_0021978 3300042007 Bacteria 2388
404 Ga0439452_000907 3300042010 Bacteria 13521
405 Ga0439457_027286 3300042014 Bacteria 1264
406 Ga0439462_0004131 3300042015 Bacteria 3527
407 Ga0439462_0004645 3300042015 Bacteria 3358
408 Ga0439462_0035230 3300042015 Bacteria 1330
409 Ga0439462_0056577 3300042015 Bacteria 1058
410 Ga0450911_000717 3300042115 Bacteria 9642
411 Ga0450911_020113 3300042115 Bacteria 872
412 Ga0450920_018960 3300042122 Bacteria 1319
413 Ga0450922_010541 3300042124 Bacteria 885
414 Ga0450890_009450 3300042127 Bacteria 1249
415 Ga0450892_004977 3300042130 Bacteria 1089
416 Ga0450902_013414 3300042137 Bacteria 1320
417 Ga0439446_0001380 3300042156 Bacteria 5493
418 Ga0439446_0019189 3300042156 Bacteria 1921
419 Ga0439458_0059096 3300042157 Bacteria 955
420 Ga0450908_000844 3300042184 Bacteria 5918
421 Ga0450908_020403 3300042184 Bacteria 1165
422 Ga0450909_023898 3300042185 Bacteria 917
423 Ga0439434_0015767 3300042435 Bacteria 2253
424 Ga0439434_0064781 3300042435 Bacteria 1146
425 Ga0439464_0005973 3300042439 Bacteria 3165
426 Ga0450918_000516 3300042531 Bacteria 8276
427 Ga0466969_0267796 3300044656 Bacteria 774
428 Ga0453683_0091795 3300044673 Bacteria 1903
429 Ga0466965_0006533 3300044683 Bacteria 5305
430 Ga0466964_0164530 3300044706 Bacteria 1040
431 Ga0466968_0059784 3300044735 Bacteria 1642
432 Ga0466960_0020091 3300044901 Bacteria 2954
433 Ga0451576_0016029 3300045051 Bacteria 8281
434 Ga0451576_0869427 3300045051 Bacteria 946
435 Ga0495617_004194 3300046452 Bacteria 5273
436 Ga0495617_004883 3300046452 Bacteria 4822
437 Ga0495627_019311 3300046453 Bacteria 2287
438 Ga0495638_0005556 3300046460 Bacteria 9331
439 Ga0495638_0029313 3300046460 Bacteria 3549
440 Ga0495605_0004293 3300046474 Bacteria 8397
441 Ga0495605_0137683 3300046474 Bacteria 1097
442 Ga0495639_0001341 3300046475 Bacteria 11053
443 Ga0495584_0000188 3300046491 Bacteria 43748
444 Ga0495584_0150973 3300046491 Bacteria 1180
445 Ga0495585_0000706 3300046492 Bacteria 30076
446 Ga0495585_0013217 3300046492 Bacteria 4836
447 Ga0495585_0035741 3300046492 Bacteria 2805
448 Ga0495585_0050216 3300046492 Bacteria 2314
449 Ga0495596_0002907 3300046500 Bacteria 8911
450 Ga0495607_0010863 3300046501 Bacteria 6091
451 Ga0495607_0135416 3300046501 Bacteria 1276
452 Ga0495607_0163148 3300046501 Bacteria 1130
453 Ga0495583_0000045 3300046506 Bacteria 220503
454 Ga0495583_0050365 3300046506 Bacteria 1903
455 Ga0495583_0105488 3300046506 Bacteria 1199
456 Ga0495606_0054341 3300046507 Bacteria 2594
457 Ga0495610_0082494 3300046512 Bacteria 1473
458 Ga0495616_0005680 3300046513 Bacteria 7641
459 Ga0495616_0010519 3300046513 Bacteria 5353
460 Ga0495620_0006857 3300046515 Bacteria 6226
461 Ga0495631_0002176 3300046518 Bacteria 11313
462 Ga0495637_0010829 3300046520 Bacteria 4395
463 Ga0495637_0071933 3300046520 Bacteria 1393
464 Ga0495648_0000245 3300046524 Bacteria 61457
465 Ga0495642_0003248 3300046528 Bacteria 6437
466 Ga0495642_0042566 3300046528 Bacteria 1850
467 Ga0495609_0000399 3300046538 Bacteria 36495
468 Ga0495609_0015670 3300046538 Bacteria 3545
469 Ga0495621_0035562 3300046539 Bacteria 1726
470 Ga0495621_0056812 3300046539 Bacteria 1412
471 Ga0495597_0000208 3300046542 Bacteria 53439
472 Ga0495633_0001063 3300046558 Bacteria 22254
473 Ga0495633_0002952 3300046558 Bacteria 11627
474 Ga0495656_0000209 3300046615 Bacteria 20972
475 Ga0495656_0012974 3300046615 Bacteria 3089
476 Ga0495656_0013615 3300046615 Bacteria 3030
477 Ga0495656_0103792 3300046615 Bacteria 1318
478 Ga0495611_0001297 3300046648 Bacteria 12750
479 Ga0495625_0000044 3300046660 Bacteria 203855
480 Ga0495625_0033017 3300046660 Bacteria 3831
481 Ga0495625_0136747 3300046660 Bacteria 1656
482 Ga0495659_0000067 3300046664 Bacteria 46337
483 Ga0495661_0200629 3300046665 Bacteria 1045
484 Ga0495588_0030838 3300046674 Bacteria 2696
485 Ga0495588_0033417 3300046674 Bacteria 2597
486 Ga0495588_0039594 3300046674 Bacteria 2402
487 Ga0495599_0131909 3300046678 Bacteria 1552
488 Ga0495658_0136211 3300046683 Bacteria 1498
489 Ga0495658_0208966 3300046683 Bacteria 1219
490 Ga0495670_0000570 3300046691 Bacteria 17593
491 Ga0495670_0053925 3300046691 Bacteria 2014
492 Ga0495671_0013095 3300046692 Bacteria 4506
493 Ga0495671_0035800 3300046692 Bacteria 2519
494 Ga0495636_0000103 3300047318 Bacteria 36323
495 Ga0495636_0085712 3300047318 Bacteria 1362
496 Ga0495672_0001528 3300047320 Bacteria 22660
497 Ga0495676_0026230 3300047321 Bacteria 5018
498 Ga0495683_0000009 3300047323 Bacteria 241385
499 Ga0495683_0007436 3300047323 Bacteria 5921
500 Ga0495687_000156 3300047443 Bacteria 103711
501 Ga0495677_0007890 3300047445 Bacteria 3960
502 Ga0495685_000022 3300047447 Bacteria 71800
503 Ga0495673_0008233 3300047469 Bacteria 5886
504 Ga0495681_0002250 3300047470 Bacteria 13882
505 Ga0495681_0056166 3300047470 Bacteria 1833
506 Ga0495681_0064453 3300047470 Bacteria 1678
507 Ga0495593_0017861 3300047673 Bacteria 3994
508 Ga0495614_0053657 3300048089 Bacteria 1728
509 Ga0495615_0028986 3300048090 Bacteria 1310
510 Ga0496100_0011371 3300048903 Bacteria 5065
511 Ga0496101_0000958 3300048904 Bacteria 17056
512 Ga0496101_0094303 3300048904 Bacteria 2230
513 Ga0496102_0000310 3300048905 Bacteria 61386
514 Ga0496102_0037849 3300048905 Bacteria 4352
515 Ga0496102_0039527 3300048905 Bacteria 4263
516 Ga0496103_0028934 3300048906 Bacteria 3366
517 Ga0496103_0146266 3300048906 Bacteria 1513
518 Ga0496104_0000688 3300048907 Bacteria 29108
519 Ga0496104_0065997 3300048907 Bacteria 3436
520 Ga0496105_0005944 3300048908 Bacteria 9312
521 Ga0496105_0042329 3300048908 Bacteria 3754
522 Ga0496106_0069570 3300048909 Bacteria 2687
523 Ga0496106_0781967 3300048909 Bacteria 758
524 Ga0496107_0041302 3300048910 Bacteria 3312
525 Ga0496108_0011290 3300048911 Bacteria 7257
526 Ga0496108_0176174 3300048911 Bacteria 1851
527 Ga0496108_0835022 3300048911 Bacteria 793
528 Ga0496109_0040775 3300048912 Bacteria 4206
529 Ga0496109_0405182 3300048912 Bacteria 1288
530 Ga0496110_0031792 3300048913 Bacteria 4556
531 Ga0496110_0097168 3300048913 Bacteria 2639
532 Ga0496110_0255264 3300048913 Bacteria 1596
533 Ga0496111_0029141 3300048914 Bacteria 3919
534 Ga0496114_0021656 3300048917 Bacteria 5231
535 Ga0496114_0393502 3300048917 Bacteria 1227
536 Ga0496116_0021136 3300048919 Bacteria 4916
537 Ga0496116_0181930 3300048919 Bacteria 1124
538 Ga0496117_0018952 3300048920 Bacteria 5673
539 Ga0496117_0063890 3300048920 Bacteria 2513
540 Ga0496118_0049833 3300048921 Bacteria 3220
541 Ga0496118_0069356 3300048921 Bacteria 2554
542 Ga0496121_0014501 3300048924 Bacteria 8356
543 Ga0496121_0015016 3300048924 Bacteria 8153
544 Ga0496121_0045777 3300048924 Bacteria 3756
545 Ga0496121_0176074 3300048924 Bacteria 1548
546 Ga0496122_0000274 3300048925 Bacteria 115100
547 Ga0496122_0062978 3300048925 Bacteria 2711
548 Ga0496123_0003708 3300048926 Bacteria 16801
549 Ga0496123_0052989 3300048926 Bacteria 2686
550 Ga0496124_0024673 3300048927 Bacteria 5461
551 Ga0496124_0101737 3300048927 Bacteria 2327
552 Ga0496124_0154867 3300048927 Bacteria 1793
553 Ga0496124_0384568 3300048927 Bacteria 980
554 Ga0496125_0001879 3300048928 Bacteria 28856
555 Ga0496125_0012614 3300048928 Bacteria 8371
556 Ga0496125_0014401 3300048928 Bacteria 7704
557 Ga0496125_0200416 3300048928 Bacteria 1307
558 Ga0496125_0220837 3300048928 Bacteria 1221
559 Ga0496125_0295147 3300048928 Bacteria 996
560 Ga0496126_0088475 3300048929 Bacteria 2728
561 Ga0496126_0289803 3300048929 Bacteria 1354
562 Ga0501306_013307 3300049127 Bacteria 1071
563 Ga0501306_016403 3300049127 Bacteria 995
564 Ga0501306_036214 3300049127 Bacteria 751
565 Ga0501306_043197 3300049127 Bacteria 704
566 Ga0501308_032375 3300049128 Bacteria 707
567 Ga0501309_012791 3300049129 Bacteria 1109
568 Ga0501310_013154 3300049130 Bacteria 957
569 Ga0501310_021065 3300049130 Bacteria 814
570 Ga0501310_022665 3300049130 Bacteria 794
571 Ga0501310_024663 3300049130 Bacteria 771
572 Ga0501310_036004 3300049130 Bacteria 674
573 Ga0501304_006233 3300049160 Bacteria 957
574 Ga0501304_012655 3300049160 Bacteria 764
575 Ga0501304_016078 3300049160 Bacteria 706
576 Ga0501305_012094 3300049161 Bacteria 1176
577 Ga0501305_025121 3300049161 Bacteria 901
578 Ga0501305_029455 3300049161 Bacteria 849
579 Ga0501305_051535 3300049161 Bacteria 692
580 Ga0501307_022892 3300049162 Bacteria 824
581 Ga0501307_023368 3300049162 Bacteria 818
582 Ga0495678_003755 3300049459 Bacteria 9170
583 Ga0495682_0000461 3300049460 Bacteria 28071
584 Ga0495682_0001710 3300049460 Bacteria 11145
585 Ga0495682_0088374 3300049460 Bacteria 1113
586 Ga0501313_011798 3300049529 Bacteria 1011
587 Ga0501313_027574 3300049529 Bacteria 726
588 Ga0501313_030193 3300049529 Bacteria 700
589 Ga0501314_010850 3300049530 Bacteria 853
590 Ga0501314_016856 3300049530 Bacteria 732
591 Ga0501314_018371 3300049530 Bacteria 711
592 Ga0501315_008623 3300049531 Bacteria 1189
593 Ga0501315_018826 3300049531 Bacteria 914
594 Ga0501315_022229 3300049531 Bacteria 864
595 Ga0501315_031759 3300049531 Bacteria 764
596 Ga0501315_041806 3300049531 Bacteria 696
597 Ga0501316_032066 3300049532 Bacteria 707
598 Ga0501320_013582 3300049536 Bacteria 871
599 Ga0501321_031163 3300049537 Bacteria 713
600 Ga0501322_007675 3300049538 Bacteria 790
601 Ga0501323_008662 3300049539 Bacteria 1185
602 Ga0501323_031098 3300049539 Bacteria 750
603 Ga0501043_0186685 3300049579 Bacteria 1614
604 Ga0501223_027932 3300049663 Bacteria 1098
605 Ga0501249_002689 3300049679 Bacteria 3583
606 Ga0501241_014340 3300049758 Bacteria 1439
607 Ga0501262_000210 3300049759 Bacteria 7283
608 Ga0501044_0785202 3300049823 Bacteria 832
609 Ga0501226_011670 3300049853 Bacteria 973
610 nmdc:mga03683_145917_c1 3300050489 Bacteria 1066
611 nmdc:mga03683_305289_c1 3300050489 Bacteria 747
612 nmdc:mga0k408_116930_c1 3300050493 Bacteria 1578
613 nmdc:mga0k408_12049_c1 3300050493 Bacteria 4721
614 nmdc:mga0k408_50825_c1 3300050493 Bacteria 2400
615 nmdc:mga06z11_11842_c1 3300050494 Bacteria 3773
616 nmdc:mga06z11_95696_c1 3300050494 Bacteria 1620
617 nmdc:mga07m45_115372_c1 3300050496 Bacteria 1549
618 nmdc:mga07m45_12425_c1 3300050496 Bacteria 4501
619 nmdc:mga07m45_167312_c1 3300050496 Bacteria 1277
620 nmdc:mga07m45_22727_c1 3300050496 Bacteria 3426
621 nmdc:mga07m45_34539_c1 3300050496 Bacteria 2811
622 nmdc:mga07m45_386_c1 3300050496 Bacteria 18107
623 nmdc:mga07m45_460279_c1 3300050496 Bacteria 737
624 nmdc:mga07m45_6174_c1 3300050496 Bacteria 6042
625 nmdc:mga09592_135046_c1 3300050508 Bacteria 2124
626 Ga0500643_013156 3300053087 Bacteria 2934
627 Ga0500644_0016808 3300053088 Bacteria 2111
628 Ga0500651_0000063 3300053093 Bacteria 70772
629 Ga0500566_0095922 3300053094 Bacteria 1633
630 Ga0500641_0095174 3300053096 Bacteria 1274
631 Ga0500562_002124 3300053108 Bacteria 4955
632 Ga0500571_006776 3300053110 Bacteria 6206
633 Ga0500593_000829 3300053117 Bacteria 11563
634 Ga0500594_0002456 3300053118 Bacteria 4033
635 Ga0500597_039379 3300053120 Bacteria 1981
636 Ga0500607_001609 3300053121 Bacteria 19935
637 Ga0500607_048234 3300053121 Bacteria 2278
638 Ga0500608_052273 3300053122 Bacteria 1962
639 Ga0500655_003141 3300053133 Bacteria 2994
640 Ga0500658_0000481 3300053134 Bacteria 17081
641 Ga0500658_0000709 3300053134 Bacteria 13770
642 Ga0500559_0003620 3300053136 Bacteria 7556
643 Ga0500568_0003586 3300053139 Bacteria 8572
644 Ga0500616_0241801 3300053153 Bacteria 775
645 Ga0500624_041586 3300053157 Bacteria 828
646 Ga0500627_0003521 3300053158 Bacteria 4856
647 Ga0500633_0159070 3300053160 Bacteria 847
648 Ga0500634_0008688 3300053161 Bacteria 5091
649 Ga0500634_0018086 3300053161 Bacteria 3782
650 Ga0500638_043069 3300053162 Bacteria 2192
651 Ga0500625_028720 3300053729 Bacteria 2640
652 Ga0500645_000059 3300053730 Bacteria 91141
653 Ga0500645_002200 3300053730 Bacteria 8917
654 Ga0590075_013138 3300059424 Bacteria 2014
655 Ga0587084_024870 3300059477 Bacteria 925
656 Ga0587084_053397 3300059477 Bacteria 721
657 Ga0587111_0105279 3300060346 Bacteria 708

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046474 Ga0495605_0137683 Ga0495605_0137683_11_658 198
2 3300005539 Ga0068853_100302366 Ga0068853_1003023662 206
3 3300026116 Ga0207674_10856978 Ga0207674_108569781 206
4 3300005445 Ga0070708_100703966 Ga0070708_1007039662 207
5 3300005471 Ga0070698_100755748 Ga0070698_1007557481 207
6 3300006058 Ga0075432_10085254 Ga0075432_100852542 207
7 3300013306 Ga0163162_10280428 Ga0163162_102804282 207
8 3300026121 Ga0207683_10655236 Ga0207683_106552361 207
9 3300046520 Ga0495637_0010829 Ga0495637_0010829_1520_2143 207
10 3300046528 Ga0495642_0003248 Ga0495642_0003248_1900_2523 207
11 3300047470 Ga0495681_0002250 Ga0495681_0002250_1548_2171 207
12 3300031456 Ga0307513_10182612 Ga0307513_101826122 208
13 3300005459 Ga0068867_100072252 Ga0068867_1000722523 210
14 3300006237 Ga0097621_100504052 Ga0097621_1005040521 210
15 3300025294 Ga0209025_1012900 Ga0209025_10129006 210
16 3300049130 Ga0501310_022665 Ga0501310_022665_26_661 210
17 3300049161 Ga0501305_025121 Ga0501305_025121_241_876 210
18 3300049162 Ga0501307_022892 Ga0501307_022892_19_654 210
19 3300049529 Ga0501313_027574 Ga0501313_027574_26_661 210
20 3300049531 Ga0501315_008623 Ga0501315_008623_529_1164 210
21 3300049536 Ga0501320_013582 Ga0501320_013582_26_661 210
22 iso_pu_bacteria 2547132374 2548498779 210
23 iso_pu_bacteria 2643221570 2643866675 210
24 iso_pu_bacteria 2643221596 2643991348 210
25 iso_pu_bacteria 2643221652 2644296273 210
26 iso_pu_bacteria 2643221717 2644647779 210
27 iso_pu_bacteria 2894023352 2894025216 210
28 iso_pu_bacteria 2990710928 2990712138 210
29 3300042007 Ga0439449_0020305 Ga0439449_0020305_1311_1952 211
30 3300042014 Ga0439457_027286 Ga0439457_027286_424_1065 211
31 3300042015 Ga0439462_0004131 Ga0439462_0004131_1141_1782 211
32 3300042185 Ga0450909_023898 Ga0450909_023898_108_749 211
33 iso_pu_bacteria 2513020051 2513227125 211
34 iso_pu_bacteria 2599185214 2599623652 211
35 iso_pu_bacteria 2599185226 2599671729 211
36 iso_pu_bacteria 2599185227 2599681258 211
37 iso_pu_bacteria 2599185229 2599693339 211
38 iso_pu_bacteria 2643221628 2644163223 211
39 iso_pu_bacteria 2643221658 2644327613 211
40 iso_pu_bacteria 2643221672 2644401483 211
41 iso_pu_bacteria 2643221683 2644468158 211
42 iso_pu_bacteria 2738541277 2738717722 211
43 iso_pu_bacteria 2738543019 2739278408 211
44 iso_pu_bacteria 2739367655 2739612388 211
45 iso_pu_bacteria 2831265667 2831266331 211
46 iso_pu_bacteria 2838054893 2838057557 211
47 iso_pu_bacteria 2842677519 2842679668 211
48 iso_pu_bacteria 2842733646 2842735038 211
49 iso_pu_bacteria 2881927736 2881930791 211
50 iso_pu_bacteria 2885198086 2885204454 211
51 iso_pu_bacteria 2885211737 2885218107 211
52 iso_pu_bacteria 2887375801 2887378458 211
53 iso_pu_bacteria 2904449895 2904455771 211
54 iso_pu_bacteria 2904456579 2904457798 211
55 iso_pu_bacteria 2904541872 2904548162 211
56 iso_pu_bacteria 2919462493 2919467241 211
57 iso_pu_bacteria 2928070936 2928071729 211
58 iso_pu_bacteria 2928084124 2928084326 211
59 iso_pu_bacteria 2929160207 2929163091 211
60 iso_pu_bacteria 2929520902 2929522754 211
61 iso_pu_bacteria 2945945610 2945947700 211
62 iso_pu_bacteria 2954767861 2954772460 211
63 3300049127 Ga0501306_043197 Ga0501306_043197_31_672 212
64 3300049537 Ga0501321_031163 Ga0501321_031163_48_689 212
65 3300031731 Ga0307405_10088728 Ga0307405_100887282 213
66 3300031901 Ga0307406_10401846 Ga0307406_104018462 213
67 3300042115 Ga0450911_000717 Ga0450911_000717_4450_5094 213
68 3300042137 Ga0450902_013414 Ga0450902_013414_82_726 213
69 3300048924 Ga0496121_0015016 Ga0496121_0015016_3493_4137 213
70 3300048928 Ga0496125_0001879 Ga0496125_0001879_25615_26259 213
71 3300048928 Ga0496125_0200416 Ga0496125_0200416_235_879 213
72 3300048929 Ga0496126_0289803 Ga0496126_0289803_221_865 213
73 3300049539 Ga0501323_008662 Ga0501323_008662_26_733 213
74 3300059424 Ga0590075_013138 Ga0590075_013138_547_1191 213
75 3300003577 Ga0007416J51690_1059848 Ga0007416J51690_10598481 214
76 3300005288 Ga0065714_10105205 Ga0065714_101052051 214
77 3300005293 Ga0065715_10007212 Ga0065715_100072124 214
78 3300025901 Ga0207688_10038652 Ga0207688_100386523 214
79 3300031456 Ga0307513_10298720 Ga0307513_102987202 214
80 3300031548 Ga0307408_100066535 Ga0307408_1000665351 214
81 3300031901 Ga0307406_10002828 Ga0307406_100028283 214
82 3300041456 Ga0451795_1633835 Ga0451795_1633835_33_680 214
83 3300046452 Ga0495617_004194 Ga0495617_004194_3818_4465 214
84 3300046452 Ga0495617_004883 Ga0495617_004883_3127_3774 214
85 3300046460 Ga0495638_0005556 Ga0495638_0005556_1824_2471 214
86 3300046474 Ga0495605_0004293 Ga0495605_0004293_5797_6444 214
87 3300046491 Ga0495584_0000188 Ga0495584_0000188_23036_23683 214
88 3300046491 Ga0495584_0150973 Ga0495584_0150973_256_903 214
89 3300046492 Ga0495585_0000706 Ga0495585_0000706_16508_17155 214
90 3300046492 Ga0495585_0013217 Ga0495585_0013217_3484_4131 214
91 3300046492 Ga0495585_0035741 Ga0495585_0035741_127_774 214
92 3300046492 Ga0495585_0050216 Ga0495585_0050216_1217_1864 214
93 3300046500 Ga0495596_0002907 Ga0495596_0002907_7276_7923 214
94 3300046501 Ga0495607_0010863 Ga0495607_0010863_3098_3745 214
95 3300046501 Ga0495607_0135416 Ga0495607_0135416_550_1197 214
96 3300046501 Ga0495607_0163148 Ga0495607_0163148_131_778 214
97 3300046506 Ga0495583_0000045 Ga0495583_0000045_76301_76948 214
98 3300046506 Ga0495583_0050365 Ga0495583_0050365_1120_1767 214
99 3300046507 Ga0495606_0054341 Ga0495606_0054341_952_1599 214
100 3300046513 Ga0495616_0010519 Ga0495616_0010519_4170_4817 214
101 3300046515 Ga0495620_0006857 Ga0495620_0006857_189_836 214
102 3300046524 Ga0495648_0000245 Ga0495648_0000245_8676_9323 214
103 3300046528 Ga0495642_0042566 Ga0495642_0042566_670_1317 214
104 3300046538 Ga0495609_0000399 Ga0495609_0000399_27491_28138 214
105 3300046538 Ga0495609_0015670 Ga0495609_0015670_1348_1995 214
106 3300046542 Ga0495597_0000208 Ga0495597_0000208_9231_9878 214
107 3300046558 Ga0495633_0001063 Ga0495633_0001063_18225_18872 214
108 3300046558 Ga0495633_0002952 Ga0495633_0002952_7432_8079 214
109 3300046615 Ga0495656_0013615 Ga0495656_0013615_2223_2870 214
110 3300046615 Ga0495656_0103792 Ga0495656_0103792_16_663 214
111 3300046648 Ga0495611_0001297 Ga0495611_0001297_1374_2021 214
112 3300046664 Ga0495659_0000067 Ga0495659_0000067_41330_41977 214
113 3300046665 Ga0495661_0200629 Ga0495661_0200629_37_684 214
114 3300046691 Ga0495670_0000570 Ga0495670_0000570_2523_3170 214
115 3300046692 Ga0495671_0035800 Ga0495671_0035800_1210_1857 214
116 3300047318 Ga0495636_0000103 Ga0495636_0000103_5194_5841 214
117 3300047318 Ga0495636_0085712 Ga0495636_0085712_226_873 214
118 3300047320 Ga0495672_0001528 Ga0495672_0001528_7556_8203 214
119 3300047323 Ga0495683_0000009 Ga0495683_0000009_89148_89795 214
120 3300047323 Ga0495683_0007436 Ga0495683_0007436_4662_5309 214
121 3300047443 Ga0495687_000156 Ga0495687_000156_55160_55807 214
122 3300047445 Ga0495677_0007890 Ga0495677_0007890_1657_2304 214
123 3300047447 Ga0495685_000022 Ga0495685_000022_52748_53395 214
124 3300047469 Ga0495673_0008233 Ga0495673_0008233_1567_2214 214
125 3300047470 Ga0495681_0056166 Ga0495681_0056166_475_1122 214
126 3300047470 Ga0495681_0064453 Ga0495681_0064453_628_1275 214
127 3300048090 Ga0495615_0028986 Ga0495615_0028986_631_1278 214
128 3300048905 Ga0496102_0039527 Ga0496102_0039527_1867_2514 214
129 3300048906 Ga0496103_0146266 Ga0496103_0146266_223_870 214
130 3300048909 Ga0496106_0781967 Ga0496106_0781967_77_724 214
131 3300048925 Ga0496122_0000274 Ga0496122_0000274_14841_15485 214
132 3300048926 Ga0496123_0003708 Ga0496123_0003708_9905_10549 214
133 3300048927 Ga0496124_0154867 Ga0496124_0154867_680_1324 214
134 3300049459 Ga0495678_003755 Ga0495678_003755_1828_2475 214
135 3300049460 Ga0495682_0000461 Ga0495682_0000461_19061_19708 214
136 3300049460 Ga0495682_0001710 Ga0495682_0001710_2920_3567 214
137 3300049460 Ga0495682_0088374 Ga0495682_0088374_454_1101 214
138 3300049529 Ga0501313_011798 Ga0501313_011798_10_657 214
139 3300053088 Ga0500644_0016808 Ga0500644_0016808_560_1210 214
140 3300003187 JGI25151J46595_10001260 JGI25151J46595_100012605 215
141 3300003187 JGI25151J46595_10007367 JGI25151J46595_100073676 215
142 3300003305 Ga0006770J48903_1041039 Ga0006770J48903_10410391 215
143 3300003308 Ga0006777J48905_1077401 Ga0006777J48905_10774011 215
144 3300003577 Ga0007416J51690_1036082 Ga0007416J51690_10360821 215
145 3300003577 Ga0007416J51690_1045190 Ga0007416J51690_10451901 215
146 3300003579 Ga0007429J51699_1020602 Ga0007429J51699_10206021 215
147 3300003761 Ga0055535_1000330 Ga0055535_100033030 215
148 3300003762 Ga0055542_1000039 Ga0055542_100003966 215
149 3300003773 Ga0055537_1000285 Ga0055537_100028527 215
150 3300003773 Ga0055537_1000373 Ga0055537_10003738 215
151 3300003773 Ga0055537_1011479 Ga0055537_10114792 215
152 3300003781 Ga0055536_1001531 Ga0055536_10015313 215
153 3300003781 Ga0055536_1004149 Ga0055536_10041496 215
154 3300003784 Ga0055534_1000018 Ga0055534_1000018103 215
155 3300003790 Ga0055528_1000401 Ga0055528_100040113 215
156 3300003790 Ga0055528_1024650 Ga0055528_10246502 215
157 3300003790 Ga0055528_1025740 Ga0055528_10257402 215
158 3300003791 Ga0055530_10015125 Ga0055530_100151253 215
159 3300003792 Ga0055540_1000788 Ga0055540_100078823 215
160 3300003792 Ga0055540_1001180 Ga0055540_100118013 215
161 3300003792 Ga0055540_1008068 Ga0055540_10080683 215
162 3300004625 Ga0055543_1004921 Ga0055543_10049214 215
163 3300005288 Ga0065714_10015276 Ga0065714_100152763 215
164 3300005289 Ga0065704_10074000 Ga0065704_100740004 215
165 3300005293 Ga0065715_10114105 Ga0065715_101141052 215
166 3300005327 Ga0070658_10084151 Ga0070658_100841512 215
167 3300005327 Ga0070658_10182318 Ga0070658_101823182 215
168 3300005327 Ga0070658_10277299 Ga0070658_102772992 215
169 3300005328 Ga0070676_10024726 Ga0070676_100247266 215
170 3300005330 Ga0070690_100003807 Ga0070690_1000038074 215
171 3300005334 Ga0068869_100045046 Ga0068869_1000450461 215
172 3300005335 Ga0070666_10006291 Ga0070666_100062916 215
173 3300005335 Ga0070666_10093364 Ga0070666_100933642 215
174 3300005336 Ga0070680_100341375 Ga0070680_1003413752 215
175 3300005338 Ga0068868_100017362 Ga0068868_1000173623 215
176 3300005339 Ga0070660_100090762 Ga0070660_1000907622 215
177 3300005347 Ga0070668_100133658 Ga0070668_1001336582 215
178 3300005347 Ga0070668_100276798 Ga0070668_1002767981 215
179 3300005353 Ga0070669_100019979 Ga0070669_1000199793 215
180 3300005353 Ga0070669_100836294 Ga0070669_1008362941 215
181 3300005354 Ga0070675_100001058 Ga0070675_1000010583 215
182 3300005354 Ga0070675_100184884 Ga0070675_1001848842 215
183 3300005355 Ga0070671_100020705 Ga0070671_1000207053 215
184 3300005355 Ga0070671_100356188 Ga0070671_1003561881 215
185 3300005356 Ga0070674_100311307 Ga0070674_1003113072 215
186 3300005364 Ga0070673_100029058 Ga0070673_1000290583 215
187 3300005365 Ga0070688_100025823 Ga0070688_1000258232 215
188 3300005366 Ga0070659_100863503 Ga0070659_1008635031 215
189 3300005367 Ga0070667_100048932 Ga0070667_1000489322 215
190 3300005455 Ga0070663_100233939 Ga0070663_1002339391 215
191 3300005456 Ga0070678_100012066 Ga0070678_1000120664 215
192 3300005456 Ga0070678_100170557 Ga0070678_1001705572 215
193 3300005457 Ga0070662_100004214 Ga0070662_1000042148 215
194 3300005457 Ga0070662_100247499 Ga0070662_1002474992 215
195 3300005457 Ga0070662_100723715 Ga0070662_1007237151 215
196 3300005459 Ga0068867_100055819 Ga0068867_1000558193 215
197 3300005530 Ga0070679_100103958 Ga0070679_1001039582 215
198 3300005530 Ga0070679_100113030 Ga0070679_1001130302 215
199 3300005539 Ga0068853_100051727 Ga0068853_1000517272 215
200 3300005539 Ga0068853_100365169 Ga0068853_1003651692 215
201 3300005543 Ga0070672_100124366 Ga0070672_1001243662 215
202 3300005543 Ga0070672_100258777 Ga0070672_1002587772 215
203 3300005548 Ga0070665_100187817 Ga0070665_1001878172 215
204 3300005548 Ga0070665_100610418 Ga0070665_1006104182 215
205 3300005563 Ga0068855_100016751 Ga0068855_1000167517 215
206 3300005563 Ga0068855_100281364 Ga0068855_1002813641 215
207 3300005564 Ga0070664_100041366 Ga0070664_1000413663 215
208 3300005614 Ga0068856_100337264 Ga0068856_1003372642 215
209 3300005616 Ga0068852_100520334 Ga0068852_1005203342 215
210 3300005617 Ga0068859_100022769 Ga0068859_1000227693 215
211 3300005618 Ga0068864_100000212 Ga0068864_1000002127 215
212 3300005718 Ga0068866_10024083 Ga0068866_100240832 215
213 3300005719 Ga0068861_100284798 Ga0068861_1002847982 215
214 3300005841 Ga0068863_100001367 Ga0068863_1000013671 215
215 3300005841 Ga0068863_100775827 Ga0068863_1007758272 215
216 3300005842 Ga0068858_100002207 Ga0068858_10000220722 215
217 3300005843 Ga0068860_100059901 Ga0068860_1000599012 215
218 3300005844 Ga0068862_100220132 Ga0068862_1002201322 215
219 3300005844 Ga0068862_100295282 Ga0068862_1002952822 215
220 3300006038 Ga0075365_10008170 Ga0075365_100081706 215
221 3300006048 Ga0075363_100019632 Ga0075363_1000196321 215
222 3300006048 Ga0075363_100171268 Ga0075363_1001712682 215
223 3300006051 Ga0075364_10026087 Ga0075364_100260875 215
224 3300006058 Ga0075432_10030376 Ga0075432_100303762 215
225 3300006177 Ga0075362_10031575 Ga0075362_100315752 215
226 3300006177 Ga0075362_10042960 Ga0075362_100429603 215
227 3300006178 Ga0075367_10058598 Ga0075367_100585983 215
228 3300006195 Ga0075366_10009650 Ga0075366_100096507 215
229 3300006195 Ga0075366_10115852 Ga0075366_101158522 215
230 3300006237 Ga0097621_100007144 Ga0097621_1000071443 215
231 3300006237 Ga0097621_100072548 Ga0097621_1000725482 215
232 3300006237 Ga0097621_100073271 Ga0097621_1000732712 215
233 3300006353 Ga0075370_10005901 Ga0075370_100059011 215
234 3300006353 Ga0075370_10009692 Ga0075370_100096925 215
235 3300006353 Ga0075370_10010505 Ga0075370_100105056 215
236 3300006353 Ga0075370_10046297 Ga0075370_100462972 215
237 3300006353 Ga0075370_10342967 Ga0075370_103429671 215
238 3300006358 Ga0068871_100016987 Ga0068871_1000169873 215
239 3300006358 Ga0068871_100308343 Ga0068871_1003083432 215
240 3300006880 Ga0075429_100478710 Ga0075429_1004787101 215
241 3300006881 Ga0068865_100030894 Ga0068865_1000308944 215
242 3300006931 Ga0097620_100022770 Ga0097620_1000227703 215
243 3300006948 Ga0099826_10000116 Ga0099826_1000011624 215
244 3300006948 Ga0099826_10217346 Ga0099826_102173462 215
245 3300009036 Ga0105244_10006285 Ga0105244_100062856 215
246 3300009093 Ga0105240_10134415 Ga0105240_101344152 215
247 3300009148 Ga0105243_10014281 Ga0105243_100142814 215
248 3300009148 Ga0105243_10387527 Ga0105243_103875272 215
249 3300009174 Ga0105241_10275970 Ga0105241_102759702 215
250 3300009176 Ga0105242_10344667 Ga0105242_103446672 215
251 3300009177 Ga0105248_10024395 Ga0105248_100243956 215
252 3300009177 Ga0105248_10891850 Ga0105248_108918501 215
253 3300009545 Ga0105237_10122282 Ga0105237_101222823 215
254 3300009545 Ga0105237_10332011 Ga0105237_103320112 215
255 3300010375 Ga0105239_10206651 Ga0105239_102066512 215
256 3300011119 Ga0105246_10089496 Ga0105246_100894963 215
257 3300011119 Ga0105246_10097776 Ga0105246_100977762 215
258 3300013100 Ga0157373_10079660 Ga0157373_100796602 215
259 3300013105 Ga0157369_10034980 Ga0157369_100349807 215
260 3300013296 Ga0157374_10055118 Ga0157374_100551184 215
261 3300013297 Ga0157378_10168337 Ga0157378_101683372 215
262 3300013306 Ga0163162_10019158 Ga0163162_100191583 215
263 3300013306 Ga0163162_10110726 Ga0163162_101107262 215
264 3300013306 Ga0163162_10700381 Ga0163162_107003812 215
265 3300013308 Ga0157375_10024781 Ga0157375_100247814 215
266 3300013308 Ga0157375_10092116 Ga0157375_100921161 215
267 3300013308 Ga0157375_10415970 Ga0157375_104159702 215
268 3300014325 Ga0163163_10027074 Ga0163163_100270743 215
269 3300014326 Ga0157380_10226896 Ga0157380_102268962 215
270 3300014497 Ga0182008_10000190 Ga0182008_1000019027 215
271 3300014497 Ga0182008_10001821 Ga0182008_100018214 215
272 3300014497 Ga0182008_10101753 Ga0182008_101017532 215
273 3300014968 Ga0157379_10019567 Ga0157379_100195675 215
274 3300014969 Ga0157376_10043764 Ga0157376_100437642 215
275 3300014969 Ga0157376_10054969 Ga0157376_100549693 215
276 3300014969 Ga0157376_10547501 Ga0157376_105475012 215
277 3300015261 Ga0182006_1001217 Ga0182006_100121714 215
278 3300015262 Ga0182007_10001403 Ga0182007_100014038 215
279 3300015262 Ga0182007_10059013 Ga0182007_100590131 215
280 3300017792 Ga0163161_10000092 Ga0163161_1000009270 215
281 3300017792 Ga0163161_10003072 Ga0163161_100030723 215
282 3300017792 Ga0163161_10021484 Ga0163161_100214843 215
283 3300017792 Ga0163161_10038890 Ga0163161_100388902 215
284 3300017792 Ga0163161_10169556 Ga0163161_101695562 215
285 3300020078 Ga0206352_11194471 Ga0206352_111944711 215
286 3300025228 Ga0209672_100647 Ga0209672_1006472 215
287 3300025229 Ga0209147_101107 Ga0209147_1011072 215
288 3300025242 Ga0209258_100099 Ga0209258_100099147 215
289 3300025245 Ga0207425_1000799 Ga0207425_100079912 215
290 3300025254 Ga0209148_1000103 Ga0209148_1000103147 215
291 3300025258 Ga0209129_1000007 Ga0209129_1000007449 215
292 3300025258 Ga0209129_1001701 Ga0209129_10017019 215
293 3300025263 Ga0209565_1000075 Ga0209565_100007553 215
294 3300025263 Ga0209565_1000199 Ga0209565_100019925 215
295 3300025263 Ga0209565_1002461 Ga0209565_10024615 215
296 3300025273 Ga0209673_1000128 Ga0209673_1000128109 215
297 3300025273 Ga0209673_1000289 Ga0209673_100028930 215
298 3300025273 Ga0209673_1001078 Ga0209673_100107825 215
299 3300025273 Ga0209673_1004719 Ga0209673_10047198 215
300 3300025284 Ga0209130_1000321 Ga0209130_10003218 215
301 3300025284 Ga0209130_1001524 Ga0209130_100152413 215
302 3300025291 Ga0209675_1000074 Ga0209675_100007453 215
303 3300025291 Ga0209675_1000114 Ga0209675_10001147 215
304 3300025291 Ga0209675_1037319 Ga0209675_10373192 215
305 3300025292 Ga0209676_1000122 Ga0209676_100012269 215
306 3300025292 Ga0209676_1000301 Ga0209676_100030143 215
307 3300025294 Ga0209025_1000073 Ga0209025_1000073128 215
308 3300025294 Ga0209025_1000491 Ga0209025_100049123 215
309 3300025294 Ga0209025_1008800 Ga0209025_10088005 215
310 3300025294 Ga0209025_1013011 Ga0209025_10130115 215
311 3300025295 Ga0209564_1000360 Ga0209564_100036039 215
312 3300025295 Ga0209564_1000603 Ga0209564_10006038 215
313 3300025297 Ga0209758_1000025 Ga0209758_100002577 215
314 3300025297 Ga0209758_1006146 Ga0209758_10061465 215
315 3300025298 Ga0209050_1020992 Ga0209050_10209923 215
316 3300025299 Ga0209256_1000050 Ga0209256_1000050143 215
317 3300025299 Ga0209256_1000063 Ga0209256_1000063165 215
318 3300025299 Ga0209256_1047129 Ga0209256_10471292 215
319 3300025302 Ga0207426_1000001 Ga0207426_1000001560 215
320 3300025302 Ga0207426_1000028 Ga0207426_1000028383 215
321 3300025303 Ga0209051_1000002 Ga0209051_10000021470 215
322 3300025303 Ga0209051_1000605 Ga0209051_100060514 215
323 3300025303 Ga0209051_1000907 Ga0209051_100090717 215
324 3300025304 Ga0209257_1000002 Ga0209257_10000021611 215
325 3300025304 Ga0209257_1001389 Ga0209257_100138925 215
326 3300025304 Ga0209257_1005066 Ga0209257_10050668 215
327 3300025315 Ga0207697_10047814 Ga0207697_100478142 215
328 3300025728 Ga0207655_1010441 Ga0207655_10104416 215
329 3300025903 Ga0207680_10003111 Ga0207680_100031113 215
330 3300025909 Ga0207705_10105780 Ga0207705_101057802 215
331 3300025909 Ga0207705_10219091 Ga0207705_102190912 215
332 3300025913 Ga0207695_10092666 Ga0207695_100926663 215
333 3300025913 Ga0207695_10129800 Ga0207695_101298002 215
334 3300025914 Ga0207671_10326685 Ga0207671_103266852 215
335 3300025914 Ga0207671_10447505 Ga0207671_104475052 215
336 3300025917 Ga0207660_10159691 Ga0207660_101596912 215
337 3300025919 Ga0207657_10067544 Ga0207657_100675442 215
338 3300025920 Ga0207649_10025507 Ga0207649_100255072 215
339 3300025921 Ga0207652_10024345 Ga0207652_100243452 215
340 3300025923 Ga0207681_10181070 Ga0207681_101810702 215
341 3300025923 Ga0207681_10326279 Ga0207681_103262791 215
342 3300025926 Ga0207659_10000441 Ga0207659_1000044123 215
343 3300025926 Ga0207659_10514882 Ga0207659_105148822 215
344 3300025931 Ga0207644_10027033 Ga0207644_100270333 215
345 3300025933 Ga0207706_10015206 Ga0207706_100152064 215
346 3300025933 Ga0207706_10308378 Ga0207706_103083782 215
347 3300025935 Ga0207709_10001793 Ga0207709_100017937 215
348 3300025937 Ga0207669_10012121 Ga0207669_100121213 215
349 3300025938 Ga0207704_10046392 Ga0207704_100463922 215
350 3300025940 Ga0207691_10008761 Ga0207691_1000876110 215
351 3300025940 Ga0207691_10183648 Ga0207691_101836482 215
352 3300025941 Ga0207711_10011063 Ga0207711_100110636 215
353 3300025941 Ga0207711_10550764 Ga0207711_105507642 215
354 3300025941 Ga0207711_10611669 Ga0207711_106116691 215
355 3300025942 Ga0207689_10075271 Ga0207689_100752712 215
356 3300025949 Ga0207667_10022142 Ga0207667_100221422 215
357 3300025960 Ga0207651_10007601 Ga0207651_100076014 215
358 3300025960 Ga0207651_10300763 Ga0207651_103007632 215
359 3300025981 Ga0207640_10252310 Ga0207640_102523102 215
360 3300025986 Ga0207658_10058363 Ga0207658_100583632 215
361 3300025986 Ga0207658_10482366 Ga0207658_104823662 215
362 3300026023 Ga0207677_10000679 Ga0207677_100006798 215
363 3300026035 Ga0207703_10001030 Ga0207703_100010303 215
364 3300026041 Ga0207639_10089228 Ga0207639_100892283 215
365 3300026075 Ga0207708_10154737 Ga0207708_101547372 215
366 3300026078 Ga0207702_10636665 Ga0207702_106366652 215
367 3300026089 Ga0207648_10025011 Ga0207648_100250114 215
368 3300026089 Ga0207648_10053077 Ga0207648_100530774 215
369 3300026095 Ga0207676_10000229 Ga0207676_1000022929 215
370 3300026118 Ga0207675_100088642 Ga0207675_1000886422 215
371 3300026121 Ga0207683_10023200 Ga0207683_100232004 215
372 3300026142 Ga0207698_10108783 Ga0207698_101087832 215
373 3300027666 Ga0209282_1000114 Ga0209282_100011433 215
374 3300027666 Ga0209282_1195790 Ga0209282_11957902 215
375 3300027866 Ga0209813_10068287 Ga0209813_100682872 215
376 3300028379 Ga0268266_10431527 Ga0268266_104315272 215
377 3300028380 Ga0268265_10637837 Ga0268265_106378372 215
378 3300028381 Ga0268264_10035668 Ga0268264_100356682 215
379 3300028381 Ga0268264_10770368 Ga0268264_107703681 215
380 3300028794 Ga0307515_10000137 Ga0307515_1000013793 215
381 3300030731 Ga0316177_1002400 Ga0316177_10024005 215
382 3300030732 Ga0316176_1128501 Ga0316176_11285013 215
383 3300030733 Ga0314311_1071148 Ga0314311_10711486 215
384 3300030734 Ga0316179_1025484 Ga0316179_10254842 215
385 3300030735 Ga0316178_1156265 Ga0316178_11562652 215
386 3300030742 Ga0316183_1046023 Ga0316183_10460233 215
387 3300030744 Ga0316181_1189823 Ga0316181_11898231 215
388 3300030745 Ga0316182_1133866 Ga0316182_11338662 215
389 3300030745 Ga0316182_1232125 Ga0316182_12321252 215
390 3300031548 Ga0307408_100066690 Ga0307408_1000666903 215
391 3300031548 Ga0307408_100134411 Ga0307408_1001344112 215
392 3300031548 Ga0307408_100154028 Ga0307408_1001540283 215
393 3300031711 Ga0265314_10001686 Ga0265314_1000168614 215
394 3300031731 Ga0307405_10058125 Ga0307405_100581252 215
395 3300031731 Ga0307405_10163826 Ga0307405_101638262 215
396 3300031824 Ga0307413_10227244 Ga0307413_102272441 215
397 3300031852 Ga0307410_10292360 Ga0307410_102923602 215
398 3300031901 Ga0307406_10000472 Ga0307406_1000047210 215
399 3300031901 Ga0307406_10096167 Ga0307406_100961672 215
400 3300031901 Ga0307406_10300721 Ga0307406_103007212 215
401 3300031903 Ga0307407_10613773 Ga0307407_106137731 215
402 3300031911 Ga0307412_10072304 Ga0307412_100723042 215
403 3300031911 Ga0307412_10093677 Ga0307412_100936772 215
404 3300031911 Ga0307412_10221209 Ga0307412_102212092 215
405 3300032002 Ga0307416_100446914 Ga0307416_1004469141 215
406 3300032004 Ga0307414_10005033 Ga0307414_100050338 215
407 3300032004 Ga0307414_10482077 Ga0307414_104820771 215
408 3300032005 Ga0307411_10008361 Ga0307411_100083617 215
409 3300032005 Ga0307411_10120110 Ga0307411_101201102 215
410 3300032005 Ga0307411_10131201 Ga0307411_101312012 215
411 3300032005 Ga0307411_10220623 Ga0307411_102206231 215
412 3300035725 Ga0373947_0294808 Ga0373947_0294808_165_818 215
413 3300037068 Ga0373925_0379145 Ga0373925_0379145_468_1121 215
414 3300037418 Ga0395900_0303793 Ga0395900_0303793_470_1120 215
415 3300037466 Ga0395898_0003968 Ga0395898_0003968_6832_7482 215
416 3300037471 Ga0395905_0000180 Ga0395905_0000180_23725_24375 215
417 3300037471 Ga0395905_0041095 Ga0395905_0041095_3627_4280 215
418 3300037471 Ga0395905_0096760 Ga0395905_0096760_598_1248 215
419 3300037471 Ga0395905_0512419 Ga0395905_0512419_269_919 215
420 3300038443 Ga0395901_0068022 Ga0395901_0068022_329_982 215
421 3300038443 Ga0395901_0170687 Ga0395901_0170687_945_1595 215
422 3300038443 Ga0395901_0317819 Ga0395901_0317819_276_926 215
423 3300038443 Ga0395901_0331416 Ga0395901_0331416_329_982 215
424 3300038443 Ga0395901_0416513 Ga0395901_0416513_530_1180 215
425 3300041407 Ga0439447_002984 Ga0439447_002984_2142_2789 215
426 3300041407 Ga0439447_052926 Ga0439447_052926_20_667 215
427 3300041410 Ga0439461_0005148 Ga0439461_0005148_1515_2162 215
428 3300041411 Ga0439466_0110151 Ga0439466_0110151_10_657 215
429 3300041413 Ga0439465_0000212 Ga0439465_0000212_1967_2614 215
430 3300041486 Ga0451807_1640364 Ga0451807_1640364_77_724 215
431 3300041498 Ga0451841_0576698 Ga0451841_0576698_206_904 215
432 3300041997 Ga0439431_0003405 Ga0439431_0003405_1964_2611 215
433 3300041999 Ga0439433_0031582 Ga0439433_0031582_438_1085 215
434 3300042002 Ga0439442_020440 Ga0439442_020440_493_1140 215
435 3300042004 Ga0439445_0000327 Ga0439445_0000327_2237_2884 215
436 3300042006 Ga0439432_002375 Ga0439432_002375_2085_2732 215
437 3300042006 Ga0439432_017821 Ga0439432_017821_568_1215 215
438 3300042007 Ga0439449_0000783 Ga0439449_0000783_7566_8213 215
439 3300042007 Ga0439449_0006225 Ga0439449_0006225_1612_2259 215
440 3300042007 Ga0439449_0021978 Ga0439449_0021978_317_964 215
441 3300042010 Ga0439452_000907 Ga0439452_000907_7355_8002 215
442 3300042015 Ga0439462_0004645 Ga0439462_0004645_1699_2346 215
443 3300042015 Ga0439462_0035230 Ga0439462_0035230_127_774 215
444 3300042015 Ga0439462_0056577 Ga0439462_0056577_228_875 215
445 3300042115 Ga0450911_020113 Ga0450911_020113_200_850 215
446 3300042122 Ga0450920_018960 Ga0450920_018960_602_1249 215
447 3300042124 Ga0450922_010541 Ga0450922_010541_10_657 215
448 3300042127 Ga0450890_009450 Ga0450890_009450_84_734 215
449 3300042130 Ga0450892_004977 Ga0450892_004977_222_872 215
450 3300042156 Ga0439446_0001380 Ga0439446_0001380_2510_3157 215
451 3300042156 Ga0439446_0019189 Ga0439446_0019189_25_675 215
452 3300042157 Ga0439458_0059096 Ga0439458_0059096_186_836 215
453 3300042184 Ga0450908_000844 Ga0450908_000844_1138_1785 215
454 3300042184 Ga0450908_020403 Ga0450908_020403_277_924 215
455 3300042435 Ga0439434_0015767 Ga0439434_0015767_1465_2112 215
456 3300042435 Ga0439434_0064781 Ga0439434_0064781_70_717 215
457 3300042439 Ga0439464_0005973 Ga0439464_0005973_1566_2216 215
458 3300042531 Ga0450918_000516 Ga0450918_000516_5159_5806 215
459 3300044656 Ga0466969_0267796 Ga0466969_0267796_107_757 215
460 3300044673 Ga0453683_0091795 Ga0453683_0091795_414_1064 215
461 3300044706 Ga0466964_0164530 Ga0466964_0164530_290_940 215
462 3300044735 Ga0466968_0059784 Ga0466968_0059784_136_786 215
463 3300045051 Ga0451576_0016029 Ga0451576_0016029_3549_4199 215
464 3300046453 Ga0495627_019311 Ga0495627_019311_258_905 215
465 3300046460 Ga0495638_0029313 Ga0495638_0029313_2044_2691 215
466 3300046506 Ga0495583_0105488 Ga0495583_0105488_265_912 215
467 3300046512 Ga0495610_0082494 Ga0495610_0082494_734_1381 215
468 3300046513 Ga0495616_0005680 Ga0495616_0005680_1610_2257 215
469 3300046518 Ga0495631_0002176 Ga0495631_0002176_3888_4535 215
470 3300046539 Ga0495621_0035562 Ga0495621_0035562_683_1333 215
471 3300046615 Ga0495656_0000209 Ga0495656_0000209_3112_3759 215
472 3300046615 Ga0495656_0012974 Ga0495656_0012974_1498_2145 215
473 3300046660 Ga0495625_0000044 Ga0495625_0000044_134898_135545 215
474 3300046660 Ga0495625_0033017 Ga0495625_0033017_1707_2354 215
475 3300046674 Ga0495588_0030838 Ga0495588_0030838_1790_2437 215
476 3300046674 Ga0495588_0033417 Ga0495588_0033417_1071_1718 215
477 3300046683 Ga0495658_0136211 Ga0495658_0136211_742_1395 215
478 3300046683 Ga0495658_0208966 Ga0495658_0208966_460_1107 215
479 3300047321 Ga0495676_0026230 Ga0495676_0026230_2997_3644 215
480 3300047673 Ga0495593_0017861 Ga0495593_0017861_3114_3761 215
481 3300048089 Ga0495614_0053657 Ga0495614_0053657_74_721 215
482 3300048904 Ga0496101_0094303 Ga0496101_0094303_1076_1723 215
483 3300048905 Ga0496102_0000310 Ga0496102_0000310_6453_7241 215
484 3300048907 Ga0496104_0065997 Ga0496104_0065997_2645_3298 215
485 3300048908 Ga0496105_0042329 Ga0496105_0042329_2264_2917 215
486 3300048909 Ga0496106_0069570 Ga0496106_0069570_658_1308 215
487 3300048911 Ga0496108_0011290 Ga0496108_0011290_1642_2292 215
488 3300048912 Ga0496109_0040775 Ga0496109_0040775_1239_1889 215
489 3300048913 Ga0496110_0255264 Ga0496110_0255264_889_1536 215
490 3300048917 Ga0496114_0021656 Ga0496114_0021656_3553_4206 215
491 3300048917 Ga0496114_0393502 Ga0496114_0393502_381_1028 215
492 3300048919 Ga0496116_0021136 Ga0496116_0021136_3586_4233 215
493 3300048919 Ga0496116_0181930 Ga0496116_0181930_260_907 215
494 3300048920 Ga0496117_0018952 Ga0496117_0018952_2481_3128 215
495 3300048920 Ga0496117_0063890 Ga0496117_0063890_1421_2068 215
496 3300048921 Ga0496118_0049833 Ga0496118_0049833_444_1091 215
497 3300048921 Ga0496118_0069356 Ga0496118_0069356_282_929 215
498 3300048924 Ga0496121_0014501 Ga0496121_0014501_4660_5307 215
499 3300048924 Ga0496121_0045777 Ga0496121_0045777_1156_1803 215
500 3300048924 Ga0496121_0176074 Ga0496121_0176074_490_1137 215
501 3300048925 Ga0496122_0062978 Ga0496122_0062978_952_1599 215
502 3300048926 Ga0496123_0052989 Ga0496123_0052989_2009_2656 215
503 3300048927 Ga0496124_0024673 Ga0496124_0024673_1963_2610 215
504 3300048927 Ga0496124_0101737 Ga0496124_0101737_1390_2037 215
505 3300048927 Ga0496124_0384568 Ga0496124_0384568_207_854 215
506 3300048928 Ga0496125_0012614 Ga0496125_0012614_811_1458 215
507 3300048928 Ga0496125_0014401 Ga0496125_0014401_5575_6222 215
508 3300048928 Ga0496125_0220837 Ga0496125_0220837_81_728 215
509 3300048928 Ga0496125_0295147 Ga0496125_0295147_38_685 215
510 3300048929 Ga0496126_0088475 Ga0496126_0088475_1527_2174 215
511 3300049127 Ga0501306_013307 Ga0501306_013307_16_666 215
512 3300049127 Ga0501306_016403 Ga0501306_016403_21_671 215
513 3300049127 Ga0501306_036214 Ga0501306_036214_32_682 215
514 3300049128 Ga0501308_032375 Ga0501308_032375_43_690 215
515 3300049129 Ga0501309_012791 Ga0501309_012791_73_723 215
516 3300049130 Ga0501310_013154 Ga0501310_013154_27_677 215
517 3300049130 Ga0501310_021065 Ga0501310_021065_134_784 215
518 3300049130 Ga0501310_024663 Ga0501310_024663_99_749 215
519 3300049130 Ga0501310_036004 Ga0501310_036004_10_657 215
520 3300049160 Ga0501304_006233 Ga0501304_006233_29_679 215
521 3300049160 Ga0501304_012655 Ga0501304_012655_25_675 215
522 3300049160 Ga0501304_016078 Ga0501304_016078_18_665 215
523 3300049161 Ga0501305_012094 Ga0501305_012094_499_1149 215
524 3300049161 Ga0501305_029455 Ga0501305_029455_28_678 215
525 3300049161 Ga0501305_051535 Ga0501305_051535_21_671 215
526 3300049162 Ga0501307_023368 Ga0501307_023368_141_791 215
527 3300049529 Ga0501313_030193 Ga0501313_030193_29_682 215
528 3300049530 Ga0501314_010850 Ga0501314_010850_41_688 215
529 3300049530 Ga0501314_016856 Ga0501314_016856_16_666 215
530 3300049530 Ga0501314_018371 Ga0501314_018371_14_664 215
531 3300049531 Ga0501315_018826 Ga0501315_018826_193_843 215
532 3300049531 Ga0501315_022229 Ga0501315_022229_192_842 215
533 3300049531 Ga0501315_031759 Ga0501315_031759_33_680 215
534 3300049531 Ga0501315_041806 Ga0501315_041806_34_681 215
535 3300049532 Ga0501316_032066 Ga0501316_032066_21_674 215
536 3300049538 Ga0501322_007675 Ga0501322_007675_18_668 215
537 3300049539 Ga0501323_031098 Ga0501323_031098_29_679 215
538 3300049679 Ga0501249_002689 Ga0501249_002689_776_1423 215
539 3300049758 Ga0501241_014340 Ga0501241_014340_10_657 215
540 3300049759 Ga0501262_000210 Ga0501262_000210_4192_4839 215
541 3300049823 Ga0501044_0785202 Ga0501044_0785202_95_745 215
542 3300050489 nmdc:mga03683_305289_c1 nmdc:mga03683_305289_c1_80_727 215
543 3300050493 nmdc:mga0k408_116930_c1 nmdc:mga0k408_116930_c1_513_1160 215
544 3300050494 nmdc:mga06z11_11842_c1 nmdc:mga06z11_11842_c1_555_1202 215
545 3300050496 nmdc:mga07m45_115372_c1 nmdc:mga07m45_115372_c1_600_1247 215
546 3300050496 nmdc:mga07m45_12425_c1 nmdc:mga07m45_12425_c1_1213_1860 215
547 3300050496 nmdc:mga07m45_167312_c1 nmdc:mga07m45_167312_c1_539_1186 215
548 3300050496 nmdc:mga07m45_386_c1 nmdc:mga07m45_386_c1_1022_1672 215
549 3300050496 nmdc:mga07m45_6174_c1 nmdc:mga07m45_6174_c1_3124_3771 215
550 3300053087 Ga0500643_013156 Ga0500643_013156_1503_2150 215
551 3300053093 Ga0500651_0000063 Ga0500651_0000063_70111_70758 215
552 3300053094 Ga0500566_0095922 Ga0500566_0095922_957_1604 215
553 3300053108 Ga0500562_002124 Ga0500562_002124_691_1338 215
554 3300053110 Ga0500571_006776 Ga0500571_006776_5502_6149 215
555 3300053118 Ga0500594_0002456 Ga0500594_0002456_2152_2799 215
556 3300053120 Ga0500597_039379 Ga0500597_039379_229_876 215
557 3300053121 Ga0500607_001609 Ga0500607_001609_6887_7534 215
558 3300053121 Ga0500607_048234 Ga0500607_048234_1476_2123 215
559 3300053133 Ga0500655_003141 Ga0500655_003141_1516_2163 215
560 3300053134 Ga0500658_0000481 Ga0500658_0000481_6679_7326 215
561 3300053134 Ga0500658_0000709 Ga0500658_0000709_5123_5770 215
562 3300053136 Ga0500559_0003620 Ga0500559_0003620_4862_5551 215
563 3300053139 Ga0500568_0003586 Ga0500568_0003586_2740_3387 215
564 3300053153 Ga0500616_0241801 Ga0500616_0241801_28_675 215
565 3300053157 Ga0500624_041586 Ga0500624_041586_13_660 215
566 3300053161 Ga0500634_0008688 Ga0500634_0008688_2536_3183 215
567 3300053162 Ga0500638_043069 Ga0500638_043069_1361_2008 215
568 3300053729 Ga0500625_028720 Ga0500625_028720_1873_2520 215
569 3300059477 Ga0587084_024870 Ga0587084_024870_43_690 215
570 3300059477 Ga0587084_053397 Ga0587084_053397_33_680 215
571 3300060346 Ga0587111_0105279 Ga0587111_0105279_46_693 215
572 3300005288 Ga0065714_10188073 Ga0065714_101880732 216
573 3300005367 Ga0070667_100013446 Ga0070667_1000134466 216
574 3300005456 Ga0070678_100795132 Ga0070678_1007951321 216
575 3300006195 Ga0075366_10156024 Ga0075366_101560242 216
576 3300006353 Ga0075370_10009157 Ga0075370_100091575 216
577 3300009176 Ga0105242_10612207 Ga0105242_106122071 216
578 3300009551 Ga0105238_10115661 Ga0105238_101156612 216
579 3300009553 Ga0105249_10091984 Ga0105249_100919843 216
580 3300013104 Ga0157370_10034191 Ga0157370_100341913 216
581 3300013296 Ga0157374_10368459 Ga0157374_103684592 216
582 3300013306 Ga0163162_10117062 Ga0163162_101170623 216
583 3300014497 Ga0182008_10022826 Ga0182008_100228264 216
584 3300014497 Ga0182008_10037658 Ga0182008_100376583 216
585 3300015261 Ga0182006_1050345 Ga0182006_10503452 216
586 3300015262 Ga0182007_10000916 Ga0182007_100009168 216
587 3300017792 Ga0163161_10040574 Ga0163161_100405742 216
588 3300025258 Ga0209129_1000528 Ga0209129_10005282 216
589 3300025294 Ga0209025_1000248 Ga0209025_100024875 216
590 3300025940 Ga0207691_10583478 Ga0207691_105834781 216
591 3300025986 Ga0207658_10060708 Ga0207658_100607082 216
592 3300026121 Ga0207683_10317661 Ga0207683_103176612 216
593 3300026142 Ga0207698_10503687 Ga0207698_105036872 216
594 3300027907 Ga0207428_10569974 Ga0207428_105699741 216
595 3300031239 Ga0265328_10024200 Ga0265328_100242002 216
596 3300031456 Ga0307513_10000486 Ga0307513_1000048624 216
597 3300031911 Ga0307412_10956972 Ga0307412_109569721 216
598 3300041451 Ga0451791_0997051 Ga0451791_0997051_81_734 216
599 3300044683 Ga0466965_0006533 Ga0466965_0006533_3173_3871 216
600 3300044901 Ga0466960_0020091 Ga0466960_0020091_61_759 216
601 3300045051 Ga0451576_0869427 Ga0451576_0869427_80_733 216
602 3300046475 Ga0495639_0001341 Ga0495639_0001341_2432_3085 216
603 3300046520 Ga0495637_0071933 Ga0495637_0071933_254_937 216
604 3300046539 Ga0495621_0056812 Ga0495621_0056812_18_674 216
605 3300046660 Ga0495625_0136747 Ga0495625_0136747_866_1549 216
606 3300046674 Ga0495588_0039594 Ga0495588_0039594_871_1524 216
607 3300046678 Ga0495599_0131909 Ga0495599_0131909_507_1160 216
608 3300046691 Ga0495670_0053925 Ga0495670_0053925_970_1623 216
609 3300046692 Ga0495671_0013095 Ga0495671_0013095_2850_3533 216
610 3300048903 Ga0496100_0011371 Ga0496100_0011371_4001_4654 216
611 3300048904 Ga0496101_0000958 Ga0496101_0000958_6890_7543 216
612 3300048905 Ga0496102_0037849 Ga0496102_0037849_141_794 216
613 3300048906 Ga0496103_0028934 Ga0496103_0028934_313_966 216
614 3300048907 Ga0496104_0000688 Ga0496104_0000688_26275_26928 216
615 3300048908 Ga0496105_0005944 Ga0496105_0005944_4189_4842 216
616 3300048910 Ga0496107_0041302 Ga0496107_0041302_1683_2336 216
617 3300048911 Ga0496108_0176174 Ga0496108_0176174_541_1194 216
618 3300048911 Ga0496108_0835022 Ga0496108_0835022_51_704 216
619 3300048912 Ga0496109_0405182 Ga0496109_0405182_406_1059 216
620 3300048913 Ga0496110_0031792 Ga0496110_0031792_2038_2691 216
621 3300048913 Ga0496110_0097168 Ga0496110_0097168_1165_1818 216
622 3300048914 Ga0496111_0029141 Ga0496111_0029141_1146_1799 216
623 3300049579 Ga0501043_0186685 Ga0501043_0186685_78_770 216
624 3300049663 Ga0501223_027932 Ga0501223_027932_157_960 216
625 3300049853 Ga0501226_011670 Ga0501226_011670_103_906 216
626 3300050493 nmdc:mga0k408_12049_c1 nmdc:mga0k408_12049_c1_79_765 216
627 3300050493 nmdc:mga0k408_50825_c1 nmdc:mga0k408_50825_c1_1431_2114 216
628 3300050494 nmdc:mga06z11_95696_c1 nmdc:mga06z11_95696_c1_144_830 216
629 3300050496 nmdc:mga07m45_22727_c1 nmdc:mga07m45_22727_c1_1374_2057 216
630 3300050496 nmdc:mga07m45_34539_c1 nmdc:mga07m45_34539_c1_80_766 216
631 3300050496 nmdc:mga07m45_460279_c1 nmdc:mga07m45_460279_c1_32_685 216
632 3300050508 nmdc:mga09592_135046_c1 nmdc:mga09592_135046_c1_1162_1818 216
633 3300053117 Ga0500593_000829 Ga0500593_000829_8091_8774 216
634 3300053122 Ga0500608_052273 Ga0500608_052273_887_1570 216
635 3300053158 Ga0500627_0003521 Ga0500627_0003521_2131_2814 216
636 3300053160 Ga0500633_0159070 Ga0500633_0159070_107_790 216
637 3300053161 Ga0500634_0018086 Ga0500634_0018086_2823_3506 216
638 3300053730 Ga0500645_000059 Ga0500645_000059_52376_53080 216
639 3300053730 Ga0500645_002200 Ga0500645_002200_2955_3605 216
640 3300002704 JGI25155J39150_1000392 JGI25155J39150_10003929 217
641 3300002705 JGI25156J39149_1001058 JGI25156J39149_10010589 217
642 3300002738 JGI25154J39366_1000894 JGI25154J39366_10008949 217
643 3300002741 JGI25157J39369_1001038 JGI25157J39369_10010389 217
644 3300002987 JGI25159J45721_1003130 JGI25159J45721_10031303 217
645 3300002987 JGI25159J45721_1007356 JGI25159J45721_10073562 217
646 3300003187 JGI25151J46595_10005828 JGI25151J46595_100058286 217
647 3300003354 JGI25160J50197_1011352 JGI25160J50197_10113522 217
648 3300003374 JGI25161J50226_1004040 JGI25161J50226_10040402 217
649 3300003771 Ga0055526_1001314 Ga0055526_100131419 217
650 3300003771 Ga0055526_1008772 Ga0055526_10087723 217
651 3300003773 Ga0055537_1000034 Ga0055537_100003468 217
652 3300003775 Ga0055524_1000016 Ga0055524_100001676 217
653 3300003784 Ga0055534_1001269 Ga0055534_10012692 217
654 3300003790 Ga0055528_1000527 Ga0055528_100052734 217
655 3300003791 Ga0055530_10000431 Ga0055530_1000043130 217
656 3300003791 Ga0055530_10028411 Ga0055530_100284112 217
657 3300003792 Ga0055540_1000031 Ga0055540_100003186 217
658 3300003794 Ga0055531_10002449 Ga0055531_100024497 217
659 3300004625 Ga0055543_1005541 Ga0055543_10055412 217
660 3300005578 Ga0068854_100680502 Ga0068854_1006805021 217
661 3300006038 Ga0075365_10447070 Ga0075365_104470701 217
662 3300006177 Ga0075362_10108518 Ga0075362_101085182 217
663 3300025206 Ga0209435_100001 Ga0209435_100001411 217
664 3300025245 Ga0207425_1003171 Ga0207425_10031714 217
665 3300025246 Ga0209646_1000001 Ga0209646_1000001780 217
666 3300025250 Ga0209026_1000003 Ga0209026_1000003411 217
667 3300025256 Ga0209759_1000001 Ga0209759_1000001411 217
668 3300025263 Ga0209565_1000004 Ga0209565_1000004316 217
669 3300025263 Ga0209565_1005599 Ga0209565_10055992 217
670 3300025273 Ga0209673_1000045 Ga0209673_100004555 217
671 3300025284 Ga0209130_1000056 Ga0209130_10000562 217
672 3300025284 Ga0209130_1000155 Ga0209130_100015550 217
673 3300025291 Ga0209675_1000225 Ga0209675_100022524 217
674 3300025291 Ga0209675_1008925 Ga0209675_10089252 217
675 3300025292 Ga0209676_1000007 Ga0209676_1000007856 217
676 3300025294 Ga0209025_1014941 Ga0209025_10149415 217
677 3300025295 Ga0209564_1000358 Ga0209564_10003589 217
678 3300025295 Ga0209564_1001768 Ga0209564_100176817 217
679 3300025295 Ga0209564_1006761 Ga0209564_10067616 217
680 3300025297 Ga0209758_1031838 Ga0209758_10318382 217
681 3300025298 Ga0209050_1000003 Ga0209050_1000003651 217
682 3300025298 Ga0209050_1004524 Ga0209050_10045242 217
683 3300025299 Ga0209256_1000001 Ga0209256_1000001651 217
684 3300025299 Ga0209256_1018315 Ga0209256_10183152 217
685 3300025302 Ga0207426_1000025 Ga0207426_1000025321 217
686 3300025302 Ga0207426_1003991 Ga0207426_10039917 217
687 3300025303 Ga0209051_1000003 Ga0209051_1000003651 217
688 3300025304 Ga0209257_1000018 Ga0209257_1000018651 217
689 3300025304 Ga0209257_1012788 Ga0209257_10127882 217
690 3300026041 Ga0207639_10168591 Ga0207639_101685912 217
691 3300031548 Ga0307408_100019789 Ga0307408_1000197891 217
692 3300031901 Ga0307406_10024399 Ga0307406_100243993 217
693 3300050489 nmdc:mga03683_145917_c1 nmdc:mga03683_145917_c1_358_1011 217
694 3300053096 Ga0500641_0095174 Ga0500641_0095174_18_671 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02525

Flavodoxin_2

Flavodoxin-like fold

41

243

0.94

PF03358

FMN_red

NADPH-dependent FMN reductase

41

206

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z98-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) 0.9592 2 205
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9592 2 205
2z98-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) 0.9544 2 205
2z9b-assembly1.cif.gz_A-2 the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals 0.9544 2 205
7n2x-assembly1.cif.gz_A the crystal structure of an fmn-dependent nadh:quinone oxidoreductase, azor from escherichia coli 0.9541 1 205
ID Description Score Start End Superfamily
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9481 1 206 3.40.50.360
1tikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9391 1 206 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9307 2 201 3.40.50.360
6dxpB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9101 1 206 3.40.50.360
4c0wA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9084 2 201 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A068Z1X3-F1-model_v4 FMN-dependent NADH-azoreductase 0.9899 1 144
AF-A0A433BLN3-F1-model_v4 FMN-dependent NADH-azoreductase (EC 1.7.1.17) 0.988 44 202 GO:0010181
GO:0016655
AF-A0A1I5PF16-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9826 2 217 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-Q220J4-F1-model_v4 FMN-dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9813 2 203 GO:0009055
GO:0010181
GO:0016652
GO:0016655
AF-A0A2G6Y693-F1-model_v4 FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) 0.9811 2 205 GO:0009055
GO:0010181
GO:0016652
GO:0016655

Feature Viewer

pLDDT pTM Quality
93.44 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map