F475724
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 397 | 657 | 216 |
Family's Representative Sequence
| Representative Sequence | 3300009176|Ga0105242_10612207|Ga0105242_106122071 |
| Length | 256 |
| Sequence | MGSSYEQDNLSRNRQLIKRLIHRHTLFTRPHRGRSIREKTLKLLHIDSSPLGAQSVSRELTRRTVAQWQDSHPGTTVEYLDLAADAPSHLNMDSLGFRLGLDADALTPVQKRENARTEQLLSQFLAADVVVVGAPMYNFSIPSQLKAWIDRVAQAGRTFKYTDQGPVGLAAGKTVIVVSSRGGAYSANPALAFLDHQESYLTAVFGFFGITDVRFVRAEGVAMGDAAKAHAIASAEADIRVHAAEAANEGKVALRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 4 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 5 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 6 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 7 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 8 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 9 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 10 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 11 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 12 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 13 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 14 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 15 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 16 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 17 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 18 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 19 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 20 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 21 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 22 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 23 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 24 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 25 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 26 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 27 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 28 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 29 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 30 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 31 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 32 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 33 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 34 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 35 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 36 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 37 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 38 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 39 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 40 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 41 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 42 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 43 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 44 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 45 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 46 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 47 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 48 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 49 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 50 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 51 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 54 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 55 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 56 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 57 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 58 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 59 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 60 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 68 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 69 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 72 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 87 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 119 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 147 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 155 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 212 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 213 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 214 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 215 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 216 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 217 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 218 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 219 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 220 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 227 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 228 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 231 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 240 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 243 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 247 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 250 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 251 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 252 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 253 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 254 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 255 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 256 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 257 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 258 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 259 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 260 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 261 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 262 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 263 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 264 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 265 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 266 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 267 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 268 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 269 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 270 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 271 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 272 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 273 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 274 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 333 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 338 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 339 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 340 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 341 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 342 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 361 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 362 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 363 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 368 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 372 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 374 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 375 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 376 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 377 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 378 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 379 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 380 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 382 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 383 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 384 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 385 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 386 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 387 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 388 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 389 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 391 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 392 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 393 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 394 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 395 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 396 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.9 |
| Metatranscriptomes | 6.77 |
| Isolates | 5.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.63 |
| Nodule | 0.86 |
| Rhizoplane | 4.61 |
| Rhizosphere | 62.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000392 | 3300002704 | Bacteria | 12366 |
| 2 | JGI25156J39149_1001058 | 3300002705 | Bacteria | 12712 |
| 3 | JGI25154J39366_1000894 | 3300002738 | Bacteria | 12712 |
| 4 | JGI25157J39369_1001038 | 3300002741 | Bacteria | 12712 |
| 5 | JGI25159J45721_1003130 | 3300002987 | Bacteria | 5957 |
| 6 | JGI25159J45721_1007356 | 3300002987 | Bacteria | 3166 |
| 7 | JGI25151J46595_10001260 | 3300003187 | Bacteria | 17947 |
| 8 | JGI25151J46595_10005828 | 3300003187 | Bacteria | 6304 |
| 9 | JGI25151J46595_10007367 | 3300003187 | Bacteria | 5405 |
| 10 | Ga0006770J48903_1041039 | 3300003305 | Bacteria | 954 |
| 11 | Ga0006777J48905_1077401 | 3300003308 | Bacteria | 711 |
| 12 | JGI25160J50197_1011352 | 3300003354 | Bacteria | 3166 |
| 13 | JGI25161J50226_1004040 | 3300003374 | Bacteria | 3166 |
| 14 | Ga0007416J51690_1036082 | 3300003577 | Bacteria | 993 |
| 15 | Ga0007416J51690_1045190 | 3300003577 | Bacteria | 1452 |
| 16 | Ga0007416J51690_1059848 | 3300003577 | Bacteria | 703 |
| 17 | Ga0007429J51699_1020602 | 3300003579 | Bacteria | 1326 |
| 18 | Ga0055535_1000330 | 3300003761 | Bacteria | 47889 |
| 19 | Ga0055542_1000039 | 3300003762 | Bacteria | 215126 |
| 20 | Ga0055526_1001314 | 3300003771 | Bacteria | 17813 |
| 21 | Ga0055526_1008772 | 3300003771 | Bacteria | 4980 |
| 22 | Ga0055537_1000034 | 3300003773 | Bacteria | 98043 |
| 23 | Ga0055537_1000285 | 3300003773 | Bacteria | 36115 |
| 24 | Ga0055537_1000373 | 3300003773 | Bacteria | 30435 |
| 25 | Ga0055537_1011479 | 3300003773 | Bacteria | 1795 |
| 26 | Ga0055524_1000016 | 3300003775 | Bacteria | 244926 |
| 27 | Ga0055536_1001531 | 3300003781 | Bacteria | 13863 |
| 28 | Ga0055536_1004149 | 3300003781 | Bacteria | 7508 |
| 29 | Ga0055534_1000018 | 3300003784 | Bacteria | 138136 |
| 30 | Ga0055534_1001269 | 3300003784 | Bacteria | 10294 |
| 31 | Ga0055528_1000401 | 3300003790 | Bacteria | 35131 |
| 32 | Ga0055528_1000527 | 3300003790 | Bacteria | 29607 |
| 33 | Ga0055528_1024650 | 3300003790 | Bacteria | 1795 |
| 34 | Ga0055528_1025740 | 3300003790 | Bacteria | 1715 |
| 35 | Ga0055530_10000431 | 3300003791 | Bacteria | 37213 |
| 36 | Ga0055530_10015125 | 3300003791 | Bacteria | 2539 |
| 37 | Ga0055530_10028411 | 3300003791 | Bacteria | 1510 |
| 38 | Ga0055540_1000031 | 3300003792 | Bacteria | 177859 |
| 39 | Ga0055540_1000788 | 3300003792 | Bacteria | 21446 |
| 40 | Ga0055540_1001180 | 3300003792 | Bacteria | 16115 |
| 41 | Ga0055540_1008068 | 3300003792 | Bacteria | 3846 |
| 42 | Ga0055531_10002449 | 3300003794 | Bacteria | 12423 |
| 43 | Ga0055543_1004921 | 3300004625 | Bacteria | 3518 |
| 44 | Ga0055543_1005541 | 3300004625 | Bacteria | 3204 |
| 45 | Ga0065714_10015276 | 3300005288 | Bacteria | 2255 |
| 46 | Ga0065714_10105205 | 3300005288 | Bacteria | 1570 |
| 47 | Ga0065714_10188073 | 3300005288 | Bacteria | 937 |
| 48 | Ga0065704_10074000 | 3300005289 | Bacteria | 6602 |
| 49 | Ga0065715_10007212 | 3300005293 | Bacteria | 4129 |
| 50 | Ga0065715_10114105 | 3300005293 | Bacteria | 2462 |
| 51 | Ga0070658_10084151 | 3300005327 | Bacteria | 2616 |
| 52 | Ga0070658_10182318 | 3300005327 | Bacteria | 1767 |
| 53 | Ga0070658_10277299 | 3300005327 | Bacteria | 1427 |
| 54 | Ga0070676_10024726 | 3300005328 | Bacteria | 3387 |
| 55 | Ga0070690_100003807 | 3300005330 | Bacteria | 8311 |
| 56 | Ga0068869_100045046 | 3300005334 | Bacteria | 3174 |
| 57 | Ga0070666_10006291 | 3300005335 | Bacteria | 7301 |
| 58 | Ga0070666_10093364 | 3300005335 | Bacteria | 2069 |
| 59 | Ga0070680_100341375 | 3300005336 | Bacteria | 1273 |
| 60 | Ga0068868_100017362 | 3300005338 | Bacteria | 5360 |
| 61 | Ga0070660_100090762 | 3300005339 | Bacteria | 2409 |
| 62 | Ga0070668_100133658 | 3300005347 | Bacteria | 1993 |
| 63 | Ga0070668_100276798 | 3300005347 | Bacteria | 1400 |
| 64 | Ga0070669_100019979 | 3300005353 | Bacteria | 4783 |
| 65 | Ga0070669_100836294 | 3300005353 | Bacteria | 784 |
| 66 | Ga0070675_100001058 | 3300005354 | Bacteria | 19826 |
| 67 | Ga0070675_100184884 | 3300005354 | Bacteria | 1803 |
| 68 | Ga0070671_100020705 | 3300005355 | Bacteria | 5365 |
| 69 | Ga0070671_100356188 | 3300005355 | Bacteria | 1249 |
| 70 | Ga0070674_100311307 | 3300005356 | Bacteria | 1259 |
| 71 | Ga0070673_100029058 | 3300005364 | Bacteria | 4119 |
| 72 | Ga0070688_100025823 | 3300005365 | Bacteria | 3483 |
| 73 | Ga0070659_100863503 | 3300005366 | Bacteria | 789 |
| 74 | Ga0070667_100013446 | 3300005367 | Bacteria | 6766 |
| 75 | Ga0070667_100048932 | 3300005367 | Bacteria | 3560 |
| 76 | Ga0070708_100703966 | 3300005445 | Bacteria | 951 |
| 77 | Ga0070663_100233939 | 3300005455 | Bacteria | 1448 |
| 78 | Ga0070678_100012066 | 3300005456 | Bacteria | 5355 |
| 79 | Ga0070678_100170557 | 3300005456 | Bacteria | 1772 |
| 80 | Ga0070678_100795132 | 3300005456 | Bacteria | 858 |
| 81 | Ga0070662_100004214 | 3300005457 | Bacteria | 9058 |
| 82 | Ga0070662_100247499 | 3300005457 | Bacteria | 1432 |
| 83 | Ga0070662_100723715 | 3300005457 | Bacteria | 843 |
| 84 | Ga0068867_100055819 | 3300005459 | Bacteria | 2921 |
| 85 | Ga0068867_100072252 | 3300005459 | Bacteria | 2582 |
| 86 | Ga0070698_100755748 | 3300005471 | Bacteria | 915 |
| 87 | Ga0070679_100103958 | 3300005530 | Bacteria | 2826 |
| 88 | Ga0070679_100113030 | 3300005530 | Bacteria | 2701 |
| 89 | Ga0068853_100051727 | 3300005539 | Bacteria | 3537 |
| 90 | Ga0068853_100302366 | 3300005539 | Bacteria | 1479 |
| 91 | Ga0068853_100365169 | 3300005539 | Bacteria | 1346 |
| 92 | Ga0070672_100124366 | 3300005543 | Bacteria | 2114 |
| 93 | Ga0070672_100258777 | 3300005543 | Bacteria | 1467 |
| 94 | Ga0070665_100187817 | 3300005548 | Bacteria | 2067 |
| 95 | Ga0070665_100610418 | 3300005548 | Bacteria | 1104 |
| 96 | Ga0068855_100016751 | 3300005563 | Bacteria | 8814 |
| 97 | Ga0068855_100281364 | 3300005563 | Bacteria | 1847 |
| 98 | Ga0070664_100041366 | 3300005564 | Bacteria | 3889 |
| 99 | Ga0068854_100680502 | 3300005578 | Bacteria | 886 |
| 100 | Ga0068856_100337264 | 3300005614 | Bacteria | 1526 |
| 101 | Ga0068852_100520334 | 3300005616 | Bacteria | 1187 |
| 102 | Ga0068859_100022769 | 3300005617 | Bacteria | 6282 |
| 103 | Ga0068864_100000212 | 3300005618 | Bacteria | 52395 |
| 104 | Ga0068866_10024083 | 3300005718 | Bacteria | 2840 |
| 105 | Ga0068861_100284798 | 3300005719 | Bacteria | 1424 |
| 106 | Ga0068863_100001367 | 3300005841 | Bacteria | 24264 |
| 107 | Ga0068863_100775827 | 3300005841 | Bacteria | 955 |
| 108 | Ga0068858_100002207 | 3300005842 | Bacteria | 19715 |
| 109 | Ga0068860_100059901 | 3300005843 | Bacteria | 3619 |
| 110 | Ga0068862_100220132 | 3300005844 | Bacteria | 1718 |
| 111 | Ga0068862_100295282 | 3300005844 | Bacteria | 1489 |
| 112 | Ga0075365_10008170 | 3300006038 | Bacteria | 5918 |
| 113 | Ga0075365_10447070 | 3300006038 | Bacteria | 913 |
| 114 | Ga0075363_100019632 | 3300006048 | Bacteria | 3380 |
| 115 | Ga0075363_100171268 | 3300006048 | Bacteria | 1232 |
| 116 | Ga0075364_10026087 | 3300006051 | Bacteria | 3725 |
| 117 | Ga0075432_10030376 | 3300006058 | Bacteria | 1867 |
| 118 | Ga0075432_10085254 | 3300006058 | Bacteria | 1150 |
| 119 | Ga0075362_10031575 | 3300006177 | Bacteria | 2293 |
| 120 | Ga0075362_10042960 | 3300006177 | Bacteria | 2000 |
| 121 | Ga0075362_10108518 | 3300006177 | Bacteria | 1305 |
| 122 | Ga0075367_10058598 | 3300006178 | Bacteria | 2292 |
| 123 | Ga0075366_10009650 | 3300006195 | Bacteria | 5395 |
| 124 | Ga0075366_10115852 | 3300006195 | Bacteria | 1614 |
| 125 | Ga0075366_10156024 | 3300006195 | Bacteria | 1382 |
| 126 | Ga0097621_100007144 | 3300006237 | Bacteria | 7960 |
| 127 | Ga0097621_100072548 | 3300006237 | Bacteria | 2848 |
| 128 | Ga0097621_100073271 | 3300006237 | Bacteria | 2835 |
| 129 | Ga0097621_100504052 | 3300006237 | Bacteria | 1097 |
| 130 | Ga0075370_10005901 | 3300006353 | Bacteria | 6125 |
| 131 | Ga0075370_10009157 | 3300006353 | Bacteria | 5126 |
| 132 | Ga0075370_10009692 | 3300006353 | Bacteria | 5013 |
| 133 | Ga0075370_10010505 | 3300006353 | Bacteria | 4841 |
| 134 | Ga0075370_10046297 | 3300006353 | Bacteria | 2461 |
| 135 | Ga0075370_10342967 | 3300006353 | Bacteria | 892 |
| 136 | Ga0068871_100016987 | 3300006358 | Bacteria | 5495 |
| 137 | Ga0068871_100308343 | 3300006358 | Bacteria | 1391 |
| 138 | Ga0075429_100478710 | 3300006880 | Bacteria | 1091 |
| 139 | Ga0068865_100030894 | 3300006881 | Bacteria | 3567 |
| 140 | Ga0097620_100022770 | 3300006931 | Bacteria | 6282 |
| 141 | Ga0099826_10000116 | 3300006948 | Bacteria | 36767 |
| 142 | Ga0099826_10217346 | 3300006948 | Bacteria | 1032 |
| 143 | Ga0105244_10006285 | 3300009036 | Bacteria | 7731 |
| 144 | Ga0105240_10134415 | 3300009093 | Bacteria | 2963 |
| 145 | Ga0105243_10014281 | 3300009148 | Bacteria | 6009 |
| 146 | Ga0105243_10387527 | 3300009148 | Bacteria | 1294 |
| 147 | Ga0105241_10275970 | 3300009174 | Bacteria | 1434 |
| 148 | Ga0105242_10344667 | 3300009176 | Bacteria | 1374 |
| 149 | Ga0105242_10612207 | 3300009176 | Bacteria | 1054 |
| 150 | Ga0105248_10024395 | 3300009177 | Bacteria | 6725 |
| 151 | Ga0105248_10891850 | 3300009177 | Bacteria | 1004 |
| 152 | Ga0105237_10122282 | 3300009545 | Bacteria | 2597 |
| 153 | Ga0105237_10332011 | 3300009545 | Bacteria | 1525 |
| 154 | Ga0105238_10115661 | 3300009551 | Bacteria | 2661 |
| 155 | Ga0105249_10091984 | 3300009553 | Bacteria | 2839 |
| 156 | Ga0105239_10206651 | 3300010375 | Bacteria | 2200 |
| 157 | Ga0105246_10089496 | 3300011119 | Bacteria | 2215 |
| 158 | Ga0105246_10097776 | 3300011119 | Bacteria | 2131 |
| 159 | Ga0157373_10079660 | 3300013100 | Bacteria | 2310 |
| 160 | Ga0157370_10034191 | 3300013104 | Bacteria | 4952 |
| 161 | Ga0157369_10034980 | 3300013105 | Bacteria | 5508 |
| 162 | Ga0157374_10055118 | 3300013296 | Bacteria | 3710 |
| 163 | Ga0157374_10368459 | 3300013296 | Bacteria | 1429 |
| 164 | Ga0157378_10168337 | 3300013297 | Bacteria | 2053 |
| 165 | Ga0163162_10019158 | 3300013306 | Bacteria | 6711 |
| 166 | Ga0163162_10110726 | 3300013306 | Bacteria | 2843 |
| 167 | Ga0163162_10117062 | 3300013306 | Bacteria | 2766 |
| 168 | Ga0163162_10280428 | 3300013306 | Bacteria | 1798 |
| 169 | Ga0163162_10700381 | 3300013306 | Bacteria | 1134 |
| 170 | Ga0157375_10024781 | 3300013308 | Bacteria | 5560 |
| 171 | Ga0157375_10092116 | 3300013308 | Bacteria | 3094 |
| 172 | Ga0157375_10415970 | 3300013308 | Bacteria | 1511 |
| 173 | Ga0163163_10027074 | 3300014325 | Bacteria | 5486 |
| 174 | Ga0157380_10226896 | 3300014326 | Bacteria | 1675 |
| 175 | Ga0182008_10000190 | 3300014497 | Bacteria | 48677 |
| 176 | Ga0182008_10001821 | 3300014497 | Bacteria | 13892 |
| 177 | Ga0182008_10022826 | 3300014497 | Bacteria | 3202 |
| 178 | Ga0182008_10037658 | 3300014497 | Bacteria | 2420 |
| 179 | Ga0182008_10101753 | 3300014497 | Bacteria | 1420 |
| 180 | Ga0157379_10019567 | 3300014968 | Bacteria | 5979 |
| 181 | Ga0157376_10043764 | 3300014969 | Bacteria | 3676 |
| 182 | Ga0157376_10054969 | 3300014969 | Bacteria | 3320 |
| 183 | Ga0157376_10547501 | 3300014969 | Bacteria | 1145 |
| 184 | Ga0182006_1001217 | 3300015261 | Bacteria | 16063 |
| 185 | Ga0182006_1050345 | 3300015261 | Bacteria | 1605 |
| 186 | Ga0182007_10000916 | 3300015262 | Bacteria | 16314 |
| 187 | Ga0182007_10001403 | 3300015262 | Bacteria | 12974 |
| 188 | Ga0182007_10059013 | 3300015262 | Bacteria | 1258 |
| 189 | Ga0163161_10000092 | 3300017792 | Bacteria | 90636 |
| 190 | Ga0163161_10003072 | 3300017792 | Bacteria | 11775 |
| 191 | Ga0163161_10021484 | 3300017792 | Bacteria | 4535 |
| 192 | Ga0163161_10038890 | 3300017792 | Bacteria | 3413 |
| 193 | Ga0163161_10040574 | 3300017792 | Bacteria | 3344 |
| 194 | Ga0163161_10169556 | 3300017792 | Bacteria | 1668 |
| 195 | Ga0206352_11194471 | 3300020078 | Bacteria | 714 |
| 196 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 197 | Ga0209672_100647 | 3300025228 | Bacteria | 17930 |
| 198 | Ga0209147_101107 | 3300025229 | Bacteria | 11223 |
| 199 | Ga0209258_100099 | 3300025242 | Bacteria | 214924 |
| 200 | Ga0207425_1000799 | 3300025245 | Bacteria | 16016 |
| 201 | Ga0207425_1003171 | 3300025245 | Bacteria | 5378 |
| 202 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 203 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 204 | Ga0209148_1000103 | 3300025254 | Bacteria | 215356 |
| 205 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 206 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 207 | Ga0209129_1000528 | 3300025258 | Bacteria | 26713 |
| 208 | Ga0209129_1001701 | 3300025258 | Bacteria | 11876 |
| 209 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 210 | Ga0209565_1000075 | 3300025263 | Bacteria | 162259 |
| 211 | Ga0209565_1000199 | 3300025263 | Bacteria | 71613 |
| 212 | Ga0209565_1002461 | 3300025263 | Bacteria | 6648 |
| 213 | Ga0209565_1005599 | 3300025263 | Bacteria | 3629 |
| 214 | Ga0209673_1000045 | 3300025273 | Bacteria | 290531 |
| 215 | Ga0209673_1000128 | 3300025273 | Bacteria | 164482 |
| 216 | Ga0209673_1000289 | 3300025273 | Bacteria | 93941 |
| 217 | Ga0209673_1001078 | 3300025273 | Bacteria | 30774 |
| 218 | Ga0209673_1004719 | 3300025273 | Bacteria | 7177 |
| 219 | Ga0209130_1000056 | 3300025284 | Bacteria | 210851 |
| 220 | Ga0209130_1000155 | 3300025284 | Bacteria | 102476 |
| 221 | Ga0209130_1000321 | 3300025284 | Bacteria | 56239 |
| 222 | Ga0209130_1001524 | 3300025284 | Bacteria | 14876 |
| 223 | Ga0209675_1000074 | 3300025291 | Bacteria | 162260 |
| 224 | Ga0209675_1000114 | 3300025291 | Bacteria | 112118 |
| 225 | Ga0209675_1000225 | 3300025291 | Bacteria | 57878 |
| 226 | Ga0209675_1008925 | 3300025291 | Bacteria | 3604 |
| 227 | Ga0209675_1037319 | 3300025291 | Bacteria | 1093 |
| 228 | Ga0209676_1000007 | 3300025292 | Bacteria | 1029371 |
| 229 | Ga0209676_1000122 | 3300025292 | Bacteria | 195510 |
| 230 | Ga0209676_1000301 | 3300025292 | Bacteria | 99952 |
| 231 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 232 | Ga0209025_1000248 | 3300025294 | Bacteria | 126818 |
| 233 | Ga0209025_1000491 | 3300025294 | Bacteria | 75913 |
| 234 | Ga0209025_1008800 | 3300025294 | Bacteria | 7179 |
| 235 | Ga0209025_1012900 | 3300025294 | Bacteria | 5310 |
| 236 | Ga0209025_1013011 | 3300025294 | Bacteria | 5267 |
| 237 | Ga0209025_1014941 | 3300025294 | Bacteria | 4728 |
| 238 | Ga0209564_1000358 | 3300025295 | Bacteria | 85036 |
| 239 | Ga0209564_1000360 | 3300025295 | Bacteria | 84454 |
| 240 | Ga0209564_1000603 | 3300025295 | Bacteria | 56168 |
| 241 | Ga0209564_1001768 | 3300025295 | Bacteria | 20112 |
| 242 | Ga0209564_1006761 | 3300025295 | Bacteria | 6082 |
| 243 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 244 | Ga0209758_1006146 | 3300025297 | Bacteria | 8800 |
| 245 | Ga0209758_1031838 | 3300025297 | Bacteria | 2154 |
| 246 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 247 | Ga0209050_1004524 | 3300025298 | Bacteria | 9347 |
| 248 | Ga0209050_1020992 | 3300025298 | Bacteria | 2402 |
| 249 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 250 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 251 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 252 | Ga0209256_1018315 | 3300025299 | Bacteria | 2282 |
| 253 | Ga0209256_1047129 | 3300025299 | Bacteria | 1062 |
| 254 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 255 | Ga0207426_1000025 | 3300025302 | Bacteria | 532921 |
| 256 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 257 | Ga0207426_1003991 | 3300025302 | Bacteria | 7494 |
| 258 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 259 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 260 | Ga0209051_1000605 | 3300025303 | Bacteria | 41859 |
| 261 | Ga0209051_1000907 | 3300025303 | Bacteria | 29475 |
| 262 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 263 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 264 | Ga0209257_1001389 | 3300025304 | Bacteria | 29010 |
| 265 | Ga0209257_1005066 | 3300025304 | Bacteria | 9567 |
| 266 | Ga0209257_1012788 | 3300025304 | Bacteria | 3822 |
| 267 | Ga0207697_10047814 | 3300025315 | Bacteria | 1764 |
| 268 | Ga0207655_1010441 | 3300025728 | Bacteria | 5629 |
| 269 | Ga0207688_10038652 | 3300025901 | Bacteria | 2649 |
| 270 | Ga0207680_10003111 | 3300025903 | Bacteria | 7794 |
| 271 | Ga0207705_10105780 | 3300025909 | Bacteria | 2075 |
| 272 | Ga0207705_10219091 | 3300025909 | Bacteria | 1445 |
| 273 | Ga0207695_10092666 | 3300025913 | Bacteria | 3031 |
| 274 | Ga0207695_10129800 | 3300025913 | Bacteria | 2479 |
| 275 | Ga0207671_10326685 | 3300025914 | Bacteria | 1214 |
| 276 | Ga0207671_10447505 | 3300025914 | Bacteria | 1029 |
| 277 | Ga0207660_10159691 | 3300025917 | Bacteria | 1738 |
| 278 | Ga0207657_10067544 | 3300025919 | Bacteria | 3040 |
| 279 | Ga0207649_10025507 | 3300025920 | Bacteria | 3446 |
| 280 | Ga0207652_10024345 | 3300025921 | Bacteria | 5022 |
| 281 | Ga0207681_10181070 | 3300025923 | Bacteria | 1605 |
| 282 | Ga0207681_10326279 | 3300025923 | Bacteria | 1222 |
| 283 | Ga0207659_10000441 | 3300025926 | Bacteria | 24897 |
| 284 | Ga0207659_10514882 | 3300025926 | Bacteria | 1014 |
| 285 | Ga0207644_10027033 | 3300025931 | Bacteria | 3961 |
| 286 | Ga0207706_10015206 | 3300025933 | Bacteria | 6964 |
| 287 | Ga0207706_10308378 | 3300025933 | Bacteria | 1378 |
| 288 | Ga0207709_10001793 | 3300025935 | Bacteria | 14391 |
| 289 | Ga0207669_10012121 | 3300025937 | Bacteria | 4227 |
| 290 | Ga0207704_10046392 | 3300025938 | Bacteria | 2589 |
| 291 | Ga0207691_10008761 | 3300025940 | Bacteria | 9705 |
| 292 | Ga0207691_10183648 | 3300025940 | Bacteria | 1826 |
| 293 | Ga0207691_10583478 | 3300025940 | Bacteria | 947 |
| 294 | Ga0207711_10011063 | 3300025941 | Bacteria | 7500 |
| 295 | Ga0207711_10550764 | 3300025941 | Bacteria | 1076 |
| 296 | Ga0207711_10611669 | 3300025941 | Bacteria | 1017 |
| 297 | Ga0207689_10075271 | 3300025942 | Bacteria | 2775 |
| 298 | Ga0207667_10022142 | 3300025949 | Bacteria | 7030 |
| 299 | Ga0207651_10007601 | 3300025960 | Bacteria | 5784 |
| 300 | Ga0207651_10300763 | 3300025960 | Bacteria | 1334 |
| 301 | Ga0207640_10252310 | 3300025981 | Bacteria | 1370 |
| 302 | Ga0207658_10058363 | 3300025986 | Bacteria | 2871 |
| 303 | Ga0207658_10060708 | 3300025986 | Bacteria | 2822 |
| 304 | Ga0207658_10482366 | 3300025986 | Bacteria | 1102 |
| 305 | Ga0207677_10000679 | 3300026023 | Bacteria | 20130 |
| 306 | Ga0207703_10001030 | 3300026035 | Bacteria | 26749 |
| 307 | Ga0207639_10089228 | 3300026041 | Bacteria | 2463 |
| 308 | Ga0207639_10168591 | 3300026041 | Bacteria | 1852 |
| 309 | Ga0207708_10154737 | 3300026075 | Bacteria | 1808 |
| 310 | Ga0207702_10636665 | 3300026078 | Bacteria | 1048 |
| 311 | Ga0207648_10025011 | 3300026089 | Bacteria | 5322 |
| 312 | Ga0207648_10053077 | 3300026089 | Bacteria | 3544 |
| 313 | Ga0207676_10000229 | 3300026095 | Bacteria | 48726 |
| 314 | Ga0207674_10856978 | 3300026116 | Bacteria | 876 |
| 315 | Ga0207675_100088642 | 3300026118 | Bacteria | 2907 |
| 316 | Ga0207683_10023200 | 3300026121 | Bacteria | 5333 |
| 317 | Ga0207683_10317661 | 3300026121 | Bacteria | 1426 |
| 318 | Ga0207683_10655236 | 3300026121 | Bacteria | 973 |
| 319 | Ga0207698_10108783 | 3300026142 | Bacteria | 2318 |
| 320 | Ga0207698_10503687 | 3300026142 | Bacteria | 1179 |
| 321 | Ga0209282_1000114 | 3300027666 | Bacteria | 51706 |
| 322 | Ga0209282_1195790 | 3300027666 | Bacteria | 935 |
| 323 | Ga0209813_10068287 | 3300027866 | Bacteria | 1150 |
| 324 | Ga0207428_10569974 | 3300027907 | Bacteria | 818 |
| 325 | Ga0268266_10431527 | 3300028379 | Bacteria | 1250 |
| 326 | Ga0268265_10637837 | 3300028380 | Bacteria | 1022 |
| 327 | Ga0268264_10035668 | 3300028381 | Bacteria | 4095 |
| 328 | Ga0268264_10770368 | 3300028381 | Bacteria | 960 |
| 329 | Ga0307515_10000137 | 3300028794 | Bacteria | 173516 |
| 330 | Ga0316177_1002400 | 3300030731 | Bacteria | 7047 |
| 331 | Ga0316176_1128501 | 3300030732 | Bacteria | 5873 |
| 332 | Ga0314311_1071148 | 3300030733 | Bacteria | 5485 |
| 333 | Ga0316179_1025484 | 3300030734 | Bacteria | 1356 |
| 334 | Ga0316178_1156265 | 3300030735 | Bacteria | 4086 |
| 335 | Ga0316183_1046023 | 3300030742 | Bacteria | 4132 |
| 336 | Ga0316181_1189823 | 3300030744 | Bacteria | 1107 |
| 337 | Ga0316182_1133866 | 3300030745 | Bacteria | 1823 |
| 338 | Ga0316182_1232125 | 3300030745 | Bacteria | 1764 |
| 339 | Ga0265328_10024200 | 3300031239 | Bacteria | 2296 |
| 340 | Ga0307513_10000486 | 3300031456 | Bacteria | 57184 |
| 341 | Ga0307513_10182612 | 3300031456 | Bacteria | 1959 |
| 342 | Ga0307513_10298720 | 3300031456 | Bacteria | 1378 |
| 343 | Ga0307408_100019789 | 3300031548 | Bacteria | 4534 |
| 344 | Ga0307408_100066535 | 3300031548 | Bacteria | 2647 |
| 345 | Ga0307408_100066690 | 3300031548 | Bacteria | 2644 |
| 346 | Ga0307408_100134411 | 3300031548 | Bacteria | 1933 |
| 347 | Ga0307408_100154028 | 3300031548 | Bacteria | 1817 |
| 348 | Ga0265314_10001686 | 3300031711 | Bacteria | 24055 |
| 349 | Ga0307405_10058125 | 3300031731 | Bacteria | 2432 |
| 350 | Ga0307405_10088728 | 3300031731 | Bacteria | 2041 |
| 351 | Ga0307405_10163826 | 3300031731 | Bacteria | 1578 |
| 352 | Ga0307413_10227244 | 3300031824 | Bacteria | 1368 |
| 353 | Ga0307410_10292360 | 3300031852 | Bacteria | 1283 |
| 354 | Ga0307406_10000472 | 3300031901 | Bacteria | 23202 |
| 355 | Ga0307406_10002828 | 3300031901 | Bacteria | 9458 |
| 356 | Ga0307406_10024399 | 3300031901 | Bacteria | 3612 |
| 357 | Ga0307406_10096167 | 3300031901 | Bacteria | 2006 |
| 358 | Ga0307406_10300721 | 3300031901 | Bacteria | 1233 |
| 359 | Ga0307406_10401846 | 3300031901 | Bacteria | 1086 |
| 360 | Ga0307407_10613773 | 3300031903 | Bacteria | 811 |
| 361 | Ga0307412_10072304 | 3300031911 | Bacteria | 2356 |
| 362 | Ga0307412_10093677 | 3300031911 | Bacteria | 2107 |
| 363 | Ga0307412_10221209 | 3300031911 | Bacteria | 1451 |
| 364 | Ga0307412_10956972 | 3300031911 | Bacteria | 754 |
| 365 | Ga0307416_100446914 | 3300032002 | Bacteria | 1344 |
| 366 | Ga0307414_10005033 | 3300032004 | Bacteria | 7238 |
| 367 | Ga0307414_10482077 | 3300032004 | Bacteria | 1094 |
| 368 | Ga0307411_10008361 | 3300032005 | Bacteria | 5354 |
| 369 | Ga0307411_10120110 | 3300032005 | Bacteria | 1899 |
| 370 | Ga0307411_10131201 | 3300032005 | Bacteria | 1832 |
| 371 | Ga0307411_10220623 | 3300032005 | Bacteria | 1471 |
| 372 | Ga0373947_0294808 | 3300035725 | Bacteria | 1080 |
| 373 | Ga0373925_0379145 | 3300037068 | Bacteria | 1151 |
| 374 | Ga0395900_0303793 | 3300037418 | Bacteria | 1581 |
| 375 | Ga0395898_0003968 | 3300037466 | Bacteria | 16291 |
| 376 | Ga0395905_0000180 | 3300037471 | Bacteria | 100693 |
| 377 | Ga0395905_0041095 | 3300037471 | Bacteria | 4339 |
| 378 | Ga0395905_0096760 | 3300037471 | Bacteria | 2771 |
| 379 | Ga0395905_0512419 | 3300037471 | Bacteria | 1100 |
| 380 | Ga0395901_0068022 | 3300038443 | Bacteria | 3710 |
| 381 | Ga0395901_0170687 | 3300038443 | Bacteria | 2282 |
| 382 | Ga0395901_0317819 | 3300038443 | Bacteria | 1611 |
| 383 | Ga0395901_0331416 | 3300038443 | Bacteria | 1573 |
| 384 | Ga0395901_0416513 | 3300038443 | Bacteria | 1378 |
| 385 | Ga0439447_002984 | 3300041407 | Bacteria | 6064 |
| 386 | Ga0439447_052926 | 3300041407 | Bacteria | 966 |
| 387 | Ga0439461_0005148 | 3300041410 | Bacteria | 2217 |
| 388 | Ga0439466_0110151 | 3300041411 | Bacteria | 854 |
| 389 | Ga0439465_0000212 | 3300041413 | Bacteria | 15491 |
| 390 | Ga0451791_0997051 | 3300041451 | Bacteria | 866 |
| 391 | Ga0451795_1633835 | 3300041456 | Bacteria | 854 |
| 392 | Ga0451807_1640364 | 3300041486 | Bacteria | 1144 |
| 393 | Ga0451841_0576698 | 3300041498 | Bacteria | 1186 |
| 394 | Ga0439431_0003405 | 3300041997 | Bacteria | 3499 |
| 395 | Ga0439433_0031582 | 3300041999 | Bacteria | 1212 |
| 396 | Ga0439442_020440 | 3300042002 | Bacteria | 1372 |
| 397 | Ga0439445_0000327 | 3300042004 | Bacteria | 9270 |
| 398 | Ga0439432_002375 | 3300042006 | Bacteria | 7102 |
| 399 | Ga0439432_017821 | 3300042006 | Bacteria | 2380 |
| 400 | Ga0439449_0000783 | 3300042007 | Bacteria | 12258 |
| 401 | Ga0439449_0006225 | 3300042007 | Bacteria | 4560 |
| 402 | Ga0439449_0020305 | 3300042007 | Bacteria | 2489 |
| 403 | Ga0439449_0021978 | 3300042007 | Bacteria | 2388 |
| 404 | Ga0439452_000907 | 3300042010 | Bacteria | 13521 |
| 405 | Ga0439457_027286 | 3300042014 | Bacteria | 1264 |
| 406 | Ga0439462_0004131 | 3300042015 | Bacteria | 3527 |
| 407 | Ga0439462_0004645 | 3300042015 | Bacteria | 3358 |
| 408 | Ga0439462_0035230 | 3300042015 | Bacteria | 1330 |
| 409 | Ga0439462_0056577 | 3300042015 | Bacteria | 1058 |
| 410 | Ga0450911_000717 | 3300042115 | Bacteria | 9642 |
| 411 | Ga0450911_020113 | 3300042115 | Bacteria | 872 |
| 412 | Ga0450920_018960 | 3300042122 | Bacteria | 1319 |
| 413 | Ga0450922_010541 | 3300042124 | Bacteria | 885 |
| 414 | Ga0450890_009450 | 3300042127 | Bacteria | 1249 |
| 415 | Ga0450892_004977 | 3300042130 | Bacteria | 1089 |
| 416 | Ga0450902_013414 | 3300042137 | Bacteria | 1320 |
| 417 | Ga0439446_0001380 | 3300042156 | Bacteria | 5493 |
| 418 | Ga0439446_0019189 | 3300042156 | Bacteria | 1921 |
| 419 | Ga0439458_0059096 | 3300042157 | Bacteria | 955 |
| 420 | Ga0450908_000844 | 3300042184 | Bacteria | 5918 |
| 421 | Ga0450908_020403 | 3300042184 | Bacteria | 1165 |
| 422 | Ga0450909_023898 | 3300042185 | Bacteria | 917 |
| 423 | Ga0439434_0015767 | 3300042435 | Bacteria | 2253 |
| 424 | Ga0439434_0064781 | 3300042435 | Bacteria | 1146 |
| 425 | Ga0439464_0005973 | 3300042439 | Bacteria | 3165 |
| 426 | Ga0450918_000516 | 3300042531 | Bacteria | 8276 |
| 427 | Ga0466969_0267796 | 3300044656 | Bacteria | 774 |
| 428 | Ga0453683_0091795 | 3300044673 | Bacteria | 1903 |
| 429 | Ga0466965_0006533 | 3300044683 | Bacteria | 5305 |
| 430 | Ga0466964_0164530 | 3300044706 | Bacteria | 1040 |
| 431 | Ga0466968_0059784 | 3300044735 | Bacteria | 1642 |
| 432 | Ga0466960_0020091 | 3300044901 | Bacteria | 2954 |
| 433 | Ga0451576_0016029 | 3300045051 | Bacteria | 8281 |
| 434 | Ga0451576_0869427 | 3300045051 | Bacteria | 946 |
| 435 | Ga0495617_004194 | 3300046452 | Bacteria | 5273 |
| 436 | Ga0495617_004883 | 3300046452 | Bacteria | 4822 |
| 437 | Ga0495627_019311 | 3300046453 | Bacteria | 2287 |
| 438 | Ga0495638_0005556 | 3300046460 | Bacteria | 9331 |
| 439 | Ga0495638_0029313 | 3300046460 | Bacteria | 3549 |
| 440 | Ga0495605_0004293 | 3300046474 | Bacteria | 8397 |
| 441 | Ga0495605_0137683 | 3300046474 | Bacteria | 1097 |
| 442 | Ga0495639_0001341 | 3300046475 | Bacteria | 11053 |
| 443 | Ga0495584_0000188 | 3300046491 | Bacteria | 43748 |
| 444 | Ga0495584_0150973 | 3300046491 | Bacteria | 1180 |
| 445 | Ga0495585_0000706 | 3300046492 | Bacteria | 30076 |
| 446 | Ga0495585_0013217 | 3300046492 | Bacteria | 4836 |
| 447 | Ga0495585_0035741 | 3300046492 | Bacteria | 2805 |
| 448 | Ga0495585_0050216 | 3300046492 | Bacteria | 2314 |
| 449 | Ga0495596_0002907 | 3300046500 | Bacteria | 8911 |
| 450 | Ga0495607_0010863 | 3300046501 | Bacteria | 6091 |
| 451 | Ga0495607_0135416 | 3300046501 | Bacteria | 1276 |
| 452 | Ga0495607_0163148 | 3300046501 | Bacteria | 1130 |
| 453 | Ga0495583_0000045 | 3300046506 | Bacteria | 220503 |
| 454 | Ga0495583_0050365 | 3300046506 | Bacteria | 1903 |
| 455 | Ga0495583_0105488 | 3300046506 | Bacteria | 1199 |
| 456 | Ga0495606_0054341 | 3300046507 | Bacteria | 2594 |
| 457 | Ga0495610_0082494 | 3300046512 | Bacteria | 1473 |
| 458 | Ga0495616_0005680 | 3300046513 | Bacteria | 7641 |
| 459 | Ga0495616_0010519 | 3300046513 | Bacteria | 5353 |
| 460 | Ga0495620_0006857 | 3300046515 | Bacteria | 6226 |
| 461 | Ga0495631_0002176 | 3300046518 | Bacteria | 11313 |
| 462 | Ga0495637_0010829 | 3300046520 | Bacteria | 4395 |
| 463 | Ga0495637_0071933 | 3300046520 | Bacteria | 1393 |
| 464 | Ga0495648_0000245 | 3300046524 | Bacteria | 61457 |
| 465 | Ga0495642_0003248 | 3300046528 | Bacteria | 6437 |
| 466 | Ga0495642_0042566 | 3300046528 | Bacteria | 1850 |
| 467 | Ga0495609_0000399 | 3300046538 | Bacteria | 36495 |
| 468 | Ga0495609_0015670 | 3300046538 | Bacteria | 3545 |
| 469 | Ga0495621_0035562 | 3300046539 | Bacteria | 1726 |
| 470 | Ga0495621_0056812 | 3300046539 | Bacteria | 1412 |
| 471 | Ga0495597_0000208 | 3300046542 | Bacteria | 53439 |
| 472 | Ga0495633_0001063 | 3300046558 | Bacteria | 22254 |
| 473 | Ga0495633_0002952 | 3300046558 | Bacteria | 11627 |
| 474 | Ga0495656_0000209 | 3300046615 | Bacteria | 20972 |
| 475 | Ga0495656_0012974 | 3300046615 | Bacteria | 3089 |
| 476 | Ga0495656_0013615 | 3300046615 | Bacteria | 3030 |
| 477 | Ga0495656_0103792 | 3300046615 | Bacteria | 1318 |
| 478 | Ga0495611_0001297 | 3300046648 | Bacteria | 12750 |
| 479 | Ga0495625_0000044 | 3300046660 | Bacteria | 203855 |
| 480 | Ga0495625_0033017 | 3300046660 | Bacteria | 3831 |
| 481 | Ga0495625_0136747 | 3300046660 | Bacteria | 1656 |
| 482 | Ga0495659_0000067 | 3300046664 | Bacteria | 46337 |
| 483 | Ga0495661_0200629 | 3300046665 | Bacteria | 1045 |
| 484 | Ga0495588_0030838 | 3300046674 | Bacteria | 2696 |
| 485 | Ga0495588_0033417 | 3300046674 | Bacteria | 2597 |
| 486 | Ga0495588_0039594 | 3300046674 | Bacteria | 2402 |
| 487 | Ga0495599_0131909 | 3300046678 | Bacteria | 1552 |
| 488 | Ga0495658_0136211 | 3300046683 | Bacteria | 1498 |
| 489 | Ga0495658_0208966 | 3300046683 | Bacteria | 1219 |
| 490 | Ga0495670_0000570 | 3300046691 | Bacteria | 17593 |
| 491 | Ga0495670_0053925 | 3300046691 | Bacteria | 2014 |
| 492 | Ga0495671_0013095 | 3300046692 | Bacteria | 4506 |
| 493 | Ga0495671_0035800 | 3300046692 | Bacteria | 2519 |
| 494 | Ga0495636_0000103 | 3300047318 | Bacteria | 36323 |
| 495 | Ga0495636_0085712 | 3300047318 | Bacteria | 1362 |
| 496 | Ga0495672_0001528 | 3300047320 | Bacteria | 22660 |
| 497 | Ga0495676_0026230 | 3300047321 | Bacteria | 5018 |
| 498 | Ga0495683_0000009 | 3300047323 | Bacteria | 241385 |
| 499 | Ga0495683_0007436 | 3300047323 | Bacteria | 5921 |
| 500 | Ga0495687_000156 | 3300047443 | Bacteria | 103711 |
| 501 | Ga0495677_0007890 | 3300047445 | Bacteria | 3960 |
| 502 | Ga0495685_000022 | 3300047447 | Bacteria | 71800 |
| 503 | Ga0495673_0008233 | 3300047469 | Bacteria | 5886 |
| 504 | Ga0495681_0002250 | 3300047470 | Bacteria | 13882 |
| 505 | Ga0495681_0056166 | 3300047470 | Bacteria | 1833 |
| 506 | Ga0495681_0064453 | 3300047470 | Bacteria | 1678 |
| 507 | Ga0495593_0017861 | 3300047673 | Bacteria | 3994 |
| 508 | Ga0495614_0053657 | 3300048089 | Bacteria | 1728 |
| 509 | Ga0495615_0028986 | 3300048090 | Bacteria | 1310 |
| 510 | Ga0496100_0011371 | 3300048903 | Bacteria | 5065 |
| 511 | Ga0496101_0000958 | 3300048904 | Bacteria | 17056 |
| 512 | Ga0496101_0094303 | 3300048904 | Bacteria | 2230 |
| 513 | Ga0496102_0000310 | 3300048905 | Bacteria | 61386 |
| 514 | Ga0496102_0037849 | 3300048905 | Bacteria | 4352 |
| 515 | Ga0496102_0039527 | 3300048905 | Bacteria | 4263 |
| 516 | Ga0496103_0028934 | 3300048906 | Bacteria | 3366 |
| 517 | Ga0496103_0146266 | 3300048906 | Bacteria | 1513 |
| 518 | Ga0496104_0000688 | 3300048907 | Bacteria | 29108 |
| 519 | Ga0496104_0065997 | 3300048907 | Bacteria | 3436 |
| 520 | Ga0496105_0005944 | 3300048908 | Bacteria | 9312 |
| 521 | Ga0496105_0042329 | 3300048908 | Bacteria | 3754 |
| 522 | Ga0496106_0069570 | 3300048909 | Bacteria | 2687 |
| 523 | Ga0496106_0781967 | 3300048909 | Bacteria | 758 |
| 524 | Ga0496107_0041302 | 3300048910 | Bacteria | 3312 |
| 525 | Ga0496108_0011290 | 3300048911 | Bacteria | 7257 |
| 526 | Ga0496108_0176174 | 3300048911 | Bacteria | 1851 |
| 527 | Ga0496108_0835022 | 3300048911 | Bacteria | 793 |
| 528 | Ga0496109_0040775 | 3300048912 | Bacteria | 4206 |
| 529 | Ga0496109_0405182 | 3300048912 | Bacteria | 1288 |
| 530 | Ga0496110_0031792 | 3300048913 | Bacteria | 4556 |
| 531 | Ga0496110_0097168 | 3300048913 | Bacteria | 2639 |
| 532 | Ga0496110_0255264 | 3300048913 | Bacteria | 1596 |
| 533 | Ga0496111_0029141 | 3300048914 | Bacteria | 3919 |
| 534 | Ga0496114_0021656 | 3300048917 | Bacteria | 5231 |
| 535 | Ga0496114_0393502 | 3300048917 | Bacteria | 1227 |
| 536 | Ga0496116_0021136 | 3300048919 | Bacteria | 4916 |
| 537 | Ga0496116_0181930 | 3300048919 | Bacteria | 1124 |
| 538 | Ga0496117_0018952 | 3300048920 | Bacteria | 5673 |
| 539 | Ga0496117_0063890 | 3300048920 | Bacteria | 2513 |
| 540 | Ga0496118_0049833 | 3300048921 | Bacteria | 3220 |
| 541 | Ga0496118_0069356 | 3300048921 | Bacteria | 2554 |
| 542 | Ga0496121_0014501 | 3300048924 | Bacteria | 8356 |
| 543 | Ga0496121_0015016 | 3300048924 | Bacteria | 8153 |
| 544 | Ga0496121_0045777 | 3300048924 | Bacteria | 3756 |
| 545 | Ga0496121_0176074 | 3300048924 | Bacteria | 1548 |
| 546 | Ga0496122_0000274 | 3300048925 | Bacteria | 115100 |
| 547 | Ga0496122_0062978 | 3300048925 | Bacteria | 2711 |
| 548 | Ga0496123_0003708 | 3300048926 | Bacteria | 16801 |
| 549 | Ga0496123_0052989 | 3300048926 | Bacteria | 2686 |
| 550 | Ga0496124_0024673 | 3300048927 | Bacteria | 5461 |
| 551 | Ga0496124_0101737 | 3300048927 | Bacteria | 2327 |
| 552 | Ga0496124_0154867 | 3300048927 | Bacteria | 1793 |
| 553 | Ga0496124_0384568 | 3300048927 | Bacteria | 980 |
| 554 | Ga0496125_0001879 | 3300048928 | Bacteria | 28856 |
| 555 | Ga0496125_0012614 | 3300048928 | Bacteria | 8371 |
| 556 | Ga0496125_0014401 | 3300048928 | Bacteria | 7704 |
| 557 | Ga0496125_0200416 | 3300048928 | Bacteria | 1307 |
| 558 | Ga0496125_0220837 | 3300048928 | Bacteria | 1221 |
| 559 | Ga0496125_0295147 | 3300048928 | Bacteria | 996 |
| 560 | Ga0496126_0088475 | 3300048929 | Bacteria | 2728 |
| 561 | Ga0496126_0289803 | 3300048929 | Bacteria | 1354 |
| 562 | Ga0501306_013307 | 3300049127 | Bacteria | 1071 |
| 563 | Ga0501306_016403 | 3300049127 | Bacteria | 995 |
| 564 | Ga0501306_036214 | 3300049127 | Bacteria | 751 |
| 565 | Ga0501306_043197 | 3300049127 | Bacteria | 704 |
| 566 | Ga0501308_032375 | 3300049128 | Bacteria | 707 |
| 567 | Ga0501309_012791 | 3300049129 | Bacteria | 1109 |
| 568 | Ga0501310_013154 | 3300049130 | Bacteria | 957 |
| 569 | Ga0501310_021065 | 3300049130 | Bacteria | 814 |
| 570 | Ga0501310_022665 | 3300049130 | Bacteria | 794 |
| 571 | Ga0501310_024663 | 3300049130 | Bacteria | 771 |
| 572 | Ga0501310_036004 | 3300049130 | Bacteria | 674 |
| 573 | Ga0501304_006233 | 3300049160 | Bacteria | 957 |
| 574 | Ga0501304_012655 | 3300049160 | Bacteria | 764 |
| 575 | Ga0501304_016078 | 3300049160 | Bacteria | 706 |
| 576 | Ga0501305_012094 | 3300049161 | Bacteria | 1176 |
| 577 | Ga0501305_025121 | 3300049161 | Bacteria | 901 |
| 578 | Ga0501305_029455 | 3300049161 | Bacteria | 849 |
| 579 | Ga0501305_051535 | 3300049161 | Bacteria | 692 |
| 580 | Ga0501307_022892 | 3300049162 | Bacteria | 824 |
| 581 | Ga0501307_023368 | 3300049162 | Bacteria | 818 |
| 582 | Ga0495678_003755 | 3300049459 | Bacteria | 9170 |
| 583 | Ga0495682_0000461 | 3300049460 | Bacteria | 28071 |
| 584 | Ga0495682_0001710 | 3300049460 | Bacteria | 11145 |
| 585 | Ga0495682_0088374 | 3300049460 | Bacteria | 1113 |
| 586 | Ga0501313_011798 | 3300049529 | Bacteria | 1011 |
| 587 | Ga0501313_027574 | 3300049529 | Bacteria | 726 |
| 588 | Ga0501313_030193 | 3300049529 | Bacteria | 700 |
| 589 | Ga0501314_010850 | 3300049530 | Bacteria | 853 |
| 590 | Ga0501314_016856 | 3300049530 | Bacteria | 732 |
| 591 | Ga0501314_018371 | 3300049530 | Bacteria | 711 |
| 592 | Ga0501315_008623 | 3300049531 | Bacteria | 1189 |
| 593 | Ga0501315_018826 | 3300049531 | Bacteria | 914 |
| 594 | Ga0501315_022229 | 3300049531 | Bacteria | 864 |
| 595 | Ga0501315_031759 | 3300049531 | Bacteria | 764 |
| 596 | Ga0501315_041806 | 3300049531 | Bacteria | 696 |
| 597 | Ga0501316_032066 | 3300049532 | Bacteria | 707 |
| 598 | Ga0501320_013582 | 3300049536 | Bacteria | 871 |
| 599 | Ga0501321_031163 | 3300049537 | Bacteria | 713 |
| 600 | Ga0501322_007675 | 3300049538 | Bacteria | 790 |
| 601 | Ga0501323_008662 | 3300049539 | Bacteria | 1185 |
| 602 | Ga0501323_031098 | 3300049539 | Bacteria | 750 |
| 603 | Ga0501043_0186685 | 3300049579 | Bacteria | 1614 |
| 604 | Ga0501223_027932 | 3300049663 | Bacteria | 1098 |
| 605 | Ga0501249_002689 | 3300049679 | Bacteria | 3583 |
| 606 | Ga0501241_014340 | 3300049758 | Bacteria | 1439 |
| 607 | Ga0501262_000210 | 3300049759 | Bacteria | 7283 |
| 608 | Ga0501044_0785202 | 3300049823 | Bacteria | 832 |
| 609 | Ga0501226_011670 | 3300049853 | Bacteria | 973 |
| 610 | nmdc:mga03683_145917_c1 | 3300050489 | Bacteria | 1066 |
| 611 | nmdc:mga03683_305289_c1 | 3300050489 | Bacteria | 747 |
| 612 | nmdc:mga0k408_116930_c1 | 3300050493 | Bacteria | 1578 |
| 613 | nmdc:mga0k408_12049_c1 | 3300050493 | Bacteria | 4721 |
| 614 | nmdc:mga0k408_50825_c1 | 3300050493 | Bacteria | 2400 |
| 615 | nmdc:mga06z11_11842_c1 | 3300050494 | Bacteria | 3773 |
| 616 | nmdc:mga06z11_95696_c1 | 3300050494 | Bacteria | 1620 |
| 617 | nmdc:mga07m45_115372_c1 | 3300050496 | Bacteria | 1549 |
| 618 | nmdc:mga07m45_12425_c1 | 3300050496 | Bacteria | 4501 |
| 619 | nmdc:mga07m45_167312_c1 | 3300050496 | Bacteria | 1277 |
| 620 | nmdc:mga07m45_22727_c1 | 3300050496 | Bacteria | 3426 |
| 621 | nmdc:mga07m45_34539_c1 | 3300050496 | Bacteria | 2811 |
| 622 | nmdc:mga07m45_386_c1 | 3300050496 | Bacteria | 18107 |
| 623 | nmdc:mga07m45_460279_c1 | 3300050496 | Bacteria | 737 |
| 624 | nmdc:mga07m45_6174_c1 | 3300050496 | Bacteria | 6042 |
| 625 | nmdc:mga09592_135046_c1 | 3300050508 | Bacteria | 2124 |
| 626 | Ga0500643_013156 | 3300053087 | Bacteria | 2934 |
| 627 | Ga0500644_0016808 | 3300053088 | Bacteria | 2111 |
| 628 | Ga0500651_0000063 | 3300053093 | Bacteria | 70772 |
| 629 | Ga0500566_0095922 | 3300053094 | Bacteria | 1633 |
| 630 | Ga0500641_0095174 | 3300053096 | Bacteria | 1274 |
| 631 | Ga0500562_002124 | 3300053108 | Bacteria | 4955 |
| 632 | Ga0500571_006776 | 3300053110 | Bacteria | 6206 |
| 633 | Ga0500593_000829 | 3300053117 | Bacteria | 11563 |
| 634 | Ga0500594_0002456 | 3300053118 | Bacteria | 4033 |
| 635 | Ga0500597_039379 | 3300053120 | Bacteria | 1981 |
| 636 | Ga0500607_001609 | 3300053121 | Bacteria | 19935 |
| 637 | Ga0500607_048234 | 3300053121 | Bacteria | 2278 |
| 638 | Ga0500608_052273 | 3300053122 | Bacteria | 1962 |
| 639 | Ga0500655_003141 | 3300053133 | Bacteria | 2994 |
| 640 | Ga0500658_0000481 | 3300053134 | Bacteria | 17081 |
| 641 | Ga0500658_0000709 | 3300053134 | Bacteria | 13770 |
| 642 | Ga0500559_0003620 | 3300053136 | Bacteria | 7556 |
| 643 | Ga0500568_0003586 | 3300053139 | Bacteria | 8572 |
| 644 | Ga0500616_0241801 | 3300053153 | Bacteria | 775 |
| 645 | Ga0500624_041586 | 3300053157 | Bacteria | 828 |
| 646 | Ga0500627_0003521 | 3300053158 | Bacteria | 4856 |
| 647 | Ga0500633_0159070 | 3300053160 | Bacteria | 847 |
| 648 | Ga0500634_0008688 | 3300053161 | Bacteria | 5091 |
| 649 | Ga0500634_0018086 | 3300053161 | Bacteria | 3782 |
| 650 | Ga0500638_043069 | 3300053162 | Bacteria | 2192 |
| 651 | Ga0500625_028720 | 3300053729 | Bacteria | 2640 |
| 652 | Ga0500645_000059 | 3300053730 | Bacteria | 91141 |
| 653 | Ga0500645_002200 | 3300053730 | Bacteria | 8917 |
| 654 | Ga0590075_013138 | 3300059424 | Bacteria | 2014 |
| 655 | Ga0587084_024870 | 3300059477 | Bacteria | 925 |
| 656 | Ga0587084_053397 | 3300059477 | Bacteria | 721 |
| 657 | Ga0587111_0105279 | 3300060346 | Bacteria | 708 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046474 | Ga0495605_0137683 | Ga0495605_0137683_11_658 | 198 |
| 2 | 3300005539 | Ga0068853_100302366 | Ga0068853_1003023662 | 206 |
| 3 | 3300026116 | Ga0207674_10856978 | Ga0207674_108569781 | 206 |
| 4 | 3300005445 | Ga0070708_100703966 | Ga0070708_1007039662 | 207 |
| 5 | 3300005471 | Ga0070698_100755748 | Ga0070698_1007557481 | 207 |
| 6 | 3300006058 | Ga0075432_10085254 | Ga0075432_100852542 | 207 |
| 7 | 3300013306 | Ga0163162_10280428 | Ga0163162_102804282 | 207 |
| 8 | 3300026121 | Ga0207683_10655236 | Ga0207683_106552361 | 207 |
| 9 | 3300046520 | Ga0495637_0010829 | Ga0495637_0010829_1520_2143 | 207 |
| 10 | 3300046528 | Ga0495642_0003248 | Ga0495642_0003248_1900_2523 | 207 |
| 11 | 3300047470 | Ga0495681_0002250 | Ga0495681_0002250_1548_2171 | 207 |
| 12 | 3300031456 | Ga0307513_10182612 | Ga0307513_101826122 | 208 |
| 13 | 3300005459 | Ga0068867_100072252 | Ga0068867_1000722523 | 210 |
| 14 | 3300006237 | Ga0097621_100504052 | Ga0097621_1005040521 | 210 |
| 15 | 3300025294 | Ga0209025_1012900 | Ga0209025_10129006 | 210 |
| 16 | 3300049130 | Ga0501310_022665 | Ga0501310_022665_26_661 | 210 |
| 17 | 3300049161 | Ga0501305_025121 | Ga0501305_025121_241_876 | 210 |
| 18 | 3300049162 | Ga0501307_022892 | Ga0501307_022892_19_654 | 210 |
| 19 | 3300049529 | Ga0501313_027574 | Ga0501313_027574_26_661 | 210 |
| 20 | 3300049531 | Ga0501315_008623 | Ga0501315_008623_529_1164 | 210 |
| 21 | 3300049536 | Ga0501320_013582 | Ga0501320_013582_26_661 | 210 |
| 22 | iso_pu_bacteria | 2547132374 | 2548498779 | 210 |
| 23 | iso_pu_bacteria | 2643221570 | 2643866675 | 210 |
| 24 | iso_pu_bacteria | 2643221596 | 2643991348 | 210 |
| 25 | iso_pu_bacteria | 2643221652 | 2644296273 | 210 |
| 26 | iso_pu_bacteria | 2643221717 | 2644647779 | 210 |
| 27 | iso_pu_bacteria | 2894023352 | 2894025216 | 210 |
| 28 | iso_pu_bacteria | 2990710928 | 2990712138 | 210 |
| 29 | 3300042007 | Ga0439449_0020305 | Ga0439449_0020305_1311_1952 | 211 |
| 30 | 3300042014 | Ga0439457_027286 | Ga0439457_027286_424_1065 | 211 |
| 31 | 3300042015 | Ga0439462_0004131 | Ga0439462_0004131_1141_1782 | 211 |
| 32 | 3300042185 | Ga0450909_023898 | Ga0450909_023898_108_749 | 211 |
| 33 | iso_pu_bacteria | 2513020051 | 2513227125 | 211 |
| 34 | iso_pu_bacteria | 2599185214 | 2599623652 | 211 |
| 35 | iso_pu_bacteria | 2599185226 | 2599671729 | 211 |
| 36 | iso_pu_bacteria | 2599185227 | 2599681258 | 211 |
| 37 | iso_pu_bacteria | 2599185229 | 2599693339 | 211 |
| 38 | iso_pu_bacteria | 2643221628 | 2644163223 | 211 |
| 39 | iso_pu_bacteria | 2643221658 | 2644327613 | 211 |
| 40 | iso_pu_bacteria | 2643221672 | 2644401483 | 211 |
| 41 | iso_pu_bacteria | 2643221683 | 2644468158 | 211 |
| 42 | iso_pu_bacteria | 2738541277 | 2738717722 | 211 |
| 43 | iso_pu_bacteria | 2738543019 | 2739278408 | 211 |
| 44 | iso_pu_bacteria | 2739367655 | 2739612388 | 211 |
| 45 | iso_pu_bacteria | 2831265667 | 2831266331 | 211 |
| 46 | iso_pu_bacteria | 2838054893 | 2838057557 | 211 |
| 47 | iso_pu_bacteria | 2842677519 | 2842679668 | 211 |
| 48 | iso_pu_bacteria | 2842733646 | 2842735038 | 211 |
| 49 | iso_pu_bacteria | 2881927736 | 2881930791 | 211 |
| 50 | iso_pu_bacteria | 2885198086 | 2885204454 | 211 |
| 51 | iso_pu_bacteria | 2885211737 | 2885218107 | 211 |
| 52 | iso_pu_bacteria | 2887375801 | 2887378458 | 211 |
| 53 | iso_pu_bacteria | 2904449895 | 2904455771 | 211 |
| 54 | iso_pu_bacteria | 2904456579 | 2904457798 | 211 |
| 55 | iso_pu_bacteria | 2904541872 | 2904548162 | 211 |
| 56 | iso_pu_bacteria | 2919462493 | 2919467241 | 211 |
| 57 | iso_pu_bacteria | 2928070936 | 2928071729 | 211 |
| 58 | iso_pu_bacteria | 2928084124 | 2928084326 | 211 |
| 59 | iso_pu_bacteria | 2929160207 | 2929163091 | 211 |
| 60 | iso_pu_bacteria | 2929520902 | 2929522754 | 211 |
| 61 | iso_pu_bacteria | 2945945610 | 2945947700 | 211 |
| 62 | iso_pu_bacteria | 2954767861 | 2954772460 | 211 |
| 63 | 3300049127 | Ga0501306_043197 | Ga0501306_043197_31_672 | 212 |
| 64 | 3300049537 | Ga0501321_031163 | Ga0501321_031163_48_689 | 212 |
| 65 | 3300031731 | Ga0307405_10088728 | Ga0307405_100887282 | 213 |
| 66 | 3300031901 | Ga0307406_10401846 | Ga0307406_104018462 | 213 |
| 67 | 3300042115 | Ga0450911_000717 | Ga0450911_000717_4450_5094 | 213 |
| 68 | 3300042137 | Ga0450902_013414 | Ga0450902_013414_82_726 | 213 |
| 69 | 3300048924 | Ga0496121_0015016 | Ga0496121_0015016_3493_4137 | 213 |
| 70 | 3300048928 | Ga0496125_0001879 | Ga0496125_0001879_25615_26259 | 213 |
| 71 | 3300048928 | Ga0496125_0200416 | Ga0496125_0200416_235_879 | 213 |
| 72 | 3300048929 | Ga0496126_0289803 | Ga0496126_0289803_221_865 | 213 |
| 73 | 3300049539 | Ga0501323_008662 | Ga0501323_008662_26_733 | 213 |
| 74 | 3300059424 | Ga0590075_013138 | Ga0590075_013138_547_1191 | 213 |
| 75 | 3300003577 | Ga0007416J51690_1059848 | Ga0007416J51690_10598481 | 214 |
| 76 | 3300005288 | Ga0065714_10105205 | Ga0065714_101052051 | 214 |
| 77 | 3300005293 | Ga0065715_10007212 | Ga0065715_100072124 | 214 |
| 78 | 3300025901 | Ga0207688_10038652 | Ga0207688_100386523 | 214 |
| 79 | 3300031456 | Ga0307513_10298720 | Ga0307513_102987202 | 214 |
| 80 | 3300031548 | Ga0307408_100066535 | Ga0307408_1000665351 | 214 |
| 81 | 3300031901 | Ga0307406_10002828 | Ga0307406_100028283 | 214 |
| 82 | 3300041456 | Ga0451795_1633835 | Ga0451795_1633835_33_680 | 214 |
| 83 | 3300046452 | Ga0495617_004194 | Ga0495617_004194_3818_4465 | 214 |
| 84 | 3300046452 | Ga0495617_004883 | Ga0495617_004883_3127_3774 | 214 |
| 85 | 3300046460 | Ga0495638_0005556 | Ga0495638_0005556_1824_2471 | 214 |
| 86 | 3300046474 | Ga0495605_0004293 | Ga0495605_0004293_5797_6444 | 214 |
| 87 | 3300046491 | Ga0495584_0000188 | Ga0495584_0000188_23036_23683 | 214 |
| 88 | 3300046491 | Ga0495584_0150973 | Ga0495584_0150973_256_903 | 214 |
| 89 | 3300046492 | Ga0495585_0000706 | Ga0495585_0000706_16508_17155 | 214 |
| 90 | 3300046492 | Ga0495585_0013217 | Ga0495585_0013217_3484_4131 | 214 |
| 91 | 3300046492 | Ga0495585_0035741 | Ga0495585_0035741_127_774 | 214 |
| 92 | 3300046492 | Ga0495585_0050216 | Ga0495585_0050216_1217_1864 | 214 |
| 93 | 3300046500 | Ga0495596_0002907 | Ga0495596_0002907_7276_7923 | 214 |
| 94 | 3300046501 | Ga0495607_0010863 | Ga0495607_0010863_3098_3745 | 214 |
| 95 | 3300046501 | Ga0495607_0135416 | Ga0495607_0135416_550_1197 | 214 |
| 96 | 3300046501 | Ga0495607_0163148 | Ga0495607_0163148_131_778 | 214 |
| 97 | 3300046506 | Ga0495583_0000045 | Ga0495583_0000045_76301_76948 | 214 |
| 98 | 3300046506 | Ga0495583_0050365 | Ga0495583_0050365_1120_1767 | 214 |
| 99 | 3300046507 | Ga0495606_0054341 | Ga0495606_0054341_952_1599 | 214 |
| 100 | 3300046513 | Ga0495616_0010519 | Ga0495616_0010519_4170_4817 | 214 |
| 101 | 3300046515 | Ga0495620_0006857 | Ga0495620_0006857_189_836 | 214 |
| 102 | 3300046524 | Ga0495648_0000245 | Ga0495648_0000245_8676_9323 | 214 |
| 103 | 3300046528 | Ga0495642_0042566 | Ga0495642_0042566_670_1317 | 214 |
| 104 | 3300046538 | Ga0495609_0000399 | Ga0495609_0000399_27491_28138 | 214 |
| 105 | 3300046538 | Ga0495609_0015670 | Ga0495609_0015670_1348_1995 | 214 |
| 106 | 3300046542 | Ga0495597_0000208 | Ga0495597_0000208_9231_9878 | 214 |
| 107 | 3300046558 | Ga0495633_0001063 | Ga0495633_0001063_18225_18872 | 214 |
| 108 | 3300046558 | Ga0495633_0002952 | Ga0495633_0002952_7432_8079 | 214 |
| 109 | 3300046615 | Ga0495656_0013615 | Ga0495656_0013615_2223_2870 | 214 |
| 110 | 3300046615 | Ga0495656_0103792 | Ga0495656_0103792_16_663 | 214 |
| 111 | 3300046648 | Ga0495611_0001297 | Ga0495611_0001297_1374_2021 | 214 |
| 112 | 3300046664 | Ga0495659_0000067 | Ga0495659_0000067_41330_41977 | 214 |
| 113 | 3300046665 | Ga0495661_0200629 | Ga0495661_0200629_37_684 | 214 |
| 114 | 3300046691 | Ga0495670_0000570 | Ga0495670_0000570_2523_3170 | 214 |
| 115 | 3300046692 | Ga0495671_0035800 | Ga0495671_0035800_1210_1857 | 214 |
| 116 | 3300047318 | Ga0495636_0000103 | Ga0495636_0000103_5194_5841 | 214 |
| 117 | 3300047318 | Ga0495636_0085712 | Ga0495636_0085712_226_873 | 214 |
| 118 | 3300047320 | Ga0495672_0001528 | Ga0495672_0001528_7556_8203 | 214 |
| 119 | 3300047323 | Ga0495683_0000009 | Ga0495683_0000009_89148_89795 | 214 |
| 120 | 3300047323 | Ga0495683_0007436 | Ga0495683_0007436_4662_5309 | 214 |
| 121 | 3300047443 | Ga0495687_000156 | Ga0495687_000156_55160_55807 | 214 |
| 122 | 3300047445 | Ga0495677_0007890 | Ga0495677_0007890_1657_2304 | 214 |
| 123 | 3300047447 | Ga0495685_000022 | Ga0495685_000022_52748_53395 | 214 |
| 124 | 3300047469 | Ga0495673_0008233 | Ga0495673_0008233_1567_2214 | 214 |
| 125 | 3300047470 | Ga0495681_0056166 | Ga0495681_0056166_475_1122 | 214 |
| 126 | 3300047470 | Ga0495681_0064453 | Ga0495681_0064453_628_1275 | 214 |
| 127 | 3300048090 | Ga0495615_0028986 | Ga0495615_0028986_631_1278 | 214 |
| 128 | 3300048905 | Ga0496102_0039527 | Ga0496102_0039527_1867_2514 | 214 |
| 129 | 3300048906 | Ga0496103_0146266 | Ga0496103_0146266_223_870 | 214 |
| 130 | 3300048909 | Ga0496106_0781967 | Ga0496106_0781967_77_724 | 214 |
| 131 | 3300048925 | Ga0496122_0000274 | Ga0496122_0000274_14841_15485 | 214 |
| 132 | 3300048926 | Ga0496123_0003708 | Ga0496123_0003708_9905_10549 | 214 |
| 133 | 3300048927 | Ga0496124_0154867 | Ga0496124_0154867_680_1324 | 214 |
| 134 | 3300049459 | Ga0495678_003755 | Ga0495678_003755_1828_2475 | 214 |
| 135 | 3300049460 | Ga0495682_0000461 | Ga0495682_0000461_19061_19708 | 214 |
| 136 | 3300049460 | Ga0495682_0001710 | Ga0495682_0001710_2920_3567 | 214 |
| 137 | 3300049460 | Ga0495682_0088374 | Ga0495682_0088374_454_1101 | 214 |
| 138 | 3300049529 | Ga0501313_011798 | Ga0501313_011798_10_657 | 214 |
| 139 | 3300053088 | Ga0500644_0016808 | Ga0500644_0016808_560_1210 | 214 |
| 140 | 3300003187 | JGI25151J46595_10001260 | JGI25151J46595_100012605 | 215 |
| 141 | 3300003187 | JGI25151J46595_10007367 | JGI25151J46595_100073676 | 215 |
| 142 | 3300003305 | Ga0006770J48903_1041039 | Ga0006770J48903_10410391 | 215 |
| 143 | 3300003308 | Ga0006777J48905_1077401 | Ga0006777J48905_10774011 | 215 |
| 144 | 3300003577 | Ga0007416J51690_1036082 | Ga0007416J51690_10360821 | 215 |
| 145 | 3300003577 | Ga0007416J51690_1045190 | Ga0007416J51690_10451901 | 215 |
| 146 | 3300003579 | Ga0007429J51699_1020602 | Ga0007429J51699_10206021 | 215 |
| 147 | 3300003761 | Ga0055535_1000330 | Ga0055535_100033030 | 215 |
| 148 | 3300003762 | Ga0055542_1000039 | Ga0055542_100003966 | 215 |
| 149 | 3300003773 | Ga0055537_1000285 | Ga0055537_100028527 | 215 |
| 150 | 3300003773 | Ga0055537_1000373 | Ga0055537_10003738 | 215 |
| 151 | 3300003773 | Ga0055537_1011479 | Ga0055537_10114792 | 215 |
| 152 | 3300003781 | Ga0055536_1001531 | Ga0055536_10015313 | 215 |
| 153 | 3300003781 | Ga0055536_1004149 | Ga0055536_10041496 | 215 |
| 154 | 3300003784 | Ga0055534_1000018 | Ga0055534_1000018103 | 215 |
| 155 | 3300003790 | Ga0055528_1000401 | Ga0055528_100040113 | 215 |
| 156 | 3300003790 | Ga0055528_1024650 | Ga0055528_10246502 | 215 |
| 157 | 3300003790 | Ga0055528_1025740 | Ga0055528_10257402 | 215 |
| 158 | 3300003791 | Ga0055530_10015125 | Ga0055530_100151253 | 215 |
| 159 | 3300003792 | Ga0055540_1000788 | Ga0055540_100078823 | 215 |
| 160 | 3300003792 | Ga0055540_1001180 | Ga0055540_100118013 | 215 |
| 161 | 3300003792 | Ga0055540_1008068 | Ga0055540_10080683 | 215 |
| 162 | 3300004625 | Ga0055543_1004921 | Ga0055543_10049214 | 215 |
| 163 | 3300005288 | Ga0065714_10015276 | Ga0065714_100152763 | 215 |
| 164 | 3300005289 | Ga0065704_10074000 | Ga0065704_100740004 | 215 |
| 165 | 3300005293 | Ga0065715_10114105 | Ga0065715_101141052 | 215 |
| 166 | 3300005327 | Ga0070658_10084151 | Ga0070658_100841512 | 215 |
| 167 | 3300005327 | Ga0070658_10182318 | Ga0070658_101823182 | 215 |
| 168 | 3300005327 | Ga0070658_10277299 | Ga0070658_102772992 | 215 |
| 169 | 3300005328 | Ga0070676_10024726 | Ga0070676_100247266 | 215 |
| 170 | 3300005330 | Ga0070690_100003807 | Ga0070690_1000038074 | 215 |
| 171 | 3300005334 | Ga0068869_100045046 | Ga0068869_1000450461 | 215 |
| 172 | 3300005335 | Ga0070666_10006291 | Ga0070666_100062916 | 215 |
| 173 | 3300005335 | Ga0070666_10093364 | Ga0070666_100933642 | 215 |
| 174 | 3300005336 | Ga0070680_100341375 | Ga0070680_1003413752 | 215 |
| 175 | 3300005338 | Ga0068868_100017362 | Ga0068868_1000173623 | 215 |
| 176 | 3300005339 | Ga0070660_100090762 | Ga0070660_1000907622 | 215 |
| 177 | 3300005347 | Ga0070668_100133658 | Ga0070668_1001336582 | 215 |
| 178 | 3300005347 | Ga0070668_100276798 | Ga0070668_1002767981 | 215 |
| 179 | 3300005353 | Ga0070669_100019979 | Ga0070669_1000199793 | 215 |
| 180 | 3300005353 | Ga0070669_100836294 | Ga0070669_1008362941 | 215 |
| 181 | 3300005354 | Ga0070675_100001058 | Ga0070675_1000010583 | 215 |
| 182 | 3300005354 | Ga0070675_100184884 | Ga0070675_1001848842 | 215 |
| 183 | 3300005355 | Ga0070671_100020705 | Ga0070671_1000207053 | 215 |
| 184 | 3300005355 | Ga0070671_100356188 | Ga0070671_1003561881 | 215 |
| 185 | 3300005356 | Ga0070674_100311307 | Ga0070674_1003113072 | 215 |
| 186 | 3300005364 | Ga0070673_100029058 | Ga0070673_1000290583 | 215 |
| 187 | 3300005365 | Ga0070688_100025823 | Ga0070688_1000258232 | 215 |
| 188 | 3300005366 | Ga0070659_100863503 | Ga0070659_1008635031 | 215 |
| 189 | 3300005367 | Ga0070667_100048932 | Ga0070667_1000489322 | 215 |
| 190 | 3300005455 | Ga0070663_100233939 | Ga0070663_1002339391 | 215 |
| 191 | 3300005456 | Ga0070678_100012066 | Ga0070678_1000120664 | 215 |
| 192 | 3300005456 | Ga0070678_100170557 | Ga0070678_1001705572 | 215 |
| 193 | 3300005457 | Ga0070662_100004214 | Ga0070662_1000042148 | 215 |
| 194 | 3300005457 | Ga0070662_100247499 | Ga0070662_1002474992 | 215 |
| 195 | 3300005457 | Ga0070662_100723715 | Ga0070662_1007237151 | 215 |
| 196 | 3300005459 | Ga0068867_100055819 | Ga0068867_1000558193 | 215 |
| 197 | 3300005530 | Ga0070679_100103958 | Ga0070679_1001039582 | 215 |
| 198 | 3300005530 | Ga0070679_100113030 | Ga0070679_1001130302 | 215 |
| 199 | 3300005539 | Ga0068853_100051727 | Ga0068853_1000517272 | 215 |
| 200 | 3300005539 | Ga0068853_100365169 | Ga0068853_1003651692 | 215 |
| 201 | 3300005543 | Ga0070672_100124366 | Ga0070672_1001243662 | 215 |
| 202 | 3300005543 | Ga0070672_100258777 | Ga0070672_1002587772 | 215 |
| 203 | 3300005548 | Ga0070665_100187817 | Ga0070665_1001878172 | 215 |
| 204 | 3300005548 | Ga0070665_100610418 | Ga0070665_1006104182 | 215 |
| 205 | 3300005563 | Ga0068855_100016751 | Ga0068855_1000167517 | 215 |
| 206 | 3300005563 | Ga0068855_100281364 | Ga0068855_1002813641 | 215 |
| 207 | 3300005564 | Ga0070664_100041366 | Ga0070664_1000413663 | 215 |
| 208 | 3300005614 | Ga0068856_100337264 | Ga0068856_1003372642 | 215 |
| 209 | 3300005616 | Ga0068852_100520334 | Ga0068852_1005203342 | 215 |
| 210 | 3300005617 | Ga0068859_100022769 | Ga0068859_1000227693 | 215 |
| 211 | 3300005618 | Ga0068864_100000212 | Ga0068864_1000002127 | 215 |
| 212 | 3300005718 | Ga0068866_10024083 | Ga0068866_100240832 | 215 |
| 213 | 3300005719 | Ga0068861_100284798 | Ga0068861_1002847982 | 215 |
| 214 | 3300005841 | Ga0068863_100001367 | Ga0068863_1000013671 | 215 |
| 215 | 3300005841 | Ga0068863_100775827 | Ga0068863_1007758272 | 215 |
| 216 | 3300005842 | Ga0068858_100002207 | Ga0068858_10000220722 | 215 |
| 217 | 3300005843 | Ga0068860_100059901 | Ga0068860_1000599012 | 215 |
| 218 | 3300005844 | Ga0068862_100220132 | Ga0068862_1002201322 | 215 |
| 219 | 3300005844 | Ga0068862_100295282 | Ga0068862_1002952822 | 215 |
| 220 | 3300006038 | Ga0075365_10008170 | Ga0075365_100081706 | 215 |
| 221 | 3300006048 | Ga0075363_100019632 | Ga0075363_1000196321 | 215 |
| 222 | 3300006048 | Ga0075363_100171268 | Ga0075363_1001712682 | 215 |
| 223 | 3300006051 | Ga0075364_10026087 | Ga0075364_100260875 | 215 |
| 224 | 3300006058 | Ga0075432_10030376 | Ga0075432_100303762 | 215 |
| 225 | 3300006177 | Ga0075362_10031575 | Ga0075362_100315752 | 215 |
| 226 | 3300006177 | Ga0075362_10042960 | Ga0075362_100429603 | 215 |
| 227 | 3300006178 | Ga0075367_10058598 | Ga0075367_100585983 | 215 |
| 228 | 3300006195 | Ga0075366_10009650 | Ga0075366_100096507 | 215 |
| 229 | 3300006195 | Ga0075366_10115852 | Ga0075366_101158522 | 215 |
| 230 | 3300006237 | Ga0097621_100007144 | Ga0097621_1000071443 | 215 |
| 231 | 3300006237 | Ga0097621_100072548 | Ga0097621_1000725482 | 215 |
| 232 | 3300006237 | Ga0097621_100073271 | Ga0097621_1000732712 | 215 |
| 233 | 3300006353 | Ga0075370_10005901 | Ga0075370_100059011 | 215 |
| 234 | 3300006353 | Ga0075370_10009692 | Ga0075370_100096925 | 215 |
| 235 | 3300006353 | Ga0075370_10010505 | Ga0075370_100105056 | 215 |
| 236 | 3300006353 | Ga0075370_10046297 | Ga0075370_100462972 | 215 |
| 237 | 3300006353 | Ga0075370_10342967 | Ga0075370_103429671 | 215 |
| 238 | 3300006358 | Ga0068871_100016987 | Ga0068871_1000169873 | 215 |
| 239 | 3300006358 | Ga0068871_100308343 | Ga0068871_1003083432 | 215 |
| 240 | 3300006880 | Ga0075429_100478710 | Ga0075429_1004787101 | 215 |
| 241 | 3300006881 | Ga0068865_100030894 | Ga0068865_1000308944 | 215 |
| 242 | 3300006931 | Ga0097620_100022770 | Ga0097620_1000227703 | 215 |
| 243 | 3300006948 | Ga0099826_10000116 | Ga0099826_1000011624 | 215 |
| 244 | 3300006948 | Ga0099826_10217346 | Ga0099826_102173462 | 215 |
| 245 | 3300009036 | Ga0105244_10006285 | Ga0105244_100062856 | 215 |
| 246 | 3300009093 | Ga0105240_10134415 | Ga0105240_101344152 | 215 |
| 247 | 3300009148 | Ga0105243_10014281 | Ga0105243_100142814 | 215 |
| 248 | 3300009148 | Ga0105243_10387527 | Ga0105243_103875272 | 215 |
| 249 | 3300009174 | Ga0105241_10275970 | Ga0105241_102759702 | 215 |
| 250 | 3300009176 | Ga0105242_10344667 | Ga0105242_103446672 | 215 |
| 251 | 3300009177 | Ga0105248_10024395 | Ga0105248_100243956 | 215 |
| 252 | 3300009177 | Ga0105248_10891850 | Ga0105248_108918501 | 215 |
| 253 | 3300009545 | Ga0105237_10122282 | Ga0105237_101222823 | 215 |
| 254 | 3300009545 | Ga0105237_10332011 | Ga0105237_103320112 | 215 |
| 255 | 3300010375 | Ga0105239_10206651 | Ga0105239_102066512 | 215 |
| 256 | 3300011119 | Ga0105246_10089496 | Ga0105246_100894963 | 215 |
| 257 | 3300011119 | Ga0105246_10097776 | Ga0105246_100977762 | 215 |
| 258 | 3300013100 | Ga0157373_10079660 | Ga0157373_100796602 | 215 |
| 259 | 3300013105 | Ga0157369_10034980 | Ga0157369_100349807 | 215 |
| 260 | 3300013296 | Ga0157374_10055118 | Ga0157374_100551184 | 215 |
| 261 | 3300013297 | Ga0157378_10168337 | Ga0157378_101683372 | 215 |
| 262 | 3300013306 | Ga0163162_10019158 | Ga0163162_100191583 | 215 |
| 263 | 3300013306 | Ga0163162_10110726 | Ga0163162_101107262 | 215 |
| 264 | 3300013306 | Ga0163162_10700381 | Ga0163162_107003812 | 215 |
| 265 | 3300013308 | Ga0157375_10024781 | Ga0157375_100247814 | 215 |
| 266 | 3300013308 | Ga0157375_10092116 | Ga0157375_100921161 | 215 |
| 267 | 3300013308 | Ga0157375_10415970 | Ga0157375_104159702 | 215 |
| 268 | 3300014325 | Ga0163163_10027074 | Ga0163163_100270743 | 215 |
| 269 | 3300014326 | Ga0157380_10226896 | Ga0157380_102268962 | 215 |
| 270 | 3300014497 | Ga0182008_10000190 | Ga0182008_1000019027 | 215 |
| 271 | 3300014497 | Ga0182008_10001821 | Ga0182008_100018214 | 215 |
| 272 | 3300014497 | Ga0182008_10101753 | Ga0182008_101017532 | 215 |
| 273 | 3300014968 | Ga0157379_10019567 | Ga0157379_100195675 | 215 |
| 274 | 3300014969 | Ga0157376_10043764 | Ga0157376_100437642 | 215 |
| 275 | 3300014969 | Ga0157376_10054969 | Ga0157376_100549693 | 215 |
| 276 | 3300014969 | Ga0157376_10547501 | Ga0157376_105475012 | 215 |
| 277 | 3300015261 | Ga0182006_1001217 | Ga0182006_100121714 | 215 |
| 278 | 3300015262 | Ga0182007_10001403 | Ga0182007_100014038 | 215 |
| 279 | 3300015262 | Ga0182007_10059013 | Ga0182007_100590131 | 215 |
| 280 | 3300017792 | Ga0163161_10000092 | Ga0163161_1000009270 | 215 |
| 281 | 3300017792 | Ga0163161_10003072 | Ga0163161_100030723 | 215 |
| 282 | 3300017792 | Ga0163161_10021484 | Ga0163161_100214843 | 215 |
| 283 | 3300017792 | Ga0163161_10038890 | Ga0163161_100388902 | 215 |
| 284 | 3300017792 | Ga0163161_10169556 | Ga0163161_101695562 | 215 |
| 285 | 3300020078 | Ga0206352_11194471 | Ga0206352_111944711 | 215 |
| 286 | 3300025228 | Ga0209672_100647 | Ga0209672_1006472 | 215 |
| 287 | 3300025229 | Ga0209147_101107 | Ga0209147_1011072 | 215 |
| 288 | 3300025242 | Ga0209258_100099 | Ga0209258_100099147 | 215 |
| 289 | 3300025245 | Ga0207425_1000799 | Ga0207425_100079912 | 215 |
| 290 | 3300025254 | Ga0209148_1000103 | Ga0209148_1000103147 | 215 |
| 291 | 3300025258 | Ga0209129_1000007 | Ga0209129_1000007449 | 215 |
| 292 | 3300025258 | Ga0209129_1001701 | Ga0209129_10017019 | 215 |
| 293 | 3300025263 | Ga0209565_1000075 | Ga0209565_100007553 | 215 |
| 294 | 3300025263 | Ga0209565_1000199 | Ga0209565_100019925 | 215 |
| 295 | 3300025263 | Ga0209565_1002461 | Ga0209565_10024615 | 215 |
| 296 | 3300025273 | Ga0209673_1000128 | Ga0209673_1000128109 | 215 |
| 297 | 3300025273 | Ga0209673_1000289 | Ga0209673_100028930 | 215 |
| 298 | 3300025273 | Ga0209673_1001078 | Ga0209673_100107825 | 215 |
| 299 | 3300025273 | Ga0209673_1004719 | Ga0209673_10047198 | 215 |
| 300 | 3300025284 | Ga0209130_1000321 | Ga0209130_10003218 | 215 |
| 301 | 3300025284 | Ga0209130_1001524 | Ga0209130_100152413 | 215 |
| 302 | 3300025291 | Ga0209675_1000074 | Ga0209675_100007453 | 215 |
| 303 | 3300025291 | Ga0209675_1000114 | Ga0209675_10001147 | 215 |
| 304 | 3300025291 | Ga0209675_1037319 | Ga0209675_10373192 | 215 |
| 305 | 3300025292 | Ga0209676_1000122 | Ga0209676_100012269 | 215 |
| 306 | 3300025292 | Ga0209676_1000301 | Ga0209676_100030143 | 215 |
| 307 | 3300025294 | Ga0209025_1000073 | Ga0209025_1000073128 | 215 |
| 308 | 3300025294 | Ga0209025_1000491 | Ga0209025_100049123 | 215 |
| 309 | 3300025294 | Ga0209025_1008800 | Ga0209025_10088005 | 215 |
| 310 | 3300025294 | Ga0209025_1013011 | Ga0209025_10130115 | 215 |
| 311 | 3300025295 | Ga0209564_1000360 | Ga0209564_100036039 | 215 |
| 312 | 3300025295 | Ga0209564_1000603 | Ga0209564_10006038 | 215 |
| 313 | 3300025297 | Ga0209758_1000025 | Ga0209758_100002577 | 215 |
| 314 | 3300025297 | Ga0209758_1006146 | Ga0209758_10061465 | 215 |
| 315 | 3300025298 | Ga0209050_1020992 | Ga0209050_10209923 | 215 |
| 316 | 3300025299 | Ga0209256_1000050 | Ga0209256_1000050143 | 215 |
| 317 | 3300025299 | Ga0209256_1000063 | Ga0209256_1000063165 | 215 |
| 318 | 3300025299 | Ga0209256_1047129 | Ga0209256_10471292 | 215 |
| 319 | 3300025302 | Ga0207426_1000001 | Ga0207426_1000001560 | 215 |
| 320 | 3300025302 | Ga0207426_1000028 | Ga0207426_1000028383 | 215 |
| 321 | 3300025303 | Ga0209051_1000002 | Ga0209051_10000021470 | 215 |
| 322 | 3300025303 | Ga0209051_1000605 | Ga0209051_100060514 | 215 |
| 323 | 3300025303 | Ga0209051_1000907 | Ga0209051_100090717 | 215 |
| 324 | 3300025304 | Ga0209257_1000002 | Ga0209257_10000021611 | 215 |
| 325 | 3300025304 | Ga0209257_1001389 | Ga0209257_100138925 | 215 |
| 326 | 3300025304 | Ga0209257_1005066 | Ga0209257_10050668 | 215 |
| 327 | 3300025315 | Ga0207697_10047814 | Ga0207697_100478142 | 215 |
| 328 | 3300025728 | Ga0207655_1010441 | Ga0207655_10104416 | 215 |
| 329 | 3300025903 | Ga0207680_10003111 | Ga0207680_100031113 | 215 |
| 330 | 3300025909 | Ga0207705_10105780 | Ga0207705_101057802 | 215 |
| 331 | 3300025909 | Ga0207705_10219091 | Ga0207705_102190912 | 215 |
| 332 | 3300025913 | Ga0207695_10092666 | Ga0207695_100926663 | 215 |
| 333 | 3300025913 | Ga0207695_10129800 | Ga0207695_101298002 | 215 |
| 334 | 3300025914 | Ga0207671_10326685 | Ga0207671_103266852 | 215 |
| 335 | 3300025914 | Ga0207671_10447505 | Ga0207671_104475052 | 215 |
| 336 | 3300025917 | Ga0207660_10159691 | Ga0207660_101596912 | 215 |
| 337 | 3300025919 | Ga0207657_10067544 | Ga0207657_100675442 | 215 |
| 338 | 3300025920 | Ga0207649_10025507 | Ga0207649_100255072 | 215 |
| 339 | 3300025921 | Ga0207652_10024345 | Ga0207652_100243452 | 215 |
| 340 | 3300025923 | Ga0207681_10181070 | Ga0207681_101810702 | 215 |
| 341 | 3300025923 | Ga0207681_10326279 | Ga0207681_103262791 | 215 |
| 342 | 3300025926 | Ga0207659_10000441 | Ga0207659_1000044123 | 215 |
| 343 | 3300025926 | Ga0207659_10514882 | Ga0207659_105148822 | 215 |
| 344 | 3300025931 | Ga0207644_10027033 | Ga0207644_100270333 | 215 |
| 345 | 3300025933 | Ga0207706_10015206 | Ga0207706_100152064 | 215 |
| 346 | 3300025933 | Ga0207706_10308378 | Ga0207706_103083782 | 215 |
| 347 | 3300025935 | Ga0207709_10001793 | Ga0207709_100017937 | 215 |
| 348 | 3300025937 | Ga0207669_10012121 | Ga0207669_100121213 | 215 |
| 349 | 3300025938 | Ga0207704_10046392 | Ga0207704_100463922 | 215 |
| 350 | 3300025940 | Ga0207691_10008761 | Ga0207691_1000876110 | 215 |
| 351 | 3300025940 | Ga0207691_10183648 | Ga0207691_101836482 | 215 |
| 352 | 3300025941 | Ga0207711_10011063 | Ga0207711_100110636 | 215 |
| 353 | 3300025941 | Ga0207711_10550764 | Ga0207711_105507642 | 215 |
| 354 | 3300025941 | Ga0207711_10611669 | Ga0207711_106116691 | 215 |
| 355 | 3300025942 | Ga0207689_10075271 | Ga0207689_100752712 | 215 |
| 356 | 3300025949 | Ga0207667_10022142 | Ga0207667_100221422 | 215 |
| 357 | 3300025960 | Ga0207651_10007601 | Ga0207651_100076014 | 215 |
| 358 | 3300025960 | Ga0207651_10300763 | Ga0207651_103007632 | 215 |
| 359 | 3300025981 | Ga0207640_10252310 | Ga0207640_102523102 | 215 |
| 360 | 3300025986 | Ga0207658_10058363 | Ga0207658_100583632 | 215 |
| 361 | 3300025986 | Ga0207658_10482366 | Ga0207658_104823662 | 215 |
| 362 | 3300026023 | Ga0207677_10000679 | Ga0207677_100006798 | 215 |
| 363 | 3300026035 | Ga0207703_10001030 | Ga0207703_100010303 | 215 |
| 364 | 3300026041 | Ga0207639_10089228 | Ga0207639_100892283 | 215 |
| 365 | 3300026075 | Ga0207708_10154737 | Ga0207708_101547372 | 215 |
| 366 | 3300026078 | Ga0207702_10636665 | Ga0207702_106366652 | 215 |
| 367 | 3300026089 | Ga0207648_10025011 | Ga0207648_100250114 | 215 |
| 368 | 3300026089 | Ga0207648_10053077 | Ga0207648_100530774 | 215 |
| 369 | 3300026095 | Ga0207676_10000229 | Ga0207676_1000022929 | 215 |
| 370 | 3300026118 | Ga0207675_100088642 | Ga0207675_1000886422 | 215 |
| 371 | 3300026121 | Ga0207683_10023200 | Ga0207683_100232004 | 215 |
| 372 | 3300026142 | Ga0207698_10108783 | Ga0207698_101087832 | 215 |
| 373 | 3300027666 | Ga0209282_1000114 | Ga0209282_100011433 | 215 |
| 374 | 3300027666 | Ga0209282_1195790 | Ga0209282_11957902 | 215 |
| 375 | 3300027866 | Ga0209813_10068287 | Ga0209813_100682872 | 215 |
| 376 | 3300028379 | Ga0268266_10431527 | Ga0268266_104315272 | 215 |
| 377 | 3300028380 | Ga0268265_10637837 | Ga0268265_106378372 | 215 |
| 378 | 3300028381 | Ga0268264_10035668 | Ga0268264_100356682 | 215 |
| 379 | 3300028381 | Ga0268264_10770368 | Ga0268264_107703681 | 215 |
| 380 | 3300028794 | Ga0307515_10000137 | Ga0307515_1000013793 | 215 |
| 381 | 3300030731 | Ga0316177_1002400 | Ga0316177_10024005 | 215 |
| 382 | 3300030732 | Ga0316176_1128501 | Ga0316176_11285013 | 215 |
| 383 | 3300030733 | Ga0314311_1071148 | Ga0314311_10711486 | 215 |
| 384 | 3300030734 | Ga0316179_1025484 | Ga0316179_10254842 | 215 |
| 385 | 3300030735 | Ga0316178_1156265 | Ga0316178_11562652 | 215 |
| 386 | 3300030742 | Ga0316183_1046023 | Ga0316183_10460233 | 215 |
| 387 | 3300030744 | Ga0316181_1189823 | Ga0316181_11898231 | 215 |
| 388 | 3300030745 | Ga0316182_1133866 | Ga0316182_11338662 | 215 |
| 389 | 3300030745 | Ga0316182_1232125 | Ga0316182_12321252 | 215 |
| 390 | 3300031548 | Ga0307408_100066690 | Ga0307408_1000666903 | 215 |
| 391 | 3300031548 | Ga0307408_100134411 | Ga0307408_1001344112 | 215 |
| 392 | 3300031548 | Ga0307408_100154028 | Ga0307408_1001540283 | 215 |
| 393 | 3300031711 | Ga0265314_10001686 | Ga0265314_1000168614 | 215 |
| 394 | 3300031731 | Ga0307405_10058125 | Ga0307405_100581252 | 215 |
| 395 | 3300031731 | Ga0307405_10163826 | Ga0307405_101638262 | 215 |
| 396 | 3300031824 | Ga0307413_10227244 | Ga0307413_102272441 | 215 |
| 397 | 3300031852 | Ga0307410_10292360 | Ga0307410_102923602 | 215 |
| 398 | 3300031901 | Ga0307406_10000472 | Ga0307406_1000047210 | 215 |
| 399 | 3300031901 | Ga0307406_10096167 | Ga0307406_100961672 | 215 |
| 400 | 3300031901 | Ga0307406_10300721 | Ga0307406_103007212 | 215 |
| 401 | 3300031903 | Ga0307407_10613773 | Ga0307407_106137731 | 215 |
| 402 | 3300031911 | Ga0307412_10072304 | Ga0307412_100723042 | 215 |
| 403 | 3300031911 | Ga0307412_10093677 | Ga0307412_100936772 | 215 |
| 404 | 3300031911 | Ga0307412_10221209 | Ga0307412_102212092 | 215 |
| 405 | 3300032002 | Ga0307416_100446914 | Ga0307416_1004469141 | 215 |
| 406 | 3300032004 | Ga0307414_10005033 | Ga0307414_100050338 | 215 |
| 407 | 3300032004 | Ga0307414_10482077 | Ga0307414_104820771 | 215 |
| 408 | 3300032005 | Ga0307411_10008361 | Ga0307411_100083617 | 215 |
| 409 | 3300032005 | Ga0307411_10120110 | Ga0307411_101201102 | 215 |
| 410 | 3300032005 | Ga0307411_10131201 | Ga0307411_101312012 | 215 |
| 411 | 3300032005 | Ga0307411_10220623 | Ga0307411_102206231 | 215 |
| 412 | 3300035725 | Ga0373947_0294808 | Ga0373947_0294808_165_818 | 215 |
| 413 | 3300037068 | Ga0373925_0379145 | Ga0373925_0379145_468_1121 | 215 |
| 414 | 3300037418 | Ga0395900_0303793 | Ga0395900_0303793_470_1120 | 215 |
| 415 | 3300037466 | Ga0395898_0003968 | Ga0395898_0003968_6832_7482 | 215 |
| 416 | 3300037471 | Ga0395905_0000180 | Ga0395905_0000180_23725_24375 | 215 |
| 417 | 3300037471 | Ga0395905_0041095 | Ga0395905_0041095_3627_4280 | 215 |
| 418 | 3300037471 | Ga0395905_0096760 | Ga0395905_0096760_598_1248 | 215 |
| 419 | 3300037471 | Ga0395905_0512419 | Ga0395905_0512419_269_919 | 215 |
| 420 | 3300038443 | Ga0395901_0068022 | Ga0395901_0068022_329_982 | 215 |
| 421 | 3300038443 | Ga0395901_0170687 | Ga0395901_0170687_945_1595 | 215 |
| 422 | 3300038443 | Ga0395901_0317819 | Ga0395901_0317819_276_926 | 215 |
| 423 | 3300038443 | Ga0395901_0331416 | Ga0395901_0331416_329_982 | 215 |
| 424 | 3300038443 | Ga0395901_0416513 | Ga0395901_0416513_530_1180 | 215 |
| 425 | 3300041407 | Ga0439447_002984 | Ga0439447_002984_2142_2789 | 215 |
| 426 | 3300041407 | Ga0439447_052926 | Ga0439447_052926_20_667 | 215 |
| 427 | 3300041410 | Ga0439461_0005148 | Ga0439461_0005148_1515_2162 | 215 |
| 428 | 3300041411 | Ga0439466_0110151 | Ga0439466_0110151_10_657 | 215 |
| 429 | 3300041413 | Ga0439465_0000212 | Ga0439465_0000212_1967_2614 | 215 |
| 430 | 3300041486 | Ga0451807_1640364 | Ga0451807_1640364_77_724 | 215 |
| 431 | 3300041498 | Ga0451841_0576698 | Ga0451841_0576698_206_904 | 215 |
| 432 | 3300041997 | Ga0439431_0003405 | Ga0439431_0003405_1964_2611 | 215 |
| 433 | 3300041999 | Ga0439433_0031582 | Ga0439433_0031582_438_1085 | 215 |
| 434 | 3300042002 | Ga0439442_020440 | Ga0439442_020440_493_1140 | 215 |
| 435 | 3300042004 | Ga0439445_0000327 | Ga0439445_0000327_2237_2884 | 215 |
| 436 | 3300042006 | Ga0439432_002375 | Ga0439432_002375_2085_2732 | 215 |
| 437 | 3300042006 | Ga0439432_017821 | Ga0439432_017821_568_1215 | 215 |
| 438 | 3300042007 | Ga0439449_0000783 | Ga0439449_0000783_7566_8213 | 215 |
| 439 | 3300042007 | Ga0439449_0006225 | Ga0439449_0006225_1612_2259 | 215 |
| 440 | 3300042007 | Ga0439449_0021978 | Ga0439449_0021978_317_964 | 215 |
| 441 | 3300042010 | Ga0439452_000907 | Ga0439452_000907_7355_8002 | 215 |
| 442 | 3300042015 | Ga0439462_0004645 | Ga0439462_0004645_1699_2346 | 215 |
| 443 | 3300042015 | Ga0439462_0035230 | Ga0439462_0035230_127_774 | 215 |
| 444 | 3300042015 | Ga0439462_0056577 | Ga0439462_0056577_228_875 | 215 |
| 445 | 3300042115 | Ga0450911_020113 | Ga0450911_020113_200_850 | 215 |
| 446 | 3300042122 | Ga0450920_018960 | Ga0450920_018960_602_1249 | 215 |
| 447 | 3300042124 | Ga0450922_010541 | Ga0450922_010541_10_657 | 215 |
| 448 | 3300042127 | Ga0450890_009450 | Ga0450890_009450_84_734 | 215 |
| 449 | 3300042130 | Ga0450892_004977 | Ga0450892_004977_222_872 | 215 |
| 450 | 3300042156 | Ga0439446_0001380 | Ga0439446_0001380_2510_3157 | 215 |
| 451 | 3300042156 | Ga0439446_0019189 | Ga0439446_0019189_25_675 | 215 |
| 452 | 3300042157 | Ga0439458_0059096 | Ga0439458_0059096_186_836 | 215 |
| 453 | 3300042184 | Ga0450908_000844 | Ga0450908_000844_1138_1785 | 215 |
| 454 | 3300042184 | Ga0450908_020403 | Ga0450908_020403_277_924 | 215 |
| 455 | 3300042435 | Ga0439434_0015767 | Ga0439434_0015767_1465_2112 | 215 |
| 456 | 3300042435 | Ga0439434_0064781 | Ga0439434_0064781_70_717 | 215 |
| 457 | 3300042439 | Ga0439464_0005973 | Ga0439464_0005973_1566_2216 | 215 |
| 458 | 3300042531 | Ga0450918_000516 | Ga0450918_000516_5159_5806 | 215 |
| 459 | 3300044656 | Ga0466969_0267796 | Ga0466969_0267796_107_757 | 215 |
| 460 | 3300044673 | Ga0453683_0091795 | Ga0453683_0091795_414_1064 | 215 |
| 461 | 3300044706 | Ga0466964_0164530 | Ga0466964_0164530_290_940 | 215 |
| 462 | 3300044735 | Ga0466968_0059784 | Ga0466968_0059784_136_786 | 215 |
| 463 | 3300045051 | Ga0451576_0016029 | Ga0451576_0016029_3549_4199 | 215 |
| 464 | 3300046453 | Ga0495627_019311 | Ga0495627_019311_258_905 | 215 |
| 465 | 3300046460 | Ga0495638_0029313 | Ga0495638_0029313_2044_2691 | 215 |
| 466 | 3300046506 | Ga0495583_0105488 | Ga0495583_0105488_265_912 | 215 |
| 467 | 3300046512 | Ga0495610_0082494 | Ga0495610_0082494_734_1381 | 215 |
| 468 | 3300046513 | Ga0495616_0005680 | Ga0495616_0005680_1610_2257 | 215 |
| 469 | 3300046518 | Ga0495631_0002176 | Ga0495631_0002176_3888_4535 | 215 |
| 470 | 3300046539 | Ga0495621_0035562 | Ga0495621_0035562_683_1333 | 215 |
| 471 | 3300046615 | Ga0495656_0000209 | Ga0495656_0000209_3112_3759 | 215 |
| 472 | 3300046615 | Ga0495656_0012974 | Ga0495656_0012974_1498_2145 | 215 |
| 473 | 3300046660 | Ga0495625_0000044 | Ga0495625_0000044_134898_135545 | 215 |
| 474 | 3300046660 | Ga0495625_0033017 | Ga0495625_0033017_1707_2354 | 215 |
| 475 | 3300046674 | Ga0495588_0030838 | Ga0495588_0030838_1790_2437 | 215 |
| 476 | 3300046674 | Ga0495588_0033417 | Ga0495588_0033417_1071_1718 | 215 |
| 477 | 3300046683 | Ga0495658_0136211 | Ga0495658_0136211_742_1395 | 215 |
| 478 | 3300046683 | Ga0495658_0208966 | Ga0495658_0208966_460_1107 | 215 |
| 479 | 3300047321 | Ga0495676_0026230 | Ga0495676_0026230_2997_3644 | 215 |
| 480 | 3300047673 | Ga0495593_0017861 | Ga0495593_0017861_3114_3761 | 215 |
| 481 | 3300048089 | Ga0495614_0053657 | Ga0495614_0053657_74_721 | 215 |
| 482 | 3300048904 | Ga0496101_0094303 | Ga0496101_0094303_1076_1723 | 215 |
| 483 | 3300048905 | Ga0496102_0000310 | Ga0496102_0000310_6453_7241 | 215 |
| 484 | 3300048907 | Ga0496104_0065997 | Ga0496104_0065997_2645_3298 | 215 |
| 485 | 3300048908 | Ga0496105_0042329 | Ga0496105_0042329_2264_2917 | 215 |
| 486 | 3300048909 | Ga0496106_0069570 | Ga0496106_0069570_658_1308 | 215 |
| 487 | 3300048911 | Ga0496108_0011290 | Ga0496108_0011290_1642_2292 | 215 |
| 488 | 3300048912 | Ga0496109_0040775 | Ga0496109_0040775_1239_1889 | 215 |
| 489 | 3300048913 | Ga0496110_0255264 | Ga0496110_0255264_889_1536 | 215 |
| 490 | 3300048917 | Ga0496114_0021656 | Ga0496114_0021656_3553_4206 | 215 |
| 491 | 3300048917 | Ga0496114_0393502 | Ga0496114_0393502_381_1028 | 215 |
| 492 | 3300048919 | Ga0496116_0021136 | Ga0496116_0021136_3586_4233 | 215 |
| 493 | 3300048919 | Ga0496116_0181930 | Ga0496116_0181930_260_907 | 215 |
| 494 | 3300048920 | Ga0496117_0018952 | Ga0496117_0018952_2481_3128 | 215 |
| 495 | 3300048920 | Ga0496117_0063890 | Ga0496117_0063890_1421_2068 | 215 |
| 496 | 3300048921 | Ga0496118_0049833 | Ga0496118_0049833_444_1091 | 215 |
| 497 | 3300048921 | Ga0496118_0069356 | Ga0496118_0069356_282_929 | 215 |
| 498 | 3300048924 | Ga0496121_0014501 | Ga0496121_0014501_4660_5307 | 215 |
| 499 | 3300048924 | Ga0496121_0045777 | Ga0496121_0045777_1156_1803 | 215 |
| 500 | 3300048924 | Ga0496121_0176074 | Ga0496121_0176074_490_1137 | 215 |
| 501 | 3300048925 | Ga0496122_0062978 | Ga0496122_0062978_952_1599 | 215 |
| 502 | 3300048926 | Ga0496123_0052989 | Ga0496123_0052989_2009_2656 | 215 |
| 503 | 3300048927 | Ga0496124_0024673 | Ga0496124_0024673_1963_2610 | 215 |
| 504 | 3300048927 | Ga0496124_0101737 | Ga0496124_0101737_1390_2037 | 215 |
| 505 | 3300048927 | Ga0496124_0384568 | Ga0496124_0384568_207_854 | 215 |
| 506 | 3300048928 | Ga0496125_0012614 | Ga0496125_0012614_811_1458 | 215 |
| 507 | 3300048928 | Ga0496125_0014401 | Ga0496125_0014401_5575_6222 | 215 |
| 508 | 3300048928 | Ga0496125_0220837 | Ga0496125_0220837_81_728 | 215 |
| 509 | 3300048928 | Ga0496125_0295147 | Ga0496125_0295147_38_685 | 215 |
| 510 | 3300048929 | Ga0496126_0088475 | Ga0496126_0088475_1527_2174 | 215 |
| 511 | 3300049127 | Ga0501306_013307 | Ga0501306_013307_16_666 | 215 |
| 512 | 3300049127 | Ga0501306_016403 | Ga0501306_016403_21_671 | 215 |
| 513 | 3300049127 | Ga0501306_036214 | Ga0501306_036214_32_682 | 215 |
| 514 | 3300049128 | Ga0501308_032375 | Ga0501308_032375_43_690 | 215 |
| 515 | 3300049129 | Ga0501309_012791 | Ga0501309_012791_73_723 | 215 |
| 516 | 3300049130 | Ga0501310_013154 | Ga0501310_013154_27_677 | 215 |
| 517 | 3300049130 | Ga0501310_021065 | Ga0501310_021065_134_784 | 215 |
| 518 | 3300049130 | Ga0501310_024663 | Ga0501310_024663_99_749 | 215 |
| 519 | 3300049130 | Ga0501310_036004 | Ga0501310_036004_10_657 | 215 |
| 520 | 3300049160 | Ga0501304_006233 | Ga0501304_006233_29_679 | 215 |
| 521 | 3300049160 | Ga0501304_012655 | Ga0501304_012655_25_675 | 215 |
| 522 | 3300049160 | Ga0501304_016078 | Ga0501304_016078_18_665 | 215 |
| 523 | 3300049161 | Ga0501305_012094 | Ga0501305_012094_499_1149 | 215 |
| 524 | 3300049161 | Ga0501305_029455 | Ga0501305_029455_28_678 | 215 |
| 525 | 3300049161 | Ga0501305_051535 | Ga0501305_051535_21_671 | 215 |
| 526 | 3300049162 | Ga0501307_023368 | Ga0501307_023368_141_791 | 215 |
| 527 | 3300049529 | Ga0501313_030193 | Ga0501313_030193_29_682 | 215 |
| 528 | 3300049530 | Ga0501314_010850 | Ga0501314_010850_41_688 | 215 |
| 529 | 3300049530 | Ga0501314_016856 | Ga0501314_016856_16_666 | 215 |
| 530 | 3300049530 | Ga0501314_018371 | Ga0501314_018371_14_664 | 215 |
| 531 | 3300049531 | Ga0501315_018826 | Ga0501315_018826_193_843 | 215 |
| 532 | 3300049531 | Ga0501315_022229 | Ga0501315_022229_192_842 | 215 |
| 533 | 3300049531 | Ga0501315_031759 | Ga0501315_031759_33_680 | 215 |
| 534 | 3300049531 | Ga0501315_041806 | Ga0501315_041806_34_681 | 215 |
| 535 | 3300049532 | Ga0501316_032066 | Ga0501316_032066_21_674 | 215 |
| 536 | 3300049538 | Ga0501322_007675 | Ga0501322_007675_18_668 | 215 |
| 537 | 3300049539 | Ga0501323_031098 | Ga0501323_031098_29_679 | 215 |
| 538 | 3300049679 | Ga0501249_002689 | Ga0501249_002689_776_1423 | 215 |
| 539 | 3300049758 | Ga0501241_014340 | Ga0501241_014340_10_657 | 215 |
| 540 | 3300049759 | Ga0501262_000210 | Ga0501262_000210_4192_4839 | 215 |
| 541 | 3300049823 | Ga0501044_0785202 | Ga0501044_0785202_95_745 | 215 |
| 542 | 3300050489 | nmdc:mga03683_305289_c1 | nmdc:mga03683_305289_c1_80_727 | 215 |
| 543 | 3300050493 | nmdc:mga0k408_116930_c1 | nmdc:mga0k408_116930_c1_513_1160 | 215 |
| 544 | 3300050494 | nmdc:mga06z11_11842_c1 | nmdc:mga06z11_11842_c1_555_1202 | 215 |
| 545 | 3300050496 | nmdc:mga07m45_115372_c1 | nmdc:mga07m45_115372_c1_600_1247 | 215 |
| 546 | 3300050496 | nmdc:mga07m45_12425_c1 | nmdc:mga07m45_12425_c1_1213_1860 | 215 |
| 547 | 3300050496 | nmdc:mga07m45_167312_c1 | nmdc:mga07m45_167312_c1_539_1186 | 215 |
| 548 | 3300050496 | nmdc:mga07m45_386_c1 | nmdc:mga07m45_386_c1_1022_1672 | 215 |
| 549 | 3300050496 | nmdc:mga07m45_6174_c1 | nmdc:mga07m45_6174_c1_3124_3771 | 215 |
| 550 | 3300053087 | Ga0500643_013156 | Ga0500643_013156_1503_2150 | 215 |
| 551 | 3300053093 | Ga0500651_0000063 | Ga0500651_0000063_70111_70758 | 215 |
| 552 | 3300053094 | Ga0500566_0095922 | Ga0500566_0095922_957_1604 | 215 |
| 553 | 3300053108 | Ga0500562_002124 | Ga0500562_002124_691_1338 | 215 |
| 554 | 3300053110 | Ga0500571_006776 | Ga0500571_006776_5502_6149 | 215 |
| 555 | 3300053118 | Ga0500594_0002456 | Ga0500594_0002456_2152_2799 | 215 |
| 556 | 3300053120 | Ga0500597_039379 | Ga0500597_039379_229_876 | 215 |
| 557 | 3300053121 | Ga0500607_001609 | Ga0500607_001609_6887_7534 | 215 |
| 558 | 3300053121 | Ga0500607_048234 | Ga0500607_048234_1476_2123 | 215 |
| 559 | 3300053133 | Ga0500655_003141 | Ga0500655_003141_1516_2163 | 215 |
| 560 | 3300053134 | Ga0500658_0000481 | Ga0500658_0000481_6679_7326 | 215 |
| 561 | 3300053134 | Ga0500658_0000709 | Ga0500658_0000709_5123_5770 | 215 |
| 562 | 3300053136 | Ga0500559_0003620 | Ga0500559_0003620_4862_5551 | 215 |
| 563 | 3300053139 | Ga0500568_0003586 | Ga0500568_0003586_2740_3387 | 215 |
| 564 | 3300053153 | Ga0500616_0241801 | Ga0500616_0241801_28_675 | 215 |
| 565 | 3300053157 | Ga0500624_041586 | Ga0500624_041586_13_660 | 215 |
| 566 | 3300053161 | Ga0500634_0008688 | Ga0500634_0008688_2536_3183 | 215 |
| 567 | 3300053162 | Ga0500638_043069 | Ga0500638_043069_1361_2008 | 215 |
| 568 | 3300053729 | Ga0500625_028720 | Ga0500625_028720_1873_2520 | 215 |
| 569 | 3300059477 | Ga0587084_024870 | Ga0587084_024870_43_690 | 215 |
| 570 | 3300059477 | Ga0587084_053397 | Ga0587084_053397_33_680 | 215 |
| 571 | 3300060346 | Ga0587111_0105279 | Ga0587111_0105279_46_693 | 215 |
| 572 | 3300005288 | Ga0065714_10188073 | Ga0065714_101880732 | 216 |
| 573 | 3300005367 | Ga0070667_100013446 | Ga0070667_1000134466 | 216 |
| 574 | 3300005456 | Ga0070678_100795132 | Ga0070678_1007951321 | 216 |
| 575 | 3300006195 | Ga0075366_10156024 | Ga0075366_101560242 | 216 |
| 576 | 3300006353 | Ga0075370_10009157 | Ga0075370_100091575 | 216 |
| 577 | 3300009176 | Ga0105242_10612207 | Ga0105242_106122071 | 216 |
| 578 | 3300009551 | Ga0105238_10115661 | Ga0105238_101156612 | 216 |
| 579 | 3300009553 | Ga0105249_10091984 | Ga0105249_100919843 | 216 |
| 580 | 3300013104 | Ga0157370_10034191 | Ga0157370_100341913 | 216 |
| 581 | 3300013296 | Ga0157374_10368459 | Ga0157374_103684592 | 216 |
| 582 | 3300013306 | Ga0163162_10117062 | Ga0163162_101170623 | 216 |
| 583 | 3300014497 | Ga0182008_10022826 | Ga0182008_100228264 | 216 |
| 584 | 3300014497 | Ga0182008_10037658 | Ga0182008_100376583 | 216 |
| 585 | 3300015261 | Ga0182006_1050345 | Ga0182006_10503452 | 216 |
| 586 | 3300015262 | Ga0182007_10000916 | Ga0182007_100009168 | 216 |
| 587 | 3300017792 | Ga0163161_10040574 | Ga0163161_100405742 | 216 |
| 588 | 3300025258 | Ga0209129_1000528 | Ga0209129_10005282 | 216 |
| 589 | 3300025294 | Ga0209025_1000248 | Ga0209025_100024875 | 216 |
| 590 | 3300025940 | Ga0207691_10583478 | Ga0207691_105834781 | 216 |
| 591 | 3300025986 | Ga0207658_10060708 | Ga0207658_100607082 | 216 |
| 592 | 3300026121 | Ga0207683_10317661 | Ga0207683_103176612 | 216 |
| 593 | 3300026142 | Ga0207698_10503687 | Ga0207698_105036872 | 216 |
| 594 | 3300027907 | Ga0207428_10569974 | Ga0207428_105699741 | 216 |
| 595 | 3300031239 | Ga0265328_10024200 | Ga0265328_100242002 | 216 |
| 596 | 3300031456 | Ga0307513_10000486 | Ga0307513_1000048624 | 216 |
| 597 | 3300031911 | Ga0307412_10956972 | Ga0307412_109569721 | 216 |
| 598 | 3300041451 | Ga0451791_0997051 | Ga0451791_0997051_81_734 | 216 |
| 599 | 3300044683 | Ga0466965_0006533 | Ga0466965_0006533_3173_3871 | 216 |
| 600 | 3300044901 | Ga0466960_0020091 | Ga0466960_0020091_61_759 | 216 |
| 601 | 3300045051 | Ga0451576_0869427 | Ga0451576_0869427_80_733 | 216 |
| 602 | 3300046475 | Ga0495639_0001341 | Ga0495639_0001341_2432_3085 | 216 |
| 603 | 3300046520 | Ga0495637_0071933 | Ga0495637_0071933_254_937 | 216 |
| 604 | 3300046539 | Ga0495621_0056812 | Ga0495621_0056812_18_674 | 216 |
| 605 | 3300046660 | Ga0495625_0136747 | Ga0495625_0136747_866_1549 | 216 |
| 606 | 3300046674 | Ga0495588_0039594 | Ga0495588_0039594_871_1524 | 216 |
| 607 | 3300046678 | Ga0495599_0131909 | Ga0495599_0131909_507_1160 | 216 |
| 608 | 3300046691 | Ga0495670_0053925 | Ga0495670_0053925_970_1623 | 216 |
| 609 | 3300046692 | Ga0495671_0013095 | Ga0495671_0013095_2850_3533 | 216 |
| 610 | 3300048903 | Ga0496100_0011371 | Ga0496100_0011371_4001_4654 | 216 |
| 611 | 3300048904 | Ga0496101_0000958 | Ga0496101_0000958_6890_7543 | 216 |
| 612 | 3300048905 | Ga0496102_0037849 | Ga0496102_0037849_141_794 | 216 |
| 613 | 3300048906 | Ga0496103_0028934 | Ga0496103_0028934_313_966 | 216 |
| 614 | 3300048907 | Ga0496104_0000688 | Ga0496104_0000688_26275_26928 | 216 |
| 615 | 3300048908 | Ga0496105_0005944 | Ga0496105_0005944_4189_4842 | 216 |
| 616 | 3300048910 | Ga0496107_0041302 | Ga0496107_0041302_1683_2336 | 216 |
| 617 | 3300048911 | Ga0496108_0176174 | Ga0496108_0176174_541_1194 | 216 |
| 618 | 3300048911 | Ga0496108_0835022 | Ga0496108_0835022_51_704 | 216 |
| 619 | 3300048912 | Ga0496109_0405182 | Ga0496109_0405182_406_1059 | 216 |
| 620 | 3300048913 | Ga0496110_0031792 | Ga0496110_0031792_2038_2691 | 216 |
| 621 | 3300048913 | Ga0496110_0097168 | Ga0496110_0097168_1165_1818 | 216 |
| 622 | 3300048914 | Ga0496111_0029141 | Ga0496111_0029141_1146_1799 | 216 |
| 623 | 3300049579 | Ga0501043_0186685 | Ga0501043_0186685_78_770 | 216 |
| 624 | 3300049663 | Ga0501223_027932 | Ga0501223_027932_157_960 | 216 |
| 625 | 3300049853 | Ga0501226_011670 | Ga0501226_011670_103_906 | 216 |
| 626 | 3300050493 | nmdc:mga0k408_12049_c1 | nmdc:mga0k408_12049_c1_79_765 | 216 |
| 627 | 3300050493 | nmdc:mga0k408_50825_c1 | nmdc:mga0k408_50825_c1_1431_2114 | 216 |
| 628 | 3300050494 | nmdc:mga06z11_95696_c1 | nmdc:mga06z11_95696_c1_144_830 | 216 |
| 629 | 3300050496 | nmdc:mga07m45_22727_c1 | nmdc:mga07m45_22727_c1_1374_2057 | 216 |
| 630 | 3300050496 | nmdc:mga07m45_34539_c1 | nmdc:mga07m45_34539_c1_80_766 | 216 |
| 631 | 3300050496 | nmdc:mga07m45_460279_c1 | nmdc:mga07m45_460279_c1_32_685 | 216 |
| 632 | 3300050508 | nmdc:mga09592_135046_c1 | nmdc:mga09592_135046_c1_1162_1818 | 216 |
| 633 | 3300053117 | Ga0500593_000829 | Ga0500593_000829_8091_8774 | 216 |
| 634 | 3300053122 | Ga0500608_052273 | Ga0500608_052273_887_1570 | 216 |
| 635 | 3300053158 | Ga0500627_0003521 | Ga0500627_0003521_2131_2814 | 216 |
| 636 | 3300053160 | Ga0500633_0159070 | Ga0500633_0159070_107_790 | 216 |
| 637 | 3300053161 | Ga0500634_0018086 | Ga0500634_0018086_2823_3506 | 216 |
| 638 | 3300053730 | Ga0500645_000059 | Ga0500645_000059_52376_53080 | 216 |
| 639 | 3300053730 | Ga0500645_002200 | Ga0500645_002200_2955_3605 | 216 |
| 640 | 3300002704 | JGI25155J39150_1000392 | JGI25155J39150_10003929 | 217 |
| 641 | 3300002705 | JGI25156J39149_1001058 | JGI25156J39149_10010589 | 217 |
| 642 | 3300002738 | JGI25154J39366_1000894 | JGI25154J39366_10008949 | 217 |
| 643 | 3300002741 | JGI25157J39369_1001038 | JGI25157J39369_10010389 | 217 |
| 644 | 3300002987 | JGI25159J45721_1003130 | JGI25159J45721_10031303 | 217 |
| 645 | 3300002987 | JGI25159J45721_1007356 | JGI25159J45721_10073562 | 217 |
| 646 | 3300003187 | JGI25151J46595_10005828 | JGI25151J46595_100058286 | 217 |
| 647 | 3300003354 | JGI25160J50197_1011352 | JGI25160J50197_10113522 | 217 |
| 648 | 3300003374 | JGI25161J50226_1004040 | JGI25161J50226_10040402 | 217 |
| 649 | 3300003771 | Ga0055526_1001314 | Ga0055526_100131419 | 217 |
| 650 | 3300003771 | Ga0055526_1008772 | Ga0055526_10087723 | 217 |
| 651 | 3300003773 | Ga0055537_1000034 | Ga0055537_100003468 | 217 |
| 652 | 3300003775 | Ga0055524_1000016 | Ga0055524_100001676 | 217 |
| 653 | 3300003784 | Ga0055534_1001269 | Ga0055534_10012692 | 217 |
| 654 | 3300003790 | Ga0055528_1000527 | Ga0055528_100052734 | 217 |
| 655 | 3300003791 | Ga0055530_10000431 | Ga0055530_1000043130 | 217 |
| 656 | 3300003791 | Ga0055530_10028411 | Ga0055530_100284112 | 217 |
| 657 | 3300003792 | Ga0055540_1000031 | Ga0055540_100003186 | 217 |
| 658 | 3300003794 | Ga0055531_10002449 | Ga0055531_100024497 | 217 |
| 659 | 3300004625 | Ga0055543_1005541 | Ga0055543_10055412 | 217 |
| 660 | 3300005578 | Ga0068854_100680502 | Ga0068854_1006805021 | 217 |
| 661 | 3300006038 | Ga0075365_10447070 | Ga0075365_104470701 | 217 |
| 662 | 3300006177 | Ga0075362_10108518 | Ga0075362_101085182 | 217 |
| 663 | 3300025206 | Ga0209435_100001 | Ga0209435_100001411 | 217 |
| 664 | 3300025245 | Ga0207425_1003171 | Ga0207425_10031714 | 217 |
| 665 | 3300025246 | Ga0209646_1000001 | Ga0209646_1000001780 | 217 |
| 666 | 3300025250 | Ga0209026_1000003 | Ga0209026_1000003411 | 217 |
| 667 | 3300025256 | Ga0209759_1000001 | Ga0209759_1000001411 | 217 |
| 668 | 3300025263 | Ga0209565_1000004 | Ga0209565_1000004316 | 217 |
| 669 | 3300025263 | Ga0209565_1005599 | Ga0209565_10055992 | 217 |
| 670 | 3300025273 | Ga0209673_1000045 | Ga0209673_100004555 | 217 |
| 671 | 3300025284 | Ga0209130_1000056 | Ga0209130_10000562 | 217 |
| 672 | 3300025284 | Ga0209130_1000155 | Ga0209130_100015550 | 217 |
| 673 | 3300025291 | Ga0209675_1000225 | Ga0209675_100022524 | 217 |
| 674 | 3300025291 | Ga0209675_1008925 | Ga0209675_10089252 | 217 |
| 675 | 3300025292 | Ga0209676_1000007 | Ga0209676_1000007856 | 217 |
| 676 | 3300025294 | Ga0209025_1014941 | Ga0209025_10149415 | 217 |
| 677 | 3300025295 | Ga0209564_1000358 | Ga0209564_10003589 | 217 |
| 678 | 3300025295 | Ga0209564_1001768 | Ga0209564_100176817 | 217 |
| 679 | 3300025295 | Ga0209564_1006761 | Ga0209564_10067616 | 217 |
| 680 | 3300025297 | Ga0209758_1031838 | Ga0209758_10318382 | 217 |
| 681 | 3300025298 | Ga0209050_1000003 | Ga0209050_1000003651 | 217 |
| 682 | 3300025298 | Ga0209050_1004524 | Ga0209050_10045242 | 217 |
| 683 | 3300025299 | Ga0209256_1000001 | Ga0209256_1000001651 | 217 |
| 684 | 3300025299 | Ga0209256_1018315 | Ga0209256_10183152 | 217 |
| 685 | 3300025302 | Ga0207426_1000025 | Ga0207426_1000025321 | 217 |
| 686 | 3300025302 | Ga0207426_1003991 | Ga0207426_10039917 | 217 |
| 687 | 3300025303 | Ga0209051_1000003 | Ga0209051_1000003651 | 217 |
| 688 | 3300025304 | Ga0209257_1000018 | Ga0209257_1000018651 | 217 |
| 689 | 3300025304 | Ga0209257_1012788 | Ga0209257_10127882 | 217 |
| 690 | 3300026041 | Ga0207639_10168591 | Ga0207639_101685912 | 217 |
| 691 | 3300031548 | Ga0307408_100019789 | Ga0307408_1000197891 | 217 |
| 692 | 3300031901 | Ga0307406_10024399 | Ga0307406_100243993 | 217 |
| 693 | 3300050489 | nmdc:mga03683_145917_c1 | nmdc:mga03683_145917_c1_358_1011 | 217 |
| 694 | 3300053096 | Ga0500641_0095174 | Ga0500641_0095174_18_671 | 217 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2z98-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) | 0.9592 | 2 | 205 |
| 2z9b-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals | 0.9592 | 2 | 205 |
| 2z98-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: oxidized azor in tetragonal crystals (the resolution has improved from 1.8 (1v4b) to 1.4 angstrom) | 0.9544 | 2 | 205 |
| 2z9b-assembly1.cif.gz_A-2 | the crystal structure of azor (azoreductase) from escherichia coli: reduced azor in tetragonal crystals | 0.9544 | 2 | 205 |
| 7n2x-assembly1.cif.gz_A | the crystal structure of an fmn-dependent nadh:quinone oxidoreductase, azor from escherichia coli | 0.9541 | 1 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9481 | 1 | 206 | 3.40.50.360 |
| 1tikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9391 | 1 | 206 | 3.40.50.360 |
| 4c0wA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9307 | 2 | 201 | 3.40.50.360 |
| 6dxpB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9101 | 1 | 206 | 3.40.50.360 |
| 4c0wA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9084 | 2 | 201 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A068Z1X3-F1-model_v4 | FMN-dependent NADH-azoreductase | 0.9899 | 1 | 144 |
|
| AF-A0A433BLN3-F1-model_v4 | FMN-dependent NADH-azoreductase (EC 1.7.1.17) | 0.988 | 44 | 202 |
GO:0010181
GO:0016655 |
| AF-A0A1I5PF16-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9826 | 2 | 217 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-Q220J4-F1-model_v4 | FMN-dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9813 | 2 | 203 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
| AF-A0A2G6Y693-F1-model_v4 | FMN dependent NADH:quinone oxidoreductase (EC 1.6.5.-) (Azo-dye reductase) (FMN-dependent NADH-azo compound oxidoreductase) (FMN-dependent NADH-azoreductase) (EC 1.7.1.17) | 0.9811 | 2 | 205 |
GO:0009055
GO:0010181 GO:0016652 GO:0016655 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar