F475717

General Info

Members Datasets Scaffolds Average Seq Length
694 444 567 324

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10029092|Ga0081539_100290921
Length 339
Sequence MISRRAEPLIPFDPAPAGKTVLAVEEVCKHFSGKGALFGKSRVIEAVDRVTLHIGASETVGLVGESGSGKSTLGRAILQLDRPTAGTVMLDGRIISTLSDRELRPLRRDMQMIFQDPQSSLNPRMKVGAIIAEPLEIAGDISGRRALRERVHQLLDLVRLPASAAERYPYEFSGGQRQRIGIARAIALNPKLVVADEAVSSLDVSIQAQVINLLTDLQSELKFACLFIAHDLAVVKAVSDRVAVMYLGRLCEVGPSEQLFAKPAHPYTALLIEAIPVPDPDIRPTETVPVGEPPSPIAPPSGCRFRTRCPRADARCSAEVPELRAVAPGQFAACHYPLI

Samples

Sample ID Description Type Environment
1 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
5 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
10 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
13 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
14 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
15 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
16 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
17 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
18 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
21 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
22 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
23 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
24 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
25 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
26 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
27 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
28 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
29 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
30 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
31 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
32 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
33 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
34 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
35 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
36 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
37 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
38 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
39 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
40 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
41 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
42 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
43 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
44 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
45 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
46 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
47 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
48 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
49 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
50 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
51 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
52 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
53 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
54 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
55 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
56 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
57 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
58 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
59 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
60 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
61 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
62 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
63 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
64 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
65 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
66 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
67 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
68 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
69 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
70 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
71 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
72 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
73 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
74 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
75 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
76 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
77 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
78 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
79 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
80 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
81 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
82 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
83 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
84 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
85 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
86 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
87 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
88 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
89 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
90 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
91 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
92 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
93 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
94 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
95 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
96 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
97 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
98 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
99 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
100 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
101 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
102 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
103 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
104 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
105 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
106 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
107 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
108 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
109 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
110 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
111 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
112 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
113 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
114 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
115 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
116 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
117 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
118 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
119 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
120 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
123 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
124 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
125 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
126 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
127 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
128 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
129 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
130 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
131 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
132 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
133 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
134 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
139 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
140 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
141 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
142 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
143 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
144 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
145 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
146 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
147 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
148 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
149 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
150 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
151 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
152 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
153 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
154 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
155 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
156 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
157 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
158 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
159 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
160 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
161 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
162 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
163 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
164 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
165 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
166 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
167 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
168 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
169 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
170 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
171 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
172 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
173 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
174 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
175 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
176 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
177 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
178 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
179 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
180 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
181 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
182 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
183 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
184 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
185 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
186 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
187 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
188 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
189 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
190 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
191 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
192 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
193 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
194 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
195 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
196 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
197 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
198 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
199 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
200 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
201 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
202 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
206 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
208 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
263 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
264 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
265 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
266 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
267 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
271 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
272 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
273 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
274 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
275 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
276 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
277 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
278 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
279 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
280 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
281 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
282 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
283 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
284 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
285 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
286 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
287 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
288 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
289 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
290 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
291 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
293 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
294 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
295 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
296 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
297 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
298 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
299 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
300 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
301 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
302 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
303 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
304 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
306 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
307 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
308 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
309 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
310 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
311 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
312 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
313 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
314 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
318 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
319 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
320 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
321 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
322 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
323 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
324 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
325 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
326 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
327 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
328 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
329 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
330 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
331 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
332 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
333 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
334 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
335 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
336 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
337 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
338 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
339 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
340 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
341 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
342 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
343 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
344 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
345 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
348 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
349 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
350 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
351 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
354 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
355 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
356 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
357 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
358 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
359 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
360 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
361 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
362 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
363 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
368 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
369 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
370 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
371 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
372 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
377 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
378 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
379 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
380 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
381 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
382 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
383 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
384 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
385 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
386 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
387 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
388 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
389 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
390 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
391 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
392 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
393 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
394 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
398 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
404 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
411 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
412 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
413 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
414 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
415 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
416 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
417 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
418 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
419 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
422 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
423 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
424 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
425 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
428 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
429 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
430 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
431 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
432 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
433 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
434 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
435 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
436 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
437 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
438 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
439 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
440 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
441 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
442 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
443 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
444 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.29
Metatranscriptomes 0
Isolates 17.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.08
Nodule 13.83
Rhizoplane 4.47
Rhizosphere 62.39
Stem 0
Stem Tuber 0
Unclassified 10.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001542 3300003215 Bacteria 13678
2 JGI25153J46596_10001551 3300003215 Bacteria 13650
3 JGI25153J46596_10003383 3300003215 Bacteria 8950
4 JGI25153J46596_10005917 3300003215 Bacteria 6312
5 JGI25153J46596_10036462 3300003215 Bacteria 1576
6 JGI25160J50197_1005959 3300003354 Bacteria 5006
7 JGI25160J50197_1013050 3300003354 Bacteria 2851
8 Ga0055539_1008103 3300003752 Bacteria 1320
9 Ga0055531_10021688 3300003794 Bacteria 2480
10 Ga0065165_1000890 3300005262 Bacteria 38576
11 Ga0065165_1002830 3300005262 Bacteria 13549
12 Ga0070658_10022995 3300005327 Bacteria 5004
13 Ga0070658_10062264 3300005327 Bacteria 3040
14 Ga0070658_10216746 3300005327 Bacteria 1618
15 Ga0070658_10234674 3300005327 Bacteria 1554
16 Ga0070683_100022696 3300005329 Bacteria 5612
17 Ga0070683_100036748 3300005329 Bacteria 4483
18 Ga0070683_100120693 3300005329 Bacteria 2476
19 Ga0070680_100003467 3300005336 Bacteria 11777
20 Ga0070680_100014244 3300005336 Bacteria 6208
21 Ga0070682_100131787 3300005337 Bacteria 1693
22 Ga0068868_100078424 3300005338 Bacteria 2645
23 Ga0068868_100134936 3300005338 Bacteria 2022
24 Ga0070660_100066336 3300005339 Bacteria 2809
25 Ga0070691_10098321 3300005341 Bacteria 1451
26 Ga0070661_100300794 3300005344 Bacteria 1249
27 Ga0070668_100018396 3300005347 Bacteria 5245
28 Ga0070669_100114490 3300005353 Bacteria 2050
29 Ga0070669_100152403 3300005353 Bacteria 1790
30 Ga0070671_100130024 3300005355 Bacteria 2121
31 Ga0070671_100436938 3300005355 Bacteria 1122
32 Ga0070659_100137588 3300005366 Bacteria 1987
33 Ga0070659_100165406 3300005366 Bacteria 1810
34 Ga0070709_10000242 3300005434 Bacteria 35190
35 Ga0070709_10006317 3300005434 Bacteria 6452
36 Ga0070714_100010247 3300005435 Bacteria 7399
37 Ga0070714_100042784 3300005435 Bacteria 3828
38 Ga0070713_100035256 3300005436 Bacteria 4027
39 Ga0070711_100018414 3300005439 Bacteria 4459
40 Ga0070708_100297092 3300005445 Bacteria 1521
41 Ga0070708_100572818 3300005445 Bacteria 1065
42 Ga0070663_100065039 3300005455 Bacteria 2638
43 Ga0070663_100143052 3300005455 Bacteria 1828
44 Ga0070663_100203633 3300005455 Bacteria 1546
45 Ga0070678_100268545 3300005456 Bacteria 1438
46 Ga0070681_10061957 3300005458 Bacteria 3714
47 Ga0068867_100153822 3300005459 Bacteria 1809
48 Ga0068867_100182203 3300005459 Bacteria 1670
49 Ga0070706_100186252 3300005467 Bacteria 1940
50 Ga0070698_100031688 3300005471 Bacteria 5480
51 Ga0070699_100010113 3300005518 Bacteria 8167
52 Ga0070697_100018658 3300005536 Bacteria 5472
53 Ga0070697_100031560 3300005536 Bacteria 4262
54 Ga0068853_100172818 3300005539 Bacteria 1955
55 Ga0068853_100196319 3300005539 Bacteria 1836
56 Ga0070672_100181951 3300005543 Bacteria 1752
57 Ga0070665_100012029 3300005548 Bacteria 8730
58 Ga0070665_100095772 3300005548 Bacteria 2973
59 Ga0070665_100158189 3300005548 Bacteria 2268
60 Ga0070665_100316578 3300005548 Bacteria 1564
61 Ga0068855_100074068 3300005563 Bacteria 3955
62 Ga0068855_100089170 3300005563 Bacteria 3561
63 Ga0070664_100017524 3300005564 Bacteria 5884
64 Ga0070664_100063866 3300005564 Bacteria 3139
65 Ga0070664_100090212 3300005564 Bacteria 2652
66 Ga0068854_100223156 3300005578 Bacteria 1492
67 Ga0068856_100000147 3300005614 Bacteria 71694
68 Ga0068856_100172825 3300005614 Bacteria 2173
69 Ga0070702_100186158 3300005615 Bacteria 1363
70 Ga0068852_100026620 3300005616 Bacteria 4704
71 Ga0068859_100138921 3300005617 Bacteria 2503
72 Ga0068859_100320727 3300005617 Bacteria 1643
73 Ga0068864_100201235 3300005618 Bacteria 1830
74 Ga0068866_10039415 3300005718 Bacteria 2333
75 Ga0068861_100162643 3300005719 Bacteria 1842
76 Ga0068861_100248684 3300005719 Bacteria 1516
77 Ga0068870_10059161 3300005840 Bacteria 2054
78 Ga0068863_100455703 3300005841 Bacteria 1255
79 Ga0068860_100000360 3300005843 Bacteria 60297
80 Ga0068860_100022237 3300005843 Bacteria 6139
81 Ga0068860_100329767 3300005843 Bacteria 1499
82 Ga0068862_100023046 3300005844 Bacteria 5214
83 Ga0081455_10000391 3300005937 Bacteria 57931
84 Ga0081455_10022037 3300005937 Bacteria 5964
85 Ga0081455_10049326 3300005937 Bacteria 3629
86 Ga0081455_10098396 3300005937 Bacteria 2355
87 Ga0081540_1000563 3300005983 Bacteria 35948
88 Ga0081540_1005358 3300005983 Bacteria 9594
89 Ga0081540_1017091 3300005983 Bacteria 4506
90 Ga0081540_1041454 3300005983 Bacteria 2386
91 Ga0081539_10020643 3300005985 Bacteria 4441
92 Ga0081539_10029092 3300005985 Bacteria 3461
93 Ga0070717_10201255 3300006028 Bacteria 1744
94 Ga0075365_10236499 3300006038 Bacteria 1283
95 Ga0075363_100008417 3300006048 Bacteria 4801
96 Ga0075364_10117840 3300006051 Bacteria 1776
97 Ga0075364_10136761 3300006051 Bacteria 1647
98 Ga0070716_100035770 3300006173 Bacteria 2733
99 Ga0075367_10001189 3300006178 Bacteria 10934
100 Ga0075367_10026850 3300006178 Bacteria 3269
101 Ga0075369_10089729 3300006186 Bacteria 1371
102 Ga0075366_10228167 3300006195 Bacteria 1134
103 Ga0075370_10064177 3300006353 Bacteria 2094
104 Ga0075370_10251005 3300006353 Bacteria 1049
105 Ga0068871_100090784 3300006358 Bacteria 2545
106 Ga0075428_100067667 3300006844 Bacteria 3908
107 Ga0068865_100010846 3300006881 Bacteria 5685
108 Ga0097620_100138923 3300006931 Bacteria 2503
109 Ga0097620_100320698 3300006931 Bacteria 1643
110 Ga0099825_1023845 3300006941 Bacteria 3682
111 Ga0099822_1005398 3300006943 Bacteria 16681
112 Ga0099823_1016101 3300006944 Bacteria 7367
113 Ga0099794_10001856 3300007265 Bacteria 7566
114 Ga0099794_10024905 3300007265 Bacteria 2751
115 Ga0099795_10028287 3300007788 Bacteria 1904
116 Ga0105240_10026930 3300009093 Bacteria 7538
117 Ga0105240_10075210 3300009093 Bacteria 4166
118 Ga0105240_10148446 3300009093 Bacteria 2795
119 Ga0111539_10045303 3300009094 Bacteria 5266
120 Ga0105245_10075121 3300009098 Bacteria 3076
121 Ga0105245_10261193 3300009098 Bacteria 1685
122 Ga0105247_10074443 3300009101 Bacteria 2130
123 Ga0105247_10077345 3300009101 Bacteria 2091
124 Ga0105247_10130806 3300009101 Bacteria 1636
125 Ga0105243_10327388 3300009148 Bacteria 1398
126 Ga0105241_10248442 3300009174 Bacteria 1507
127 Ga0105242_10384643 3300009176 Bacteria 1305
128 Ga0105248_10089840 3300009177 Bacteria 3458
129 Ga0105237_10014093 3300009545 Bacteria 8363
130 Ga0105237_10067917 3300009545 Bacteria 3559
131 Ga0105237_10090926 3300009545 Bacteria 3042
132 Ga0105238_10025466 3300009551 Bacteria 6031
133 Ga0105238_10141570 3300009551 Bacteria 2382
134 Ga0105238_10323288 3300009551 Bacteria 1529
135 Ga0099796_10017660 3300010159 Bacteria 2128
136 Ga0099796_10018360 3300010159 Bacteria 2099
137 Ga0105239_10182513 3300010375 Bacteria 2348
138 Ga0105239_10231702 3300010375 Bacteria 2072
139 Ga0105239_10293783 3300010375 Bacteria 1830
140 Ga0105239_10427226 3300010375 Bacteria 1501
141 Ga0105239_10448061 3300010375 Bacteria 1464
142 Ga0157371_10118731 3300013102 Bacteria 1880
143 Ga0157369_10016441 3300013105 Bacteria 8320
144 Ga0157369_10183167 3300013105 Bacteria 2203
145 Ga0157374_10136923 3300013296 Bacteria 2374
146 Ga0157378_10079518 3300013297 Bacteria 2960
147 Ga0157378_10220201 3300013297 Bacteria 1804
148 Ga0163162_10049675 3300013306 Bacteria 4204
149 Ga0163162_10106859 3300013306 Bacteria 2894
150 Ga0157372_10089357 3300013307 Bacteria 3500
151 Ga0157375_10567184 3300013308 Bacteria 1296
152 Ga0163163_10034163 3300014325 Bacteria 4923
153 Ga0163163_10130093 3300014325 Bacteria 2557
154 Ga0157380_10266966 3300014326 Bacteria 1558
155 Ga0157377_10243697 3300014745 Bacteria 1162
156 Ga0157379_10330439 3300014968 Bacteria 1393
157 Ga0157376_10309365 3300014969 Bacteria 1498
158 Ga0163161_10086174 3300017792 Bacteria 2318
159 Ga0214542_1000606 3300021321 Bacteria 66272
160 Ga0214545_1000003 3300021324 Bacteria 720274
161 Ga0214543_1000002 3300021327 Bacteria 712733
162 Ga0213871_10000172 3300021441 Bacteria 7098
163 Ga0209677_109175 3300025253 Bacteria 1810
164 Ga0209673_1031986 3300025273 Bacteria 1627
165 Ga0209564_1006619 3300025295 Bacteria 6196
166 Ga0209758_1000011 3300025297 Bacteria 1049685
167 Ga0209758_1000477 3300025297 Bacteria 66111
168 Ga0209758_1001198 3300025297 Bacteria 32768
169 Ga0209758_1009643 3300025297 Bacteria 5950
170 Ga0209758_1010946 3300025297 Bacteria 5334
171 Ga0209758_1040941 3300025297 Bacteria 1740
172 Ga0209256_1001993 3300025299 Bacteria 18340
173 Ga0207426_1000519 3300025302 Bacteria 56155
174 Ga0207426_1005792 3300025302 Bacteria 5537
175 Ga0207426_1014062 3300025302 Bacteria 2945
176 Ga0209257_1000654 3300025304 Bacteria 54783
177 Ga0207697_10021166 3300025315 Bacteria 2663
178 Ga0207692_10029455 3300025898 Bacteria 2609
179 Ga0207642_10034421 3300025899 Bacteria 2154
180 Ga0207642_10130686 3300025899 Bacteria 1310
181 Ga0207710_10021188 3300025900 Bacteria 2783
182 Ga0207688_10034750 3300025901 Bacteria 2791
183 Ga0207688_10197565 3300025901 Bacteria 1205
184 Ga0207699_10001448 3300025906 Bacteria 11271
185 Ga0207699_10020904 3300025906 Bacteria 3517
186 Ga0207699_10116871 3300025906 Bacteria 1718
187 Ga0207643_10036462 3300025908 Bacteria 2758
188 Ga0207705_10006541 3300025909 Bacteria 8632
189 Ga0207705_10216530 3300025909 Bacteria 1453
190 Ga0207705_10251157 3300025909 Bacteria 1349
191 Ga0207684_10119982 3300025910 Bacteria 2254
192 Ga0207654_10003430 3300025911 Bacteria 8015
193 Ga0207654_10068361 3300025911 Bacteria 2101
194 Ga0207707_10015539 3300025912 Bacteria 6630
195 Ga0207707_10017840 3300025912 Bacteria 6190
196 Ga0207707_10059169 3300025912 Bacteria 3334
197 Ga0207695_10175228 3300025913 Bacteria 2067
198 Ga0207671_10110598 3300025914 Bacteria 2090
199 Ga0207693_10003822 3300025915 Bacteria 12827
200 Ga0207663_10039730 3300025916 Bacteria 2853
201 Ga0207662_10040704 3300025918 Bacteria 2733
202 Ga0207657_10016104 3300025919 Bacteria 7218
203 Ga0207657_10409556 3300025919 Bacteria 1066
204 Ga0207649_10081414 3300025920 Bacteria 2096
205 Ga0207649_10117731 3300025920 Bacteria 1786
206 Ga0207652_10006364 3300025921 Bacteria 9535
207 Ga0207652_10017291 3300025921 Bacteria 5899
208 Ga0207646_10053775 3300025922 Bacteria 3601
209 Ga0207681_10063046 3300025923 Bacteria 2555
210 Ga0207681_10089076 3300025923 Bacteria 2199
211 Ga0207650_10193562 3300025925 Bacteria 1626
212 Ga0207650_10316839 3300025925 Bacteria 1277
213 Ga0207659_10083431 3300025926 Bacteria 2369
214 Ga0207659_10127452 3300025926 Bacteria 1959
215 Ga0207687_10051934 3300025927 Bacteria 2859
216 Ga0207687_10240179 3300025927 Bacteria 1435
217 Ga0207700_10047207 3300025928 Bacteria 3191
218 Ga0207664_10062284 3300025929 Bacteria 2979
219 Ga0207690_10115138 3300025932 Bacteria 1943
220 Ga0207706_10028322 3300025933 Bacteria 5003
221 Ga0207706_10107502 3300025933 Bacteria 2455
222 Ga0207706_10282412 3300025933 Bacteria 1447
223 Ga0207686_10068859 3300025934 Bacteria 2268
224 Ga0207709_10027813 3300025935 Bacteria 3263
225 Ga0207669_10004960 3300025937 Bacteria 5920
226 Ga0207669_10052028 3300025937 Bacteria 2458
227 Ga0207669_10205669 3300025937 Bacteria 1433
228 Ga0207665_10003894 3300025939 Bacteria 9984
229 Ga0207691_10016444 3300025940 Bacteria 7022
230 Ga0207691_10239251 3300025940 Bacteria 1570
231 Ga0207711_10082201 3300025941 Bacteria 2815
232 Ga0207711_10131333 3300025941 Bacteria 2246
233 Ga0207689_10181564 3300025942 Bacteria 1735
234 Ga0207661_10000879 3300025944 Bacteria 19757
235 Ga0207661_10141995 3300025944 Bacteria 2067
236 Ga0207679_10038891 3300025945 Bacteria 3394
237 Ga0207679_10067239 3300025945 Bacteria 2688
238 Ga0207667_10015772 3300025949 Bacteria 8567
239 Ga0207667_10058484 3300025949 Bacteria 4043
240 Ga0207668_10072624 3300025972 Bacteria 2462
241 Ga0207640_10264241 3300025981 Bacteria 1343
242 Ga0207658_10025279 3300025986 Bacteria 4158
243 Ga0207677_10065583 3300026023 Bacteria 2534
244 Ga0207677_10126182 3300026023 Bacteria 1934
245 Ga0207703_10083088 3300026035 Bacteria 2675
246 Ga0207703_10116891 3300026035 Bacteria 2284
247 Ga0207703_10227101 3300026035 Bacteria 1672
248 Ga0207703_10320324 3300026035 Bacteria 1420
249 Ga0207703_10340095 3300026035 Bacteria 1379
250 Ga0207639_10085591 3300026041 Bacteria 2507
251 Ga0207678_10003691 3300026067 Bacteria 13762
252 Ga0207678_10076471 3300026067 Bacteria 2867
253 Ga0207678_10206056 3300026067 Bacteria 1682
254 Ga0207678_10261938 3300026067 Bacteria 1482
255 Ga0207708_10157527 3300026075 Bacteria 1792
256 Ga0207702_10000414 3300026078 Bacteria 48824
257 Ga0207702_10191797 3300026078 Bacteria 1889
258 Ga0207702_10277103 3300026078 Bacteria 1584
259 Ga0207641_10124501 3300026088 Bacteria 2306
260 Ga0207641_10153590 3300026088 Bacteria 2087
261 Ga0207648_10111412 3300026089 Bacteria 2403
262 Ga0207648_10237852 3300026089 Bacteria 1621
263 Ga0207674_10023338 3300026116 Bacteria 6629
264 Ga0207675_100171903 3300026118 Bacteria 2071
265 Ga0207683_10229243 3300026121 Bacteria 1693
266 Ga0207683_10366148 3300026121 Bacteria 1324
267 Ga0207698_10127824 3300026142 Bacteria 2165
268 Ga0207698_10306484 3300026142 Bacteria 1481
269 Ga0209389_1000077 3300027296 Bacteria 91273
270 Ga0209589_1000011 3300027357 Bacteria 236981
271 Ga0209489_100012 3300027361 Bacteria 236981
272 Ga0209489_100251 3300027361 Bacteria 91273
273 Ga0209700_100019 3300027363 Bacteria 236981
274 Ga0209700_100271 3300027363 Bacteria 91215
275 Ga0207428_10224954 3300027907 Bacteria 1405
276 Ga0268266_10002986 3300028379 Bacteria 17442
277 Ga0268266_10232329 3300028379 Bacteria 1699
278 Ga0268265_10013205 3300028380 Bacteria 5611
279 Ga0268265_10044450 3300028380 Bacteria 3307
280 Ga0268265_10289550 3300028380 Bacteria 1470
281 Ga0268264_10000030 3300028381 Bacteria 418542
282 Ga0307517_10000386 3300028786 Bacteria 75442
283 Ga0307515_10009804 3300028794 Bacteria 18452
284 Ga0307512_10144844 3300030522 Bacteria 1441
285 Ga0265332_10046928 3300031238 Bacteria 1860
286 Ga0307513_10196993 3300031456 Bacteria 1860
287 Ga0307509_10075783 3300031507 Bacteria 3493
288 Ga0307509_10269423 3300031507 Bacteria 1471
289 Ga0307508_10115965 3300031616 Bacteria 2280
290 Ga0307508_10157547 3300031616 Bacteria 1874
291 Ga0265314_10001188 3300031711 Bacteria 29895
292 Ga0265342_10055007 3300031712 Bacteria 2364
293 Ga0307516_10000939 3300031730 Bacteria 40200
294 Ga0307516_10076248 3300031730 Bacteria 3206
295 Ga0307516_10206235 3300031730 Bacteria 1682
296 Ga0307406_10113799 3300031901 Bacteria 1868
297 Ga0307411_10025196 3300032005 Bacteria 3560
298 Ga0307507_10085869 3300033179 Bacteria 2734
299 Ga0307510_10030787 3300033180 Bacteria 6077
300 Ga0307510_10057657 3300033180 Bacteria 4028
301 Ga0307510_10138063 3300033180 Bacteria 2090
302 Ga0315911_1000003 3300033442 Bacteria 502217
303 Ga0316215_1003530 3300033544 Bacteria 1492
304 Ga0373928_0027821 3300035084 Bacteria 1233
305 Ga0373929_0016007 3300035085 Bacteria 1465
306 Ga0373934_0040949 3300035086 Bacteria 1828
307 Ga0373944_0008813 3300035089 Bacteria 2727
308 Ga0373944_0026305 3300035089 Bacteria 1718
309 Ga0373944_0029826 3300035089 Bacteria 1633
310 Ga0373923_0001708 3300035111 Bacteria 6440
311 Ga0373936_0009455 3300035113 Bacteria 3676
312 Ga0373936_0053600 3300035113 Bacteria 1636
313 Ga0373936_0055610 3300035113 Bacteria 1607
314 Ga0373936_0073580 3300035113 Bacteria 1413
315 Ga0373945_0017533 3300035116 Bacteria 2425
316 Ga0373945_0031429 3300035116 Bacteria 1876
317 Ga0373954_0013045 3300035118 Bacteria 3699
318 Ga0373956_0014989 3300035119 Bacteria 3242
319 Ga0373956_0020073 3300035119 Bacteria 2839
320 Ga0373957_0001196 3300035120 Bacteria 6939
321 Ga0373943_0013236 3300035170 Bacteria 3724
322 Ga0373943_0025476 3300035170 Bacteria 2765
323 Ga0373943_0069693 3300035170 Bacteria 1778
324 Ga0373943_0092370 3300035170 Bacteria 1569
325 Ga0373946_0002425 3300035171 Bacteria 6596
326 Ga0373955_0000956 3300035172 Bacteria 12321
327 Ga0373955_0007308 3300035172 Bacteria 5074
328 Ga0373935_0000424 3300035692 Bacteria 22007
329 Ga0373935_0049140 3300035692 Bacteria 2672
330 Ga0373935_0284643 3300035692 Bacteria 1164
331 Ga0373927_0010213 3300035695 Bacteria 6272
332 Ga0373927_0017385 3300035695 Bacteria 4733
333 Ga0373927_0018609 3300035695 Bacteria 4561
334 Ga0373927_0019865 3300035695 Bacteria 4405
335 Ga0373927_0021331 3300035695 Bacteria 4245
336 Ga0373933_0003417 3300035724 Bacteria 8851
337 Ga0373933_0023750 3300035724 Bacteria 3505
338 Ga0373933_0069648 3300035724 Bacteria 2139
339 Ga0373947_0001385 3300035725 Bacteria 14937
340 Ga0373947_0006895 3300035725 Bacteria 6585
341 Ga0373947_0050361 3300035725 Bacteria 2504
342 Ga0373947_0063618 3300035725 Bacteria 2248
343 Ga0373937_0027696 3300036401 Bacteria 5127
344 Ga0373937_0034455 3300036401 Bacteria 4606
345 Ga0373925_0012039 3300037068 Bacteria 6264
346 Ga0373925_0023527 3300037068 Bacteria 4495
347 Ga0373925_0029824 3300037068 Bacteria 4001
348 Ga0373925_0032464 3300037068 Bacteria 3843
349 Ga0373925_0034946 3300037068 Bacteria 3706
350 Ga0373925_0056395 3300037068 Bacteria 2943
351 Ga0395899_0006839 3300037312 Bacteria 8835
352 Ga0395900_0005550 3300037418 Bacteria 13206
353 Ga0395900_0006232 3300037418 Bacteria 12449
354 Ga0395898_0032295 3300037466 Bacteria 5225
355 Ga0395898_0104054 3300037466 Bacteria 2723
356 Ga0395905_0003367 3300037471 Bacteria 17136
357 Ga0395901_0028747 3300038443 Bacteria 5719
358 Ga0395901_0041302 3300038443 Bacteria 4779
359 Ga0395901_0100559 3300038443 Bacteria 3033
360 Ga0395901_0188212 3300038443 Bacteria 2165
361 Ga0436360_0462666 3300039438 Bacteria 13281
362 Ga0451800_0868857 3300041459 Bacteria 1243
363 Ga0451577_0014843 3300042876 Bacteria 7257
364 Ga0466972_0000113 3300044658 Bacteria 69042
365 Ga0466965_0008177 3300044683 Bacteria 4832
366 Ga0466966_0000398 3300044684 Bacteria 28025
367 Ga0466961_0000005 3300044693 Bacteria 173105
368 Ga0466960_0022833 3300044901 Bacteria 2801
369 Ga0466959_0000670 3300045049 Bacteria 20009
370 Ga0451576_0029621 3300045051 Bacteria 5857
371 Ga0451576_0129184 3300045051 Bacteria 2634
372 Ga0466967_0056707 3300045976 Bacteria 3455
373 Ga0466967_0058132 3300045976 Bacteria 3417
374 Ga0466967_0280833 3300045976 Bacteria 1598
375 Ga0495592_0010638 3300046454 Bacteria 6937
376 Ga0495592_0018813 3300046454 Bacteria 5260
377 Ga0495592_0058300 3300046454 Bacteria 2848
378 Ga0495592_0238170 3300046454 Bacteria 1209
379 Ga0495603_0000003 3300046455 Bacteria 83533
380 Ga0495629_0002388 3300046459 Bacteria 14446
381 Ga0495629_0009839 3300046459 Bacteria 6977
382 Ga0495629_0086032 3300046459 Bacteria 2193
383 Ga0495638_0000392 3300046460 Bacteria 53945
384 Ga0495641_0009506 3300046461 Bacteria 5768
385 Ga0495651_0002716 3300046462 Bacteria 13730
386 Ga0495651_0075007 3300046462 Bacteria 2565
387 Ga0495653_0095296 3300046463 Bacteria 2167
388 Ga0495580_0001857 3300046472 Bacteria 18580
389 Ga0495580_0011167 3300046472 Bacteria 6956
390 Ga0495582_0000016 3300046473 Bacteria 100714
391 Ga0495582_0044998 3300046473 Bacteria 2431
392 Ga0495605_0062889 3300046474 Bacteria 1772
393 Ga0495639_0000075 3300046475 Bacteria 46617
394 Ga0495662_0011526 3300046476 Bacteria 4320
395 Ga0495662_0033000 3300046476 Bacteria 2501
396 Ga0495664_0003066 3300046477 Bacteria 9054
397 Ga0495664_0008072 3300046477 Bacteria 5859
398 Ga0495664_0011974 3300046477 Bacteria 4901
399 Ga0495664_0019306 3300046477 Bacteria 3917
400 Ga0495664_0075124 3300046477 Bacteria 2022
401 Ga0495584_0049936 3300046491 Bacteria 2107
402 Ga0495594_0000120 3300046499 Bacteria 36823
403 Ga0495596_0036158 3300046500 Bacteria 1957
404 Ga0495606_0001387 3300046507 Bacteria 32754
405 Ga0495618_0048104 3300046514 Bacteria 2692
406 Ga0495618_0062734 3300046514 Bacteria 2359
407 Ga0495628_0051250 3300046516 Bacteria 3263
408 Ga0495630_0037982 3300046517 Bacteria 3601
409 Ga0495630_0321750 3300046517 Bacteria 1182
410 Ga0495666_0127627 3300046526 Bacteria 1189
411 Ga0495652_0011876 3300046529 Bacteria 7872
412 Ga0495652_0014719 3300046529 Bacteria 7013
413 Ga0495652_0060328 3300046529 Bacteria 3206
414 Ga0495654_0087994 3300046530 Bacteria 1445
415 Ga0495665_0000270 3300046531 Bacteria 26319
416 Ga0495640_0000210 3300046533 Bacteria 38945
417 Ga0495640_0020628 3300046533 Bacteria 4848
418 Ga0495640_0034237 3300046533 Bacteria 3604
419 Ga0495640_0038421 3300046533 Bacteria 3367
420 Ga0495587_0039151 3300046536 Bacteria 2839
421 Ga0495587_0043439 3300046536 Bacteria 2676
422 Ga0495645_0012046 3300046543 Bacteria 6094
423 Ga0495645_0020206 3300046543 Bacteria 4802
424 Ga0495645_0155296 3300046543 Bacteria 1586
425 Ga0495622_0003400 3300046557 Bacteria 7500
426 Ga0495622_0062233 3300046557 Bacteria 1727
427 Ga0495667_0024058 3300046559 Bacteria 4102
428 Ga0495667_0054939 3300046559 Bacteria 2619
429 Ga0495634_0000064 3300046642 Bacteria 85710
430 Ga0495634_0008410 3300046642 Bacteria 7687
431 Ga0495634_0023703 3300046642 Bacteria 4311
432 Ga0495625_0140979 3300046660 Bacteria 1626
433 Ga0495635_0000316 3300046663 Bacteria 31407
434 Ga0495635_0031259 3300046663 Bacteria 3697
435 Ga0495635_0104993 3300046663 Bacteria 1930
436 Ga0495588_0004843 3300046674 Bacteria 5964
437 Ga0495588_0014430 3300046674 Bacteria 3782
438 Ga0495588_0048145 3300046674 Bacteria 2190
439 Ga0495657_0010591 3300046675 Bacteria 6929
440 Ga0495657_0103560 3300046675 Bacteria 1810
441 Ga0495599_0065618 3300046678 Bacteria 2268
442 Ga0495623_0020849 3300046679 Bacteria 4236
443 Ga0495623_0071074 3300046679 Bacteria 2166
444 Ga0495646_0055284 3300046680 Bacteria 2384
445 Ga0495646_0057415 3300046680 Bacteria 2330
446 Ga0495647_0023006 3300046681 Bacteria 2256
447 Ga0495647_0053037 3300046681 Bacteria 1580
448 Ga0495658_0002630 3300046683 Bacteria 9021
449 Ga0495669_0037455 3300046684 Bacteria 2146
450 Ga0495613_0004076 3300046689 Bacteria 10922
451 Ga0495613_0072130 3300046689 Bacteria 2517
452 Ga0495613_0084854 3300046689 Bacteria 2299
453 Ga0495624_0010653 3300046690 Bacteria 6332
454 Ga0495624_0024452 3300046690 Bacteria 3974
455 Ga0495649_0145846 3300046694 Bacteria 1245
456 Ga0495600_0086233 3300046809 Bacteria 2049
457 Ga0495600_0117870 3300046809 Bacteria 1727
458 Ga0495581_0000014 3300047315 Bacteria 60735
459 Ga0495604_0019282 3300047317 Bacteria 5459
460 Ga0495604_0045443 3300047317 Bacteria 3427
461 Ga0495604_0220204 3300047317 Bacteria 1307
462 Ga0495674_0001069 3300047319 Bacteria 26383
463 Ga0495674_0002679 3300047319 Bacteria 17337
464 Ga0495674_0007246 3300047319 Bacteria 10615
465 Ga0495676_0059798 3300047321 Bacteria 2990
466 Ga0495676_0088677 3300047321 Bacteria 2319
467 Ga0495676_0211683 3300047321 Bacteria 1341
468 Ga0495680_0002674 3300047322 Bacteria 17996
469 Ga0495680_0011794 3300047322 Bacteria 7720
470 Ga0495683_0124322 3300047323 Bacteria 1222
471 Ga0495675_0007708 3300047444 Bacteria 6639
472 Ga0495684_0002682 3300047471 Bacteria 14099
473 Ga0495684_0007582 3300047471 Bacteria 8396
474 Ga0495684_0026033 3300047471 Bacteria 4496
475 Ga0495684_0215353 3300047471 Bacteria 1410
476 Ga0495593_0000003 3300047673 Bacteria 120744
477 Ga0495593_0001206 3300047673 Bacteria 15113
478 Ga0495593_0005968 3300047673 Bacteria 7173
479 Ga0495602_0031427 3300048088 Bacteria 5020
480 Ga0495614_0013203 3300048089 Bacteria 3624
481 Ga0496101_0061143 3300048904 Bacteria 2735
482 Ga0496102_0066002 3300048905 Bacteria 3317
483 Ga0496102_0179249 3300048905 Bacteria 1996
484 Ga0496102_0200361 3300048905 Bacteria 1882
485 Ga0496103_0024383 3300048906 Bacteria 3652
486 Ga0496103_0026161 3300048906 Bacteria 3532
487 Ga0496103_0137332 3300048906 Bacteria 1563
488 Ga0496104_0007868 3300048907 Bacteria 9449
489 Ga0496104_0039268 3300048907 Bacteria 4431
490 Ga0496105_0007252 3300048908 Bacteria 8560
491 Ga0496105_0139800 3300048908 Bacteria 1993
492 Ga0496106_0019837 3300048909 Bacteria 4985
493 Ga0496107_0002644 3300048910 Bacteria 11717
494 Ga0496108_0153982 3300048911 Bacteria 1984
495 Ga0496109_0030452 3300048912 Bacteria 4836
496 Ga0496109_0220267 3300048912 Bacteria 1784
497 Ga0496109_0294941 3300048912 Bacteria 1529
498 Ga0496110_0020128 3300048913 Bacteria 5629
499 Ga0496110_0026150 3300048913 Bacteria 4991
500 Ga0496111_0010633 3300048914 Bacteria 6184
501 Ga0496111_0177062 3300048914 Bacteria 1585
502 Ga0496112_0027239 3300048915 Bacteria 5511
503 Ga0496112_0124684 3300048915 Bacteria 2547
504 Ga0496112_0242010 3300048915 Bacteria 1757
505 Ga0496112_0425728 3300048915 Bacteria 1266
506 Ga0496114_0081234 3300048917 Bacteria 2738
507 Ga0496114_0127978 3300048917 Bacteria 2191
508 Ga0496115_0003047 3300048918 Bacteria 12028
509 Ga0496115_0107351 3300048918 Bacteria 2292
510 Ga0496116_0023995 3300048919 Bacteria 4524
511 Ga0496119_0017624 3300048922 Bacteria 5364
512 Ga0496121_0029799 3300048924 Bacteria 5031
513 Ga0496121_0034261 3300048924 Bacteria 4573
514 Ga0496121_0035413 3300048924 Bacteria 4475
515 Ga0496121_0038100 3300048924 Bacteria 4263
516 Ga0496121_0144458 3300048924 Bacteria 1760
517 Ga0496121_0155084 3300048924 Bacteria 1681
518 Ga0496126_0007029 3300048929 Bacteria 12417
519 Ga0496126_0020185 3300048929 Bacteria 6539
520 Ga0496126_0129432 3300048929 Bacteria 2182
521 Ga0496126_0252466 3300048929 Bacteria 1469
522 Ga0496126_0383247 3300048929 Bacteria 1144
523 Ga0501034_0378394 3300049571 Bacteria 1341
524 Ga0501036_0143300 3300049572 Bacteria 2016
525 Ga0501047_0006540 3300049581 Bacteria 10972
526 Ga0501069_0090306 3300049585 Bacteria 1732
527 Ga0501070_0004771 3300049586 Bacteria 11605
528 Ga0501080_0058215 3300049742 Bacteria 3597
529 Ga0501080_0277958 3300049742 Bacteria 1523
530 Ga0501035_0120970 3300049822 Bacteria 2289
531 nmdc:mga03n38_20946_c1 3300050490 Bacteria 2624
532 nmdc:mga0yw44_173002_c1 3300050492 Bacteria 1419
533 nmdc:mga0yw44_81973_c1 3300050492 Bacteria 2023
534 nmdc:mga0k408_10653_c1 3300050493 Bacteria 4978
535 nmdc:mga0k408_262871_c1 3300050493 Bacteria 1030
536 nmdc:mga06z11_1257_c1 3300050494 Bacteria 9144
537 nmdc:mga06z11_56355_c1 3300050494 Bacteria 2033
538 nmdc:mga07m45_11460_c1 3300050496 Bacteria 4658
539 nmdc:mga05p37_283809_c1 3300050507 Bacteria 1973
540 nmdc:mga08y16_217282_c1 3300050511 Bacteria 1979
541 nmdc:mga0n895_242940_c1 3300050512 Bacteria 1827
542 nmdc:mga0n895_512365_c1 3300050512 Bacteria 1208
543 nmdc:mga0rr50_61425_c1 3300050513 Bacteria 2831
544 nmdc:mga0sz30_60358_c1 3300050516 Bacteria 1619
545 Ga0495601_0032907 3300053077 Bacteria 3229
546 Ga0495601_0080098 3300053077 Bacteria 2095
547 Ga0495601_0106355 3300053077 Bacteria 1815
548 Ga0500635_0030075 3300053080 Bacteria 1748
549 Ga0500643_000218 3300053087 Bacteria 53579
550 Ga0500583_0014376 3300053092 Bacteria 3097
551 Ga0500566_0003699 3300053094 Bacteria 9135
552 Ga0500566_0007050 3300053094 Bacteria 6655
553 Ga0500566_0052932 3300053094 Bacteria 2318
554 Ga0500641_0030039 3300053096 Bacteria 2132
555 Ga0500555_011063 3300053103 Bacteria 2591
556 Ga0500595_000898 3300053119 Bacteria 16951
557 Ga0500595_010401 3300053119 Bacteria 3699
558 Ga0500642_0000922 3300053130 Bacteria 8545
559 Ga0500559_0083706 3300053136 Bacteria 1453
560 Ga0500603_014567 3300053150 Bacteria 1838
561 Ga0500616_0009445 3300053153 Bacteria 5932
562 Ga0500616_0055964 3300053153 Bacteria 2060
563 Ga0500637_0000103 3300053178 Bacteria 30634
564 Ga0500637_0126908 3300053178 Bacteria 1479
565 Ga0500599_002035 3300053736 Bacteria 2395
566 Ga0500661_001897 3300055283 Bacteria 3944
567 Ga0466962_0088834 3300061719 Bacteria 1480

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041459 Ga0451800_0868857 Ga0451800_0868857_294_1112 268
2 3300047321 Ga0495676_0088677 Ga0495676_0088677_10_846 278
3 3300050492 nmdc:mga0yw44_173002_c1 nmdc:mga0yw44_173002_c1_543_1409 288
4 3300050493 nmdc:mga0k408_262871_c1 nmdc:mga0k408_262871_c1_150_1016 288
5 3300005937 Ga0081455_10000391 Ga0081455_1000039141 292
6 3300050512 nmdc:mga0n895_512365_c1 nmdc:mga0n895_512365_c1_35_925 295
7 3300005937 Ga0081455_10049326 Ga0081455_100493263 298
8 3300047673 Ga0495593_0001206 Ga0495593_0001206_13327_14250 303
9 3300050496 nmdc:mga07m45_11460_c1 nmdc:mga07m45_11460_c1_2891_3829 308
10 3300046460 Ga0495638_0000392 Ga0495638_0000392_42981_43976 309
11 3300053153 Ga0500616_0009445 Ga0500616_0009445_1074_2060 309
12 3300053153 Ga0500616_0055964 Ga0500616_0055964_412_1407 309
13 3300039438 Ga0436360_0462666 Ga0436360_0462666_8141_9076 310
14 3300045051 Ga0451576_0129184 Ga0451576_0129184_1282_2277 312
15 3300048929 Ga0496126_0252466 Ga0496126_0252466_517_1455 312
16 3300049742 Ga0501080_0277958 Ga0501080_0277958_12_953 313
17 3300042876 Ga0451577_0014843 Ga0451577_0014843_4714_5679 314
18 3300005329 Ga0070683_100022696 Ga0070683_1000226964 315
19 3300005616 Ga0068852_100026620 Ga0068852_1000266203 315
20 3300005719 Ga0068861_100248684 Ga0068861_1002486842 315
21 3300005843 Ga0068860_100329767 Ga0068860_1003297672 315
22 3300009551 Ga0105238_10025466 Ga0105238_100254663 315
23 3300010375 Ga0105239_10427226 Ga0105239_104272262 315
24 3300013102 Ga0157371_10118731 Ga0157371_101187312 315
25 3300013105 Ga0157369_10183167 Ga0157369_101831673 315
26 3300025944 Ga0207661_10141995 Ga0207661_101419952 315
27 3300025945 Ga0207679_10067239 Ga0207679_100672392 315
28 3300026078 Ga0207702_10277103 Ga0207702_102771032 315
29 3300026142 Ga0207698_10127824 Ga0207698_101278242 315
30 3300035113 Ga0373936_0055610 Ga0373936_0055610_16_987 315
31 3300035170 Ga0373943_0013236 Ga0373943_0013236_1623_2594 315
32 3300035692 Ga0373935_0049140 Ga0373935_0049140_1627_2598 315
33 3300035695 Ga0373927_0018609 Ga0373927_0018609_3297_4268 315
34 3300035724 Ga0373933_0069648 Ga0373933_0069648_149_1120 315
35 3300035725 Ga0373947_0006895 Ga0373947_0006895_4078_5049 315
36 3300037068 Ga0373925_0023527 Ga0373925_0023527_3407_4378 315
37 3300037418 Ga0395900_0005550 Ga0395900_0005550_10634_11581 315
38 3300038443 Ga0395901_0028747 Ga0395901_0028747_3562_4509 315
39 3300045976 Ga0466967_0056707 Ga0466967_0056707_2123_3070 315
40 3300049571 Ga0501034_0378394 Ga0501034_0378394_273_1220 315
41 3300005327 Ga0070658_10022995 Ga0070658_100229952 316
42 3300005336 Ga0070680_100003467 Ga0070680_1000034679 316
43 3300005341 Ga0070691_10098321 Ga0070691_100983212 316
44 3300005355 Ga0070671_100130024 Ga0070671_1001300242 316
45 3300005471 Ga0070698_100031688 Ga0070698_1000316883 316
46 3300005518 Ga0070699_100010113 Ga0070699_1000101136 316
47 3300005536 Ga0070697_100018658 Ga0070697_1000186582 316
48 3300005563 Ga0068855_100089170 Ga0068855_1000891704 316
49 3300005841 Ga0068863_100455703 Ga0068863_1004557032 316
50 3300006195 Ga0075366_10228167 Ga0075366_102281671 316
51 3300009093 Ga0105240_10026930 Ga0105240_100269305 316
52 3300009093 Ga0105240_10075210 Ga0105240_100752102 316
53 3300025909 Ga0207705_10006541 Ga0207705_100065415 316
54 3300025910 Ga0207684_10119982 Ga0207684_101199822 316
55 3300025912 Ga0207707_10017840 Ga0207707_100178404 316
56 3300025913 Ga0207695_10175228 Ga0207695_101752282 316
57 3300025919 Ga0207657_10409556 Ga0207657_104095562 316
58 3300025921 Ga0207652_10006364 Ga0207652_100063645 316
59 3300025925 Ga0207650_10193562 Ga0207650_101935622 316
60 3300025949 Ga0207667_10015772 Ga0207667_100157724 316
61 3300026088 Ga0207641_10153590 Ga0207641_101535902 316
62 3300028380 Ga0268265_10289550 Ga0268265_102895502 316
63 3300037312 Ga0395899_0006839 Ga0395899_0006839_6013_6975 316
64 3300038443 Ga0395901_0041302 Ga0395901_0041302_1944_2906 316
65 3300045051 Ga0451576_0029621 Ga0451576_0029621_2848_3819 316
66 iso_pu_bacteria 2922386360 2922386960 316
67 3300005366 Ga0070659_100165406 Ga0070659_1001654062 317
68 3300005564 Ga0070664_100017524 Ga0070664_1000175243 317
69 3300005843 Ga0068860_100022237 Ga0068860_1000222375 317
70 3300006051 Ga0075364_10117840 Ga0075364_101178402 317
71 3300013307 Ga0157372_10089357 Ga0157372_100893572 317
72 3300050493 nmdc:mga0k408_10653_c1 nmdc:mga0k408_10653_c1_1530_2486 317
73 iso_pu_bacteria 2791355197 2793066532 317
74 iso_pu_bacteria 2904699407 2904701075 317
75 iso_pu_bacteria 3005474847 3005481432 317
76 3300005578 Ga0068854_100223156 Ga0068854_1002231562 318
77 3300005614 Ga0068856_100000147 Ga0068856_1000001472 318
78 3300005983 Ga0081540_1041454 Ga0081540_10414542 318
79 3300025981 Ga0207640_10264241 Ga0207640_102642411 318
80 3300026078 Ga0207702_10000414 Ga0207702_1000041442 318
81 3300031711 Ga0265314_10001188 Ga0265314_1000118813 318
82 3300031712 Ga0265342_10055007 Ga0265342_100550072 318
83 iso_pu_bacteria 2513237096 2513657108 318
84 iso_pu_bacteria 2513237137 2513856996 318
85 iso_pu_bacteria 2513237145 2513919116 318
86 iso_pu_bacteria 2517572143 2517891189 318
87 iso_pu_bacteria 2524023228 2524533624 318
88 iso_pu_bacteria 2667528175 2671123210 318
89 iso_pu_bacteria 2728368998 2728755556 318
90 iso_pu_bacteria 2885374607 2885376881 318
91 iso_pu_bacteria 2903748898 2903749690 318
92 iso_pu_bacteria 2904690495 2904698900 318
93 iso_pu_bacteria 2906610324 2906616368 318
94 iso_pu_bacteria 2906635258 2906638173 318
95 iso_pu_bacteria 2906660503 2906662848 318
96 iso_pu_bacteria 2908739725 2908741507 318
97 iso_pu_bacteria 2908756301 2908758696 318
98 iso_pu_bacteria 2922425934 2922431631 318
99 iso_pu_bacteria 2935630451 2935635815 318
100 iso_pu_bacteria 2941507105 2941512348 318
101 iso_pu_bacteria 2941515067 2941520147 318
102 iso_pu_bacteria 2941523033 2941528296 318
103 iso_pu_bacteria 3005718088 3005723314 318
104 iso_pu_bacteria 8006933436 8006939285 318
105 iso_pu_bacteria 8006973647 8006978943 318
106 iso_pu_bacteria 8019565922 8019575250 318
107 iso_pu_bacteria 8056689827 8056690644 318
108 3300006943 Ga0099822_1005398 Ga0099822_10053982 319
109 3300007788 Ga0099795_10028287 Ga0099795_100282872 319
110 3300009177 Ga0105248_10089840 Ga0105248_100898402 319
111 3300009545 Ga0105237_10090926 Ga0105237_100909264 319
112 3300013297 Ga0157378_10079518 Ga0157378_100795182 319
113 3300021441 Ga0213871_10000172 Ga0213871_100001724 319
114 3300025899 Ga0207642_10130686 Ga0207642_101306862 319
115 3300025941 Ga0207711_10131333 Ga0207711_101313332 319
116 3300026035 Ga0207703_10340095 Ga0207703_103400952 319
117 3300026121 Ga0207683_10229243 Ga0207683_102292431 319
118 3300027357 Ga0209589_1000011 Ga0209589_100001173 319
119 3300027361 Ga0209489_100012 Ga0209489_10001273 319
120 3300027363 Ga0209700_100019 Ga0209700_10001973 319
121 3300028786 Ga0307517_10000386 Ga0307517_1000038610 319
122 3300028794 Ga0307515_10009804 Ga0307515_100098046 319
123 3300031616 Ga0307508_10115965 Ga0307508_101159652 319
124 3300033180 Ga0307510_10057657 Ga0307510_100576573 319
125 3300033442 Ga0315911_1000003 Ga0315911_1000003477 319
126 3300035084 Ga0373928_0027821 Ga0373928_0027821_238_1215 319
127 3300035113 Ga0373936_0009455 Ga0373936_0009455_1176_2174 319
128 3300037068 Ga0373925_0034946 Ga0373925_0034946_621_1598 319
129 3300048904 Ga0496101_0061143 Ga0496101_0061143_743_1720 319
130 3300048906 Ga0496103_0026161 Ga0496103_0026161_1072_2049 319
131 3300048910 Ga0496107_0002644 Ga0496107_0002644_7603_8580 319
132 3300048911 Ga0496108_0153982 Ga0496108_0153982_20_997 319
133 3300048913 Ga0496110_0020128 Ga0496110_0020128_1387_2364 319
134 3300048914 Ga0496111_0010633 Ga0496111_0010633_86_1063 319
135 iso_pu_bacteria 2511231028 2511398135 319
136 iso_pu_bacteria 2513237101 2513693683 319
137 iso_pu_bacteria 2513237102 2513703426 319
138 iso_pu_bacteria 2513237104 2513720828 319
139 iso_pu_bacteria 2513237139 2513878306 319
140 iso_pu_bacteria 2528768022 2528855245 319
141 iso_pu_bacteria 2617270735 2617352767 319
142 iso_pu_bacteria 2617270741 2617372890 319
143 iso_pu_bacteria 2721755755 2723843544 319
144 iso_pu_bacteria 2791355196 2793061037 319
145 iso_pu_bacteria 2802429603 2805920529 319
146 iso_pu_bacteria 2824600985 2824602945 319
147 iso_pu_bacteria 2824609381 2824611832 319
148 iso_pu_bacteria 2824617872 2824621534 319
149 iso_pu_bacteria 2824626560 2824630646 319
150 iso_pu_bacteria 2824635225 2824638650 319
151 iso_pu_bacteria 2824644064 2824646574 319
152 iso_pu_bacteria 2824653114 2824655063 319
153 iso_pu_bacteria 2824661429 2824664447 319
154 iso_pu_bacteria 2824679649 2824682212 319
155 iso_pu_bacteria 2824696289 2824697686 319
156 iso_pu_bacteria 2824714736 2824717044 319
157 iso_pu_bacteria 2824723954 2824727188 319
158 iso_pu_bacteria 2824732956 2824733975 319
159 iso_pu_bacteria 2824746037 2824748407 319
160 iso_pu_bacteria 2824773399 2824776626 319
161 iso_pu_bacteria 2842038055 2842040803 319
162 iso_pu_bacteria 2842045827 2842046251 319
163 iso_pu_bacteria 2847930680 2847937485 319
164 iso_pu_bacteria 2847939898 2847947910 319
165 iso_pu_bacteria 2849076700 2849078243 319
166 iso_pu_bacteria 2857509624 2857511393 319
167 iso_pu_bacteria 2874604998 2874611547 319
168 iso_pu_bacteria 2874620515 2874628232 319
169 iso_pu_bacteria 2879083081 2879084898 319
170 iso_pu_bacteria 2879099564 2879107873 319
171 iso_pu_bacteria 2881364244 2881370063 319
172 iso_pu_bacteria 2885366525 2885370124 319
173 iso_pu_bacteria 2888388044 2888392629 319
174 iso_pu_bacteria 2888419890 2888425758 319
175 iso_pu_bacteria 2889033259 2889037849 319
176 iso_pu_bacteria 2904666416 2904674149 319
177 iso_pu_bacteria 2906643746 2906645559 319
178 iso_pu_bacteria 2908775508 2908781339 319
179 iso_pu_bacteria 2922361189 2922361798 319
180 iso_pu_bacteria 2922393267 2922396912 319
181 iso_pu_bacteria 2929615660 2929621199 319
182 iso_pu_bacteria 2929624759 2929625970 319
183 iso_pu_bacteria 2932784394 2932785145 319
184 iso_pu_bacteria 2932809354 2932810171 319
185 iso_pu_bacteria 2932818245 2932821745 319
186 iso_pu_bacteria 2933577622 2933582932 319
187 iso_pu_bacteria 2935616580 2935619599 319
188 iso_pu_bacteria 2935638405 2935638579 319
189 iso_pu_bacteria 2935665750 2935666569 319
190 iso_pu_bacteria 2935675223 2935676386 319
191 iso_pu_bacteria 2935684952 2935691097 319
192 iso_pu_bacteria 2935694250 2935694472 319
193 iso_pu_bacteria 2935703347 2935703585 319
194 iso_pu_bacteria 2935713505 2935718478 319
195 iso_pu_bacteria 2935722832 2935727542 319
196 iso_pu_bacteria 2935732158 2935736245 319
197 iso_pu_bacteria 2935741537 2935745625 319
198 iso_pu_bacteria 2935750917 2935756006 319
199 iso_pu_bacteria 2935760218 2935760732 319
200 iso_pu_bacteria 2935801545 2935801722 319
201 iso_pu_bacteria 2935810662 2935814862 319
202 iso_pu_bacteria 2935827899 2935828073 319
203 iso_pu_bacteria 2935837841 2935842279 319
204 iso_pu_bacteria 2935855204 2935858085 319
205 iso_pu_bacteria 2935864058 2935867990 319
206 iso_pu_bacteria 2935873716 2935873987 319
207 iso_pu_bacteria 2935992306 2935993089 319
208 iso_pu_bacteria 2936002035 2936003001 319
209 iso_pu_bacteria 2936037263 2936040495 319
210 iso_pu_bacteria 2940556831 2940562019 319
211 iso_pu_bacteria 2941531003 2941531353 319
212 iso_pu_bacteria 2941538514 2941542327 319
213 iso_pu_bacteria 3005483717 3005485557 319
214 iso_pu_bacteria 3005506211 3005508277 319
215 iso_pu_bacteria 3005587118 3005588220 319
216 iso_pu_bacteria 3005594810 3005600479 319
217 iso_pu_bacteria 8006926726 8006928589 319
218 iso_pu_bacteria 8006964411 8006966909 319
219 iso_pu_bacteria 8006984368 8006984587 319
220 iso_pu_bacteria 8006994254 8006994580 319
221 iso_pu_bacteria 8016511872 8016520479 319
222 iso_pu_bacteria 8017057580 8017065095 319
223 iso_pu_bacteria 8019576017 8019584481 319
224 iso_pu_bacteria 8019586578 8019592252 319
225 iso_pu_bacteria 8019597564 8019599033 319
226 iso_pu_bacteria 8019608314 8019609338 319
227 iso_pu_bacteria 8019648815 8019649538 319
228 iso_pu_bacteria 8055742211 8055744939 319
229 iso_pu_bacteria 8056673599 8056680953 319
230 iso_pu_bacteria 8056967851 8056974909 319
231 3300005937 Ga0081455_10098396 Ga0081455_100983962 320
232 3300010159 Ga0099796_10017660 Ga0099796_100176602 320
233 iso_pu_bacteria 2791355199 2793083927 320
234 iso_pu_bacteria 2922368715 2922375881 320
235 3300005327 Ga0070658_10216746 Ga0070658_102167461 321
236 3300005329 Ga0070683_100036748 Ga0070683_1000367482 321
237 3300005337 Ga0070682_100131787 Ga0070682_1001317871 321
238 3300005338 Ga0068868_100078424 Ga0068868_1000784242 321
239 3300005435 Ga0070714_100042784 Ga0070714_1000427843 321
240 3300005445 Ga0070708_100297092 Ga0070708_1002970922 321
241 3300005455 Ga0070663_100065039 Ga0070663_1000650392 321
242 3300005455 Ga0070663_100143052 Ga0070663_1001430521 321
243 3300005467 Ga0070706_100186252 Ga0070706_1001862522 321
244 3300005548 Ga0070665_100012029 Ga0070665_1000120298 321
245 3300005564 Ga0070664_100063866 Ga0070664_1000638662 321
246 3300005985 Ga0081539_10020643 Ga0081539_100206432 321
247 3300006038 Ga0075365_10236499 Ga0075365_102364992 321
248 3300006048 Ga0075363_100008417 Ga0075363_1000084173 321
249 3300006178 Ga0075367_10001189 Ga0075367_100011898 321
250 3300006178 Ga0075367_10026850 Ga0075367_100268503 321
251 3300006353 Ga0075370_10064177 Ga0075370_100641772 321
252 3300006358 Ga0068871_100090784 Ga0068871_1000907842 321
253 3300007265 Ga0099794_10001856 Ga0099794_100018562 321
254 3300007265 Ga0099794_10024905 Ga0099794_100249052 321
255 3300009551 Ga0105238_10323288 Ga0105238_103232881 321
256 3300014968 Ga0157379_10330439 Ga0157379_103304392 321
257 3300025315 Ga0207697_10021166 Ga0207697_100211664 321
258 3300025909 Ga0207705_10251157 Ga0207705_102511572 321
259 3300025920 Ga0207649_10081414 Ga0207649_100814142 321
260 3300025922 Ga0207646_10053775 Ga0207646_100537753 321
261 3300025926 Ga0207659_10127452 Ga0207659_101274522 321
262 3300025927 Ga0207687_10051934 Ga0207687_100519342 321
263 3300025945 Ga0207679_10038891 Ga0207679_100388912 321
264 3300026023 Ga0207677_10065583 Ga0207677_100655832 321
265 3300026035 Ga0207703_10227101 Ga0207703_102271012 321
266 3300026035 Ga0207703_10320324 Ga0207703_103203241 321
267 3300026067 Ga0207678_10003691 Ga0207678_1000369111 321
268 3300026067 Ga0207678_10076471 Ga0207678_100764712 321
269 3300028379 Ga0268266_10002986 Ga0268266_100029866 321
270 3300035086 Ga0373934_0040949 Ga0373934_0040949_842_1807 321
271 3300035113 Ga0373936_0073580 Ga0373936_0073580_225_1190 321
272 3300035116 Ga0373945_0017533 Ga0373945_0017533_577_1542 321
273 3300035118 Ga0373954_0013045 Ga0373954_0013045_1750_2715 321
274 3300035119 Ga0373956_0020073 Ga0373956_0020073_1569_2534 321
275 3300035170 Ga0373943_0025476 Ga0373943_0025476_603_1568 321
276 3300035724 Ga0373933_0023750 Ga0373933_0023750_123_1088 321
277 3300035725 Ga0373947_0050361 Ga0373947_0050361_1333_2298 321
278 3300036401 Ga0373937_0027696 Ga0373937_0027696_117_1082 321
279 3300037068 Ga0373925_0012039 Ga0373925_0012039_2851_3816 321
280 3300046459 Ga0495629_0086032 Ga0495629_0086032_665_1642 321
281 3300046462 Ga0495651_0075007 Ga0495651_0075007_1477_2454 321
282 3300046472 Ga0495580_0011167 Ga0495580_0011167_1137_2102 321
283 3300046477 Ga0495664_0003066 Ga0495664_0003066_1345_2310 321
284 3300046514 Ga0495618_0048104 Ga0495618_0048104_1713_2678 321
285 3300046543 Ga0495645_0155296 Ga0495645_0155296_601_1566 321
286 3300046681 Ga0495647_0053037 Ga0495647_0053037_165_1130 321
287 3300046694 Ga0495649_0145846 Ga0495649_0145846_28_1017 321
288 3300047319 Ga0495674_0007246 Ga0495674_0007246_1534_2499 321
289 3300047471 Ga0495684_0002682 Ga0495684_0002682_4128_5093 321
290 3300047673 Ga0495593_0005968 Ga0495593_0005968_4936_5901 321
291 3300048914 Ga0496111_0177062 Ga0496111_0177062_421_1407 321
292 3300048915 Ga0496112_0425728 Ga0496112_0425728_142_1119 321
293 3300048924 Ga0496121_0038100 Ga0496121_0038100_2763_3740 321
294 3300048929 Ga0496126_0383247 Ga0496126_0383247_75_1052 321
295 3300049585 Ga0501069_0090306 Ga0501069_0090306_216_1196 321
296 3300050490 nmdc:mga03n38_20946_c1 nmdc:mga03n38_20946_c1_1294_2271 321
297 3300050492 nmdc:mga0yw44_81973_c1 nmdc:mga0yw44_81973_c1_34_1011 321
298 3300050494 nmdc:mga06z11_1257_c1 nmdc:mga06z11_1257_c1_4448_5425 321
299 3300053077 Ga0495601_0106355 Ga0495601_0106355_559_1545 321
300 3300053096 Ga0500641_0030039 Ga0500641_0030039_142_1119 321
301 3300061719 Ga0466962_0088834 Ga0466962_0088834_330_1295 321
302 3300003215 JGI25153J46596_10005917 JGI25153J46596_100059176 322
303 3300005327 Ga0070658_10062264 Ga0070658_100622643 322
304 3300005327 Ga0070658_10234674 Ga0070658_102346742 322
305 3300005329 Ga0070683_100120693 Ga0070683_1001206932 322
306 3300005336 Ga0070680_100014244 Ga0070680_1000142445 322
307 3300005338 Ga0068868_100134936 Ga0068868_1001349362 322
308 3300005339 Ga0070660_100066336 Ga0070660_1000663362 322
309 3300005344 Ga0070661_100300794 Ga0070661_1003007941 322
310 3300005347 Ga0070668_100018396 Ga0070668_1000183962 322
311 3300005353 Ga0070669_100114490 Ga0070669_1001144902 322
312 3300005353 Ga0070669_100152403 Ga0070669_1001524032 322
313 3300005355 Ga0070671_100436938 Ga0070671_1004369381 322
314 3300005434 Ga0070709_10000242 Ga0070709_1000024222 322
315 3300005434 Ga0070709_10006317 Ga0070709_100063175 322
316 3300005435 Ga0070714_100010247 Ga0070714_1000102472 322
317 3300005436 Ga0070713_100035256 Ga0070713_1000352563 322
318 3300005439 Ga0070711_100018414 Ga0070711_1000184142 322
319 3300005458 Ga0070681_10061957 Ga0070681_100619572 322
320 3300005536 Ga0070697_100031560 Ga0070697_1000315602 322
321 3300005539 Ga0068853_100172818 Ga0068853_1001728182 322
322 3300005539 Ga0068853_100196319 Ga0068853_1001963192 322
323 3300005543 Ga0070672_100181951 Ga0070672_1001819512 322
324 3300005548 Ga0070665_100095772 Ga0070665_1000957723 322
325 3300005548 Ga0070665_100158189 Ga0070665_1001581892 322
326 3300005563 Ga0068855_100074068 Ga0068855_1000740682 322
327 3300005614 Ga0068856_100172825 Ga0068856_1001728252 322
328 3300005615 Ga0070702_100186158 Ga0070702_1001861581 322
329 3300005617 Ga0068859_100138921 Ga0068859_1001389212 322
330 3300005617 Ga0068859_100320727 Ga0068859_1003207272 322
331 3300005719 Ga0068861_100162643 Ga0068861_1001626432 322
332 3300005840 Ga0068870_10059161 Ga0068870_100591612 322
333 3300005843 Ga0068860_100000360 Ga0068860_1000003602 322
334 3300005844 Ga0068862_100023046 Ga0068862_1000230465 322
335 3300005937 Ga0081455_10022037 Ga0081455_100220372 322
336 3300005983 Ga0081540_1000563 Ga0081540_100056310 322
337 3300005983 Ga0081540_1005358 Ga0081540_10053582 322
338 3300005983 Ga0081540_1017091 Ga0081540_10170913 322
339 3300005985 Ga0081539_10029092 Ga0081539_100290921 322
340 3300006028 Ga0070717_10201255 Ga0070717_102012552 322
341 3300006173 Ga0070716_100035770 Ga0070716_1000357703 322
342 3300006844 Ga0075428_100067667 Ga0075428_1000676673 322
343 3300006931 Ga0097620_100138923 Ga0097620_1001389232 322
344 3300006931 Ga0097620_100320698 Ga0097620_1003206982 322
345 3300009093 Ga0105240_10148446 Ga0105240_101484462 322
346 3300009098 Ga0105245_10075121 Ga0105245_100751212 322
347 3300009098 Ga0105245_10261193 Ga0105245_102611932 322
348 3300009101 Ga0105247_10074443 Ga0105247_100744432 322
349 3300009101 Ga0105247_10130806 Ga0105247_101308062 322
350 3300009174 Ga0105241_10248442 Ga0105241_102484422 322
351 3300009545 Ga0105237_10014093 Ga0105237_100140935 322
352 3300009545 Ga0105237_10067917 Ga0105237_100679172 322
353 3300009551 Ga0105238_10141570 Ga0105238_101415702 322
354 3300010159 Ga0099796_10018360 Ga0099796_100183602 322
355 3300010375 Ga0105239_10182513 Ga0105239_101825132 322
356 3300010375 Ga0105239_10293783 Ga0105239_102937832 322
357 3300010375 Ga0105239_10448061 Ga0105239_104480612 322
358 3300013105 Ga0157369_10016441 Ga0157369_100164415 322
359 3300013296 Ga0157374_10136923 Ga0157374_101369232 322
360 3300013297 Ga0157378_10220201 Ga0157378_102202012 322
361 3300013306 Ga0163162_10049675 Ga0163162_100496752 322
362 3300013308 Ga0157375_10567184 Ga0157375_105671842 322
363 3300014325 Ga0163163_10034163 Ga0163163_100341634 322
364 3300014745 Ga0157377_10243697 Ga0157377_102436972 322
365 3300025297 Ga0209758_1009643 Ga0209758_10096435 322
366 3300025297 Ga0209758_1010946 Ga0209758_10109465 322
367 3300025898 Ga0207692_10029455 Ga0207692_100294552 322
368 3300025899 Ga0207642_10034421 Ga0207642_100344212 322
369 3300025900 Ga0207710_10021188 Ga0207710_100211882 322
370 3300025901 Ga0207688_10197565 Ga0207688_101975651 322
371 3300025906 Ga0207699_10001448 Ga0207699_1000144812 322
372 3300025906 Ga0207699_10020904 Ga0207699_100209042 322
373 3300025906 Ga0207699_10116871 Ga0207699_101168712 322
374 3300025908 Ga0207643_10036462 Ga0207643_100364622 322
375 3300025909 Ga0207705_10216530 Ga0207705_102165302 322
376 3300025911 Ga0207654_10068361 Ga0207654_100683612 322
377 3300025912 Ga0207707_10015539 Ga0207707_100155397 322
378 3300025912 Ga0207707_10059169 Ga0207707_100591692 322
379 3300025914 Ga0207671_10110598 Ga0207671_101105982 322
380 3300025915 Ga0207693_10003822 Ga0207693_1000382211 322
381 3300025916 Ga0207663_10039730 Ga0207663_100397302 322
382 3300025919 Ga0207657_10016104 Ga0207657_100161046 322
383 3300025920 Ga0207649_10117731 Ga0207649_101177312 322
384 3300025921 Ga0207652_10017291 Ga0207652_100172912 322
385 3300025923 Ga0207681_10063046 Ga0207681_100630462 322
386 3300025925 Ga0207650_10316839 Ga0207650_103168392 322
387 3300025926 Ga0207659_10083431 Ga0207659_100834312 322
388 3300025927 Ga0207687_10240179 Ga0207687_102401792 322
389 3300025928 Ga0207700_10047207 Ga0207700_100472074 322
390 3300025929 Ga0207664_10062284 Ga0207664_100622843 322
391 3300025933 Ga0207706_10107502 Ga0207706_101075022 322
392 3300025933 Ga0207706_10282412 Ga0207706_102824122 322
393 3300025937 Ga0207669_10052028 Ga0207669_100520282 322
394 3300025937 Ga0207669_10205669 Ga0207669_102056692 322
395 3300025939 Ga0207665_10003894 Ga0207665_100038942 322
396 3300025940 Ga0207691_10239251 Ga0207691_102392511 322
397 3300025941 Ga0207711_10082201 Ga0207711_100822012 322
398 3300025942 Ga0207689_10181564 Ga0207689_101815642 322
399 3300025944 Ga0207661_10000879 Ga0207661_100008799 322
400 3300025949 Ga0207667_10058484 Ga0207667_100584842 322
401 3300025972 Ga0207668_10072624 Ga0207668_100726242 322
402 3300026023 Ga0207677_10126182 Ga0207677_101261822 322
403 3300026035 Ga0207703_10083088 Ga0207703_100830881 322
404 3300026041 Ga0207639_10085591 Ga0207639_100855912 322
405 3300026067 Ga0207678_10206056 Ga0207678_102060562 322
406 3300026075 Ga0207708_10157527 Ga0207708_101575272 322
407 3300026078 Ga0207702_10191797 Ga0207702_101917972 322
408 3300026088 Ga0207641_10124501 Ga0207641_101245012 322
409 3300026116 Ga0207674_10023338 Ga0207674_100233385 322
410 3300026118 Ga0207675_100171903 Ga0207675_1001719032 322
411 3300026142 Ga0207698_10306484 Ga0207698_103064842 322
412 3300027907 Ga0207428_10224954 Ga0207428_102249541 322
413 3300028380 Ga0268265_10013205 Ga0268265_100132052 322
414 3300028380 Ga0268265_10044450 Ga0268265_100444502 322
415 3300028381 Ga0268264_10000030 Ga0268264_10000030281 322
416 3300030522 Ga0307512_10144844 Ga0307512_101448441 322
417 3300031238 Ga0265332_10046928 Ga0265332_100469281 322
418 3300031456 Ga0307513_10196993 Ga0307513_101969932 322
419 3300031507 Ga0307509_10075783 Ga0307509_100757832 322
420 3300031507 Ga0307509_10269423 Ga0307509_102694232 322
421 3300031616 Ga0307508_10157547 Ga0307508_101575472 322
422 3300031730 Ga0307516_10000939 Ga0307516_1000093921 322
423 3300031730 Ga0307516_10076248 Ga0307516_100762483 322
424 3300031730 Ga0307516_10206235 Ga0307516_102062351 322
425 3300031901 Ga0307406_10113799 Ga0307406_101137992 322
426 3300032005 Ga0307411_10025196 Ga0307411_100251962 322
427 3300033179 Ga0307507_10085869 Ga0307507_100858692 322
428 3300033180 Ga0307510_10030787 Ga0307510_100307872 322
429 3300033180 Ga0307510_10138063 Ga0307510_101380632 322
430 3300033544 Ga0316215_1003530 Ga0316215_10035302 322
431 3300035085 Ga0373929_0016007 Ga0373929_0016007_394_1374 322
432 3300035089 Ga0373944_0008813 Ga0373944_0008813_1161_2129 322
433 3300035089 Ga0373944_0026305 Ga0373944_0026305_142_1131 322
434 3300035089 Ga0373944_0029826 Ga0373944_0029826_228_1208 322
435 3300035111 Ga0373923_0001708 Ga0373923_0001708_892_1860 322
436 3300035113 Ga0373936_0053600 Ga0373936_0053600_101_1090 322
437 3300035116 Ga0373945_0031429 Ga0373945_0031429_714_1694 322
438 3300035119 Ga0373956_0014989 Ga0373956_0014989_1031_2020 322
439 3300035120 Ga0373957_0001196 Ga0373957_0001196_84_1073 322
440 3300035170 Ga0373943_0069693 Ga0373943_0069693_188_1168 322
441 3300035170 Ga0373943_0092370 Ga0373943_0092370_263_1252 322
442 3300035171 Ga0373946_0002425 Ga0373946_0002425_2768_3757 322
443 3300035172 Ga0373955_0000956 Ga0373955_0000956_547_1536 322
444 3300035172 Ga0373955_0007308 Ga0373955_0007308_192_1160 322
445 3300035692 Ga0373935_0000424 Ga0373935_0000424_4860_5849 322
446 3300035692 Ga0373935_0284643 Ga0373935_0284643_120_1088 322
447 3300035695 Ga0373927_0010213 Ga0373927_0010213_1188_2177 322
448 3300035695 Ga0373927_0017385 Ga0373927_0017385_1511_2491 322
449 3300035695 Ga0373927_0019865 Ga0373927_0019865_2993_3973 322
450 3300035695 Ga0373927_0021331 Ga0373927_0021331_1357_2346 322
451 3300035724 Ga0373933_0003417 Ga0373933_0003417_6713_7702 322
452 3300035725 Ga0373947_0001385 Ga0373947_0001385_2060_3049 322
453 3300035725 Ga0373947_0063618 Ga0373947_0063618_702_1691 322
454 3300036401 Ga0373937_0034455 Ga0373937_0034455_1597_2586 322
455 3300037068 Ga0373925_0029824 Ga0373925_0029824_2300_3289 322
456 3300037068 Ga0373925_0032464 Ga0373925_0032464_2205_3185 322
457 3300037068 Ga0373925_0056395 Ga0373925_0056395_320_1300 322
458 3300037466 Ga0395898_0104054 Ga0395898_0104054_725_1705 322
459 3300044658 Ga0466972_0000113 Ga0466972_0000113_61155_62123 322
460 3300045976 Ga0466967_0058132 Ga0466967_0058132_2119_3087 322
461 3300046454 Ga0495592_0010638 Ga0495592_0010638_3785_4774 322
462 3300046454 Ga0495592_0018813 Ga0495592_0018813_3203_4192 322
463 3300046454 Ga0495592_0058300 Ga0495592_0058300_1340_2308 322
464 3300046455 Ga0495603_0000003 Ga0495603_0000003_15367_16356 322
465 3300046459 Ga0495629_0002388 Ga0495629_0002388_12260_13249 322
466 3300046461 Ga0495641_0009506 Ga0495641_0009506_3013_4002 322
467 3300046463 Ga0495653_0095296 Ga0495653_0095296_92_1081 322
468 3300046472 Ga0495580_0001857 Ga0495580_0001857_8367_9356 322
469 3300046473 Ga0495582_0000016 Ga0495582_0000016_14186_15175 322
470 3300046473 Ga0495582_0044998 Ga0495582_0044998_1448_2416 322
471 3300046474 Ga0495605_0062889 Ga0495605_0062889_488_1468 322
472 3300046475 Ga0495639_0000075 Ga0495639_0000075_10153_11142 322
473 3300046476 Ga0495662_0011526 Ga0495662_0011526_588_1556 322
474 3300046476 Ga0495662_0033000 Ga0495662_0033000_311_1300 322
475 3300046477 Ga0495664_0008072 Ga0495664_0008072_3655_4623 322
476 3300046477 Ga0495664_0011974 Ga0495664_0011974_2765_3754 322
477 3300046477 Ga0495664_0075124 Ga0495664_0075124_1041_2009 322
478 3300046491 Ga0495584_0049936 Ga0495584_0049936_470_1450 322
479 3300046499 Ga0495594_0000120 Ga0495594_0000120_3046_4035 322
480 3300046500 Ga0495596_0036158 Ga0495596_0036158_780_1760 322
481 3300046507 Ga0495606_0001387 Ga0495606_0001387_25883_26866 322
482 3300046514 Ga0495618_0062734 Ga0495618_0062734_1113_2102 322
483 3300046517 Ga0495630_0321750 Ga0495630_0321750_121_1089 322
484 3300046526 Ga0495666_0127627 Ga0495666_0127627_57_1046 322
485 3300046529 Ga0495652_0060328 Ga0495652_0060328_1542_2531 322
486 3300046530 Ga0495654_0087994 Ga0495654_0087994_375_1355 322
487 3300046531 Ga0495665_0000270 Ga0495665_0000270_196_1185 322
488 3300046533 Ga0495640_0000210 Ga0495640_0000210_37253_38242 322
489 3300046533 Ga0495640_0020628 Ga0495640_0020628_2093_3082 322
490 3300046533 Ga0495640_0038421 Ga0495640_0038421_1177_2145 322
491 3300046536 Ga0495587_0043439 Ga0495587_0043439_1187_2176 322
492 3300046543 Ga0495645_0020206 Ga0495645_0020206_1126_2094 322
493 3300046557 Ga0495622_0062233 Ga0495622_0062233_375_1343 322
494 3300046559 Ga0495667_0054939 Ga0495667_0054939_99_1088 322
495 3300046642 Ga0495634_0000064 Ga0495634_0000064_61994_62983 322
496 3300046642 Ga0495634_0008410 Ga0495634_0008410_2682_3671 322
497 3300046642 Ga0495634_0023703 Ga0495634_0023703_3282_4250 322
498 3300046660 Ga0495625_0140979 Ga0495625_0140979_144_1124 322
499 3300046663 Ga0495635_0000316 Ga0495635_0000316_11367_12356 322
500 3300046663 Ga0495635_0104993 Ga0495635_0104993_151_1140 322
501 3300046674 Ga0495588_0004843 Ga0495588_0004843_182_1162 322
502 3300046674 Ga0495588_0014430 Ga0495588_0014430_2641_3630 322
503 3300046674 Ga0495588_0048145 Ga0495588_0048145_804_1784 322
504 3300046675 Ga0495657_0103560 Ga0495657_0103560_321_1310 322
505 3300046679 Ga0495623_0071074 Ga0495623_0071074_1027_2016 322
506 3300046680 Ga0495646_0057415 Ga0495646_0057415_969_1958 322
507 3300046681 Ga0495647_0023006 Ga0495647_0023006_505_1494 322
508 3300046683 Ga0495658_0002630 Ga0495658_0002630_3989_4978 322
509 3300046689 Ga0495613_0004076 Ga0495613_0004076_6424_7413 322
510 3300046689 Ga0495613_0084854 Ga0495613_0084854_975_1964 322
511 3300046690 Ga0495624_0010653 Ga0495624_0010653_2579_3568 322
512 3300046809 Ga0495600_0086233 Ga0495600_0086233_54_1043 322
513 3300047315 Ga0495581_0000014 Ga0495581_0000014_22659_23648 322
514 3300047317 Ga0495604_0220204 Ga0495604_0220204_241_1209 322
515 3300047319 Ga0495674_0001069 Ga0495674_0001069_12148_13137 322
516 3300047321 Ga0495676_0059798 Ga0495676_0059798_839_1828 322
517 3300047321 Ga0495676_0211683 Ga0495676_0211683_162_1142 322
518 3300047322 Ga0495680_0011794 Ga0495680_0011794_5963_6952 322
519 3300047471 Ga0495684_0007582 Ga0495684_0007582_2507_3496 322
520 3300047471 Ga0495684_0026033 Ga0495684_0026033_3011_4000 322
521 3300047673 Ga0495593_0000003 Ga0495593_0000003_51441_52430 322
522 3300048089 Ga0495614_0013203 Ga0495614_0013203_949_1938 322
523 3300048905 Ga0496102_0066002 Ga0496102_0066002_885_1871 322
524 3300048905 Ga0496102_0200361 Ga0496102_0200361_599_1579 322
525 3300048906 Ga0496103_0024383 Ga0496103_0024383_2067_3053 322
526 3300048906 Ga0496103_0137332 Ga0496103_0137332_564_1544 322
527 3300048907 Ga0496104_0039268 Ga0496104_0039268_1011_1997 322
528 3300048908 Ga0496105_0139800 Ga0496105_0139800_79_1065 322
529 3300048909 Ga0496106_0019837 Ga0496106_0019837_3026_4012 322
530 3300048912 Ga0496109_0030452 Ga0496109_0030452_2630_3616 322
531 3300048912 Ga0496109_0294941 Ga0496109_0294941_465_1445 322
532 3300048913 Ga0496110_0026150 Ga0496110_0026150_3606_4592 322
533 3300048915 Ga0496112_0027239 Ga0496112_0027239_3925_4911 322
534 3300048915 Ga0496112_0124684 Ga0496112_0124684_824_1813 322
535 3300048915 Ga0496112_0242010 Ga0496112_0242010_731_1711 322
536 3300048917 Ga0496114_0127978 Ga0496114_0127978_388_1374 322
537 3300048918 Ga0496115_0003047 Ga0496115_0003047_3004_3990 322
538 3300048924 Ga0496121_0034261 Ga0496121_0034261_2454_3434 322
539 3300048924 Ga0496121_0144458 Ga0496121_0144458_507_1487 322
540 3300048924 Ga0496121_0155084 Ga0496121_0155084_679_1647 322
541 3300048929 Ga0496126_0007029 Ga0496126_0007029_11406_12386 322
542 3300048929 Ga0496126_0129432 Ga0496126_0129432_52_1032 322
543 3300049581 Ga0501047_0006540 Ga0501047_0006540_2458_3426 322
544 3300049586 Ga0501070_0004771 Ga0501070_0004771_1389_2357 322
545 3300049742 Ga0501080_0058215 Ga0501080_0058215_1999_2967 322
546 3300049822 Ga0501035_0120970 Ga0501035_0120970_85_1053 322
547 3300050494 nmdc:mga06z11_56355_c1 nmdc:mga06z11_56355_c1_244_1224 322
548 3300050507 nmdc:mga05p37_283809_c1 nmdc:mga05p37_283809_c1_592_1572 322
549 3300050512 nmdc:mga0n895_242940_c1 nmdc:mga0n895_242940_c1_236_1216 322
550 3300050513 nmdc:mga0rr50_61425_c1 nmdc:mga0rr50_61425_c1_274_1254 322
551 3300053077 Ga0495601_0032907 Ga0495601_0032907_110_1078 322
552 3300053077 Ga0495601_0080098 Ga0495601_0080098_1104_2072 322
553 3300053080 Ga0500635_0030075 Ga0500635_0030075_62_1042 322
554 3300053094 Ga0500566_0007050 Ga0500566_0007050_3531_4511 322
555 3300053094 Ga0500566_0052932 Ga0500566_0052932_356_1336 322
556 3300053119 Ga0500595_000898 Ga0500595_000898_586_1566 322
557 3300053119 Ga0500595_010401 Ga0500595_010401_1351_2331 322
558 3300053150 Ga0500603_014567 Ga0500603_014567_598_1587 322
559 3300053178 Ga0500637_0000103 Ga0500637_0000103_12665_13645 322
560 3300053178 Ga0500637_0126908 Ga0500637_0126908_359_1348 322
561 3300055283 Ga0500661_001897 Ga0500661_001897_2222_3202 322
562 3300003215 JGI25153J46596_10001542 JGI25153J46596_1000154212 323
563 3300003215 JGI25153J46596_10001551 JGI25153J46596_1000155112 323
564 3300003215 JGI25153J46596_10003383 JGI25153J46596_100033837 323
565 3300003215 JGI25153J46596_10036462 JGI25153J46596_100364621 323
566 3300003354 JGI25160J50197_1005959 JGI25160J50197_10059592 323
567 3300003354 JGI25160J50197_1013050 JGI25160J50197_10130502 323
568 3300003752 Ga0055539_1008103 Ga0055539_10081031 323
569 3300003794 Ga0055531_10021688 Ga0055531_100216882 323
570 3300005262 Ga0065165_1000890 Ga0065165_100089016 323
571 3300005262 Ga0065165_1002830 Ga0065165_100283010 323
572 3300005366 Ga0070659_100137588 Ga0070659_1001375882 323
573 3300005445 Ga0070708_100572818 Ga0070708_1005728181 323
574 3300005455 Ga0070663_100203633 Ga0070663_1002036332 323
575 3300005456 Ga0070678_100268545 Ga0070678_1002685451 323
576 3300005459 Ga0068867_100153822 Ga0068867_1001538222 323
577 3300005459 Ga0068867_100182203 Ga0068867_1001822032 323
578 3300005548 Ga0070665_100316578 Ga0070665_1003165782 323
579 3300005564 Ga0070664_100090212 Ga0070664_1000902122 323
580 3300005618 Ga0068864_100201235 Ga0068864_1002012352 323
581 3300005718 Ga0068866_10039415 Ga0068866_100394152 323
582 3300006051 Ga0075364_10136761 Ga0075364_101367612 323
583 3300006186 Ga0075369_10089729 Ga0075369_100897292 323
584 3300006353 Ga0075370_10251005 Ga0075370_102510051 323
585 3300006881 Ga0068865_100010846 Ga0068865_1000108464 323
586 3300006941 Ga0099825_1023845 Ga0099825_10238453 323
587 3300006944 Ga0099823_1016101 Ga0099823_10161016 323
588 3300009094 Ga0111539_10045303 Ga0111539_100453032 323
589 3300009101 Ga0105247_10077345 Ga0105247_100773452 323
590 3300009148 Ga0105243_10327388 Ga0105243_103273882 323
591 3300009176 Ga0105242_10384643 Ga0105242_103846432 323
592 3300010375 Ga0105239_10231702 Ga0105239_102317022 323
593 3300013306 Ga0163162_10106859 Ga0163162_101068593 323
594 3300014325 Ga0163163_10130093 Ga0163163_101300933 323
595 3300014326 Ga0157380_10266966 Ga0157380_102669662 323
596 3300014969 Ga0157376_10309365 Ga0157376_103093651 323
597 3300017792 Ga0163161_10086174 Ga0163161_100861742 323
598 3300021321 Ga0214542_1000606 Ga0214542_100060646 323
599 3300021324 Ga0214545_1000003 Ga0214545_1000003163 323
600 3300021327 Ga0214543_1000002 Ga0214543_1000002602 323
601 3300025253 Ga0209677_109175 Ga0209677_1091751 323
602 3300025273 Ga0209673_1031986 Ga0209673_10319862 323
603 3300025295 Ga0209564_1006619 Ga0209564_10066194 323
604 3300025297 Ga0209758_1000011 Ga0209758_1000011478 323
605 3300025297 Ga0209758_1000477 Ga0209758_100047723 323
606 3300025297 Ga0209758_1001198 Ga0209758_10011982 323
607 3300025297 Ga0209758_1040941 Ga0209758_10409412 323
608 3300025299 Ga0209256_1001993 Ga0209256_10019937 323
609 3300025302 Ga0207426_1000519 Ga0207426_100051936 323
610 3300025302 Ga0207426_1005792 Ga0207426_10057922 323
611 3300025302 Ga0207426_1014062 Ga0207426_10140623 323
612 3300025304 Ga0209257_1000654 Ga0209257_10006547 323
613 3300025901 Ga0207688_10034750 Ga0207688_100347503 323
614 3300025911 Ga0207654_10003430 Ga0207654_100034307 323
615 3300025918 Ga0207662_10040704 Ga0207662_100407042 323
616 3300025923 Ga0207681_10089076 Ga0207681_100890762 323
617 3300025932 Ga0207690_10115138 Ga0207690_101151382 323
618 3300025933 Ga0207706_10028322 Ga0207706_100283225 323
619 3300025934 Ga0207686_10068859 Ga0207686_100688592 323
620 3300025935 Ga0207709_10027813 Ga0207709_100278132 323
621 3300025937 Ga0207669_10004960 Ga0207669_100049605 323
622 3300025940 Ga0207691_10016444 Ga0207691_100164445 323
623 3300025986 Ga0207658_10025279 Ga0207658_100252794 323
624 3300026035 Ga0207703_10116891 Ga0207703_101168912 323
625 3300026067 Ga0207678_10261938 Ga0207678_102619381 323
626 3300026089 Ga0207648_10111412 Ga0207648_101114122 323
627 3300026089 Ga0207648_10237852 Ga0207648_102378522 323
628 3300026121 Ga0207683_10366148 Ga0207683_103661481 323
629 3300027296 Ga0209389_1000077 Ga0209389_100007733 323
630 3300027361 Ga0209489_100251 Ga0209489_10025133 323
631 3300027363 Ga0209700_100271 Ga0209700_10027132 323
632 3300028379 Ga0268266_10232329 Ga0268266_102323292 323
633 3300037418 Ga0395900_0006232 Ga0395900_0006232_9829_10809 323
634 3300037466 Ga0395898_0032295 Ga0395898_0032295_2346_3326 323
635 3300037471 Ga0395905_0003367 Ga0395905_0003367_4006_4977 323
636 3300038443 Ga0395901_0100559 Ga0395901_0100559_1010_1990 323
637 3300038443 Ga0395901_0188212 Ga0395901_0188212_1003_1974 323
638 3300044683 Ga0466965_0008177 Ga0466965_0008177_2358_3329 323
639 3300044684 Ga0466966_0000398 Ga0466966_0000398_22949_23920 323
640 3300044693 Ga0466961_0000005 Ga0466961_0000005_13887_14858 323
641 3300044901 Ga0466960_0022833 Ga0466960_0022833_1299_2270 323
642 3300045049 Ga0466959_0000670 Ga0466959_0000670_4125_5096 323
643 3300045976 Ga0466967_0280833 Ga0466967_0280833_194_1165 323
644 3300046454 Ga0495592_0238170 Ga0495592_0238170_221_1192 323
645 3300046459 Ga0495629_0009839 Ga0495629_0009839_4817_5788 323
646 3300046462 Ga0495651_0002716 Ga0495651_0002716_12032_13012 323
647 3300046477 Ga0495664_0019306 Ga0495664_0019306_2676_3656 323
648 3300046516 Ga0495628_0051250 Ga0495628_0051250_1611_2591 323
649 3300046517 Ga0495630_0037982 Ga0495630_0037982_544_1524 323
650 3300046529 Ga0495652_0011876 Ga0495652_0011876_10_981 323
651 3300046529 Ga0495652_0014719 Ga0495652_0014719_2912_3892 323
652 3300046533 Ga0495640_0034237 Ga0495640_0034237_1772_2752 323
653 3300046536 Ga0495587_0039151 Ga0495587_0039151_812_1792 323
654 3300046543 Ga0495645_0012046 Ga0495645_0012046_2886_3866 323
655 3300046557 Ga0495622_0003400 Ga0495622_0003400_1575_2546 323
656 3300046559 Ga0495667_0024058 Ga0495667_0024058_166_1146 323
657 3300046663 Ga0495635_0031259 Ga0495635_0031259_2231_3211 323
658 3300046675 Ga0495657_0010591 Ga0495657_0010591_4246_5226 323
659 3300046678 Ga0495599_0065618 Ga0495599_0065618_83_1063 323
660 3300046679 Ga0495623_0020849 Ga0495623_0020849_970_1950 323
661 3300046680 Ga0495646_0055284 Ga0495646_0055284_1020_2000 323
662 3300046684 Ga0495669_0037455 Ga0495669_0037455_478_1470 323
663 3300046689 Ga0495613_0072130 Ga0495613_0072130_1193_2173 323
664 3300046690 Ga0495624_0024452 Ga0495624_0024452_963_1934 323
665 3300046809 Ga0495600_0117870 Ga0495600_0117870_54_1025 323
666 3300047317 Ga0495604_0019282 Ga0495604_0019282_1704_2684 323
667 3300047317 Ga0495604_0045443 Ga0495604_0045443_1426_2397 323
668 3300047319 Ga0495674_0002679 Ga0495674_0002679_14038_15018 323
669 3300047322 Ga0495680_0002674 Ga0495680_0002674_3984_4964 323
670 3300047323 Ga0495683_0124322 Ga0495683_0124322_159_1130 323
671 3300047444 Ga0495675_0007708 Ga0495675_0007708_2229_3209 323
672 3300047471 Ga0495684_0215353 Ga0495684_0215353_393_1373 323
673 3300048088 Ga0495602_0031427 Ga0495602_0031427_2682_3662 323
674 3300048905 Ga0496102_0179249 Ga0496102_0179249_533_1525 323
675 3300048907 Ga0496104_0007868 Ga0496104_0007868_5082_6053 323
676 3300048908 Ga0496105_0007252 Ga0496105_0007252_6638_7609 323
677 3300048912 Ga0496109_0220267 Ga0496109_0220267_130_1101 323
678 3300048917 Ga0496114_0081234 Ga0496114_0081234_776_1768 323
679 3300048918 Ga0496115_0107351 Ga0496115_0107351_1184_2155 323
680 3300048919 Ga0496116_0023995 Ga0496116_0023995_1455_2426 323
681 3300048922 Ga0496119_0017624 Ga0496119_0017624_1166_2137 323
682 3300048924 Ga0496121_0029799 Ga0496121_0029799_299_1270 323
683 3300048924 Ga0496121_0035413 Ga0496121_0035413_2057_3028 323
684 3300048929 Ga0496126_0020185 Ga0496126_0020185_4945_5916 323
685 3300049572 Ga0501036_0143300 Ga0501036_0143300_519_1511 323
686 3300050511 nmdc:mga08y16_217282_c1 nmdc:mga08y16_217282_c1_391_1383 323
687 3300050516 nmdc:mga0sz30_60358_c1 nmdc:mga0sz30_60358_c1_601_1572 323
688 3300053087 Ga0500643_000218 Ga0500643_000218_7469_8440 323
689 3300053092 Ga0500583_0014376 Ga0500583_0014376_1144_2115 323
690 3300053094 Ga0500566_0003699 Ga0500566_0003699_7629_8600 323
691 3300053103 Ga0500555_011063 Ga0500555_011063_418_1389 323
692 3300053130 Ga0500642_0000922 Ga0500642_0000922_2913_3884 323
693 3300053136 Ga0500559_0083706 Ga0500559_0083706_279_1250 323
694 3300053736 Ga0500599_002035 Ga0500599_002035_716_1687 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08352

oligo_HPY

Oligopeptide/dipeptide transporter, C-terminal region

251

316

0.95

PF00005

ABC_tran

ABC transporter

47

200

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9685 11 263
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9571 10 243
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9505 10 245
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9483 10 240
4fwi-assembly1.cif.gz_B crystal structure of the nucleotide-binding domain of a dipeptide abc transporter 0.948 9 319
ID Description Score Start End Superfamily
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9756 11 261 3.40.50.300
3tujC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9743 12 247 3.40.50.300
3tujC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.966 12 247 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9643 9 234 3.40.50.300
af_P75796_311_605_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9638 9 282 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A117L021-F1-model_v4 deleted 0.9858 10 215
AF-A0A2E7WFK6-F1-model_v4 ABC transporter ATP-binding protein 0.9789 10 260 GO:0005524
GO:0005886
GO:0016887
AF-A0A537WAU2-F1-model_v4 ABC transporter ATP-binding protein 0.9773 28 261 GO:0005524
GO:0005886
GO:0015833
GO:0016887
AF-A0A212DUA4-F1-model_v4 deleted 0.9732 92 234
AF-A0A3M2ANL3-F1-model_v4 ABC transporter ATP-binding protein 0.9726 8 258 GO:0005524
GO:0016887
GO:0055085

Feature Viewer

pLDDT pTM Quality
89.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map