F475717
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 694 | 444 | 567 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300005985|Ga0081539_10029092|Ga0081539_100290921 |
| Length | 339 |
| Sequence | MISRRAEPLIPFDPAPAGKTVLAVEEVCKHFSGKGALFGKSRVIEAVDRVTLHIGASETVGLVGESGSGKSTLGRAILQLDRPTAGTVMLDGRIISTLSDRELRPLRRDMQMIFQDPQSSLNPRMKVGAIIAEPLEIAGDISGRRALRERVHQLLDLVRLPASAAERYPYEFSGGQRQRIGIARAIALNPKLVVADEAVSSLDVSIQAQVINLLTDLQSELKFACLFIAHDLAVVKAVSDRVAVMYLGRLCEVGPSEQLFAKPAHPYTALLIEAIPVPDPDIRPTETVPVGEPPSPIAPPSGCRFRTRCPRADARCSAEVPELRAVAPGQFAACHYPLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 4 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 5 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 8 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 9 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 10 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 11 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 12 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 13 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 14 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 15 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 16 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 17 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 18 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 19 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 20 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 21 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 22 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 23 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 24 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 25 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 26 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 27 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 28 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 29 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 30 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 31 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 32 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 33 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 34 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 35 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 36 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 37 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 38 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 39 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 40 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 41 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 42 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 43 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 44 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 45 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 46 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 47 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 48 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 49 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 50 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 51 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 52 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 53 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 54 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 55 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 56 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 57 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 58 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 59 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 60 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 61 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 62 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 63 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 64 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 65 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 66 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 67 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 68 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 69 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 70 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 71 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 72 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 73 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 74 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 75 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 76 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 77 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 78 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 79 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 80 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 81 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 82 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 83 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 84 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 85 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 86 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 87 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 88 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 89 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 90 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 91 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 92 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 93 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 94 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 95 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 96 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 97 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 98 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 99 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 100 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 101 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 102 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 103 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 104 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 105 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 106 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 107 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 108 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 109 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 110 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 115 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 130 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 131 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 132 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 136 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 139 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 141 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 142 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 144 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 145 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 146 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 147 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 148 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 149 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 150 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 151 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 152 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 153 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 154 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 155 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 157 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 158 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 159 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 160 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 161 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 162 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 163 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 164 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 165 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 166 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 167 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 169 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 170 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 171 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 172 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 173 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 184 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 185 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 197 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 199 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 200 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 201 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 202 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 264 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 265 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 266 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 267 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 271 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 272 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 273 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 274 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 275 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 276 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 277 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 278 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 279 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 280 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 281 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 282 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 283 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 284 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 285 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 286 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 287 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 288 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 289 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 290 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 291 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 292 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 294 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 296 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 297 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 298 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 299 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 300 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 301 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 302 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 303 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 304 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 306 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 307 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 308 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 309 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 310 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 311 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 312 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 313 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 314 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 318 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 319 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 320 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 321 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 378 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 379 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 380 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 381 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 382 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 383 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 385 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 386 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 387 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 388 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 389 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 390 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 391 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 392 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 393 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 394 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 404 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 405 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 411 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 414 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 415 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 416 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 417 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 418 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 422 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 423 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 424 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 425 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 428 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 429 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 430 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 431 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 432 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 433 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 434 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 435 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 436 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 437 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 438 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 439 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 440 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 441 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 442 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 443 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 444 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.29 |
| Metatranscriptomes | 0 |
| Isolates | 17.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.08 |
| Nodule | 13.83 |
| Rhizoplane | 4.47 |
| Rhizosphere | 62.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10001542 | 3300003215 | Bacteria | 13678 |
| 2 | JGI25153J46596_10001551 | 3300003215 | Bacteria | 13650 |
| 3 | JGI25153J46596_10003383 | 3300003215 | Bacteria | 8950 |
| 4 | JGI25153J46596_10005917 | 3300003215 | Bacteria | 6312 |
| 5 | JGI25153J46596_10036462 | 3300003215 | Bacteria | 1576 |
| 6 | JGI25160J50197_1005959 | 3300003354 | Bacteria | 5006 |
| 7 | JGI25160J50197_1013050 | 3300003354 | Bacteria | 2851 |
| 8 | Ga0055539_1008103 | 3300003752 | Bacteria | 1320 |
| 9 | Ga0055531_10021688 | 3300003794 | Bacteria | 2480 |
| 10 | Ga0065165_1000890 | 3300005262 | Bacteria | 38576 |
| 11 | Ga0065165_1002830 | 3300005262 | Bacteria | 13549 |
| 12 | Ga0070658_10022995 | 3300005327 | Bacteria | 5004 |
| 13 | Ga0070658_10062264 | 3300005327 | Bacteria | 3040 |
| 14 | Ga0070658_10216746 | 3300005327 | Bacteria | 1618 |
| 15 | Ga0070658_10234674 | 3300005327 | Bacteria | 1554 |
| 16 | Ga0070683_100022696 | 3300005329 | Bacteria | 5612 |
| 17 | Ga0070683_100036748 | 3300005329 | Bacteria | 4483 |
| 18 | Ga0070683_100120693 | 3300005329 | Bacteria | 2476 |
| 19 | Ga0070680_100003467 | 3300005336 | Bacteria | 11777 |
| 20 | Ga0070680_100014244 | 3300005336 | Bacteria | 6208 |
| 21 | Ga0070682_100131787 | 3300005337 | Bacteria | 1693 |
| 22 | Ga0068868_100078424 | 3300005338 | Bacteria | 2645 |
| 23 | Ga0068868_100134936 | 3300005338 | Bacteria | 2022 |
| 24 | Ga0070660_100066336 | 3300005339 | Bacteria | 2809 |
| 25 | Ga0070691_10098321 | 3300005341 | Bacteria | 1451 |
| 26 | Ga0070661_100300794 | 3300005344 | Bacteria | 1249 |
| 27 | Ga0070668_100018396 | 3300005347 | Bacteria | 5245 |
| 28 | Ga0070669_100114490 | 3300005353 | Bacteria | 2050 |
| 29 | Ga0070669_100152403 | 3300005353 | Bacteria | 1790 |
| 30 | Ga0070671_100130024 | 3300005355 | Bacteria | 2121 |
| 31 | Ga0070671_100436938 | 3300005355 | Bacteria | 1122 |
| 32 | Ga0070659_100137588 | 3300005366 | Bacteria | 1987 |
| 33 | Ga0070659_100165406 | 3300005366 | Bacteria | 1810 |
| 34 | Ga0070709_10000242 | 3300005434 | Bacteria | 35190 |
| 35 | Ga0070709_10006317 | 3300005434 | Bacteria | 6452 |
| 36 | Ga0070714_100010247 | 3300005435 | Bacteria | 7399 |
| 37 | Ga0070714_100042784 | 3300005435 | Bacteria | 3828 |
| 38 | Ga0070713_100035256 | 3300005436 | Bacteria | 4027 |
| 39 | Ga0070711_100018414 | 3300005439 | Bacteria | 4459 |
| 40 | Ga0070708_100297092 | 3300005445 | Bacteria | 1521 |
| 41 | Ga0070708_100572818 | 3300005445 | Bacteria | 1065 |
| 42 | Ga0070663_100065039 | 3300005455 | Bacteria | 2638 |
| 43 | Ga0070663_100143052 | 3300005455 | Bacteria | 1828 |
| 44 | Ga0070663_100203633 | 3300005455 | Bacteria | 1546 |
| 45 | Ga0070678_100268545 | 3300005456 | Bacteria | 1438 |
| 46 | Ga0070681_10061957 | 3300005458 | Bacteria | 3714 |
| 47 | Ga0068867_100153822 | 3300005459 | Bacteria | 1809 |
| 48 | Ga0068867_100182203 | 3300005459 | Bacteria | 1670 |
| 49 | Ga0070706_100186252 | 3300005467 | Bacteria | 1940 |
| 50 | Ga0070698_100031688 | 3300005471 | Bacteria | 5480 |
| 51 | Ga0070699_100010113 | 3300005518 | Bacteria | 8167 |
| 52 | Ga0070697_100018658 | 3300005536 | Bacteria | 5472 |
| 53 | Ga0070697_100031560 | 3300005536 | Bacteria | 4262 |
| 54 | Ga0068853_100172818 | 3300005539 | Bacteria | 1955 |
| 55 | Ga0068853_100196319 | 3300005539 | Bacteria | 1836 |
| 56 | Ga0070672_100181951 | 3300005543 | Bacteria | 1752 |
| 57 | Ga0070665_100012029 | 3300005548 | Bacteria | 8730 |
| 58 | Ga0070665_100095772 | 3300005548 | Bacteria | 2973 |
| 59 | Ga0070665_100158189 | 3300005548 | Bacteria | 2268 |
| 60 | Ga0070665_100316578 | 3300005548 | Bacteria | 1564 |
| 61 | Ga0068855_100074068 | 3300005563 | Bacteria | 3955 |
| 62 | Ga0068855_100089170 | 3300005563 | Bacteria | 3561 |
| 63 | Ga0070664_100017524 | 3300005564 | Bacteria | 5884 |
| 64 | Ga0070664_100063866 | 3300005564 | Bacteria | 3139 |
| 65 | Ga0070664_100090212 | 3300005564 | Bacteria | 2652 |
| 66 | Ga0068854_100223156 | 3300005578 | Bacteria | 1492 |
| 67 | Ga0068856_100000147 | 3300005614 | Bacteria | 71694 |
| 68 | Ga0068856_100172825 | 3300005614 | Bacteria | 2173 |
| 69 | Ga0070702_100186158 | 3300005615 | Bacteria | 1363 |
| 70 | Ga0068852_100026620 | 3300005616 | Bacteria | 4704 |
| 71 | Ga0068859_100138921 | 3300005617 | Bacteria | 2503 |
| 72 | Ga0068859_100320727 | 3300005617 | Bacteria | 1643 |
| 73 | Ga0068864_100201235 | 3300005618 | Bacteria | 1830 |
| 74 | Ga0068866_10039415 | 3300005718 | Bacteria | 2333 |
| 75 | Ga0068861_100162643 | 3300005719 | Bacteria | 1842 |
| 76 | Ga0068861_100248684 | 3300005719 | Bacteria | 1516 |
| 77 | Ga0068870_10059161 | 3300005840 | Bacteria | 2054 |
| 78 | Ga0068863_100455703 | 3300005841 | Bacteria | 1255 |
| 79 | Ga0068860_100000360 | 3300005843 | Bacteria | 60297 |
| 80 | Ga0068860_100022237 | 3300005843 | Bacteria | 6139 |
| 81 | Ga0068860_100329767 | 3300005843 | Bacteria | 1499 |
| 82 | Ga0068862_100023046 | 3300005844 | Bacteria | 5214 |
| 83 | Ga0081455_10000391 | 3300005937 | Bacteria | 57931 |
| 84 | Ga0081455_10022037 | 3300005937 | Bacteria | 5964 |
| 85 | Ga0081455_10049326 | 3300005937 | Bacteria | 3629 |
| 86 | Ga0081455_10098396 | 3300005937 | Bacteria | 2355 |
| 87 | Ga0081540_1000563 | 3300005983 | Bacteria | 35948 |
| 88 | Ga0081540_1005358 | 3300005983 | Bacteria | 9594 |
| 89 | Ga0081540_1017091 | 3300005983 | Bacteria | 4506 |
| 90 | Ga0081540_1041454 | 3300005983 | Bacteria | 2386 |
| 91 | Ga0081539_10020643 | 3300005985 | Bacteria | 4441 |
| 92 | Ga0081539_10029092 | 3300005985 | Bacteria | 3461 |
| 93 | Ga0070717_10201255 | 3300006028 | Bacteria | 1744 |
| 94 | Ga0075365_10236499 | 3300006038 | Bacteria | 1283 |
| 95 | Ga0075363_100008417 | 3300006048 | Bacteria | 4801 |
| 96 | Ga0075364_10117840 | 3300006051 | Bacteria | 1776 |
| 97 | Ga0075364_10136761 | 3300006051 | Bacteria | 1647 |
| 98 | Ga0070716_100035770 | 3300006173 | Bacteria | 2733 |
| 99 | Ga0075367_10001189 | 3300006178 | Bacteria | 10934 |
| 100 | Ga0075367_10026850 | 3300006178 | Bacteria | 3269 |
| 101 | Ga0075369_10089729 | 3300006186 | Bacteria | 1371 |
| 102 | Ga0075366_10228167 | 3300006195 | Bacteria | 1134 |
| 103 | Ga0075370_10064177 | 3300006353 | Bacteria | 2094 |
| 104 | Ga0075370_10251005 | 3300006353 | Bacteria | 1049 |
| 105 | Ga0068871_100090784 | 3300006358 | Bacteria | 2545 |
| 106 | Ga0075428_100067667 | 3300006844 | Bacteria | 3908 |
| 107 | Ga0068865_100010846 | 3300006881 | Bacteria | 5685 |
| 108 | Ga0097620_100138923 | 3300006931 | Bacteria | 2503 |
| 109 | Ga0097620_100320698 | 3300006931 | Bacteria | 1643 |
| 110 | Ga0099825_1023845 | 3300006941 | Bacteria | 3682 |
| 111 | Ga0099822_1005398 | 3300006943 | Bacteria | 16681 |
| 112 | Ga0099823_1016101 | 3300006944 | Bacteria | 7367 |
| 113 | Ga0099794_10001856 | 3300007265 | Bacteria | 7566 |
| 114 | Ga0099794_10024905 | 3300007265 | Bacteria | 2751 |
| 115 | Ga0099795_10028287 | 3300007788 | Bacteria | 1904 |
| 116 | Ga0105240_10026930 | 3300009093 | Bacteria | 7538 |
| 117 | Ga0105240_10075210 | 3300009093 | Bacteria | 4166 |
| 118 | Ga0105240_10148446 | 3300009093 | Bacteria | 2795 |
| 119 | Ga0111539_10045303 | 3300009094 | Bacteria | 5266 |
| 120 | Ga0105245_10075121 | 3300009098 | Bacteria | 3076 |
| 121 | Ga0105245_10261193 | 3300009098 | Bacteria | 1685 |
| 122 | Ga0105247_10074443 | 3300009101 | Bacteria | 2130 |
| 123 | Ga0105247_10077345 | 3300009101 | Bacteria | 2091 |
| 124 | Ga0105247_10130806 | 3300009101 | Bacteria | 1636 |
| 125 | Ga0105243_10327388 | 3300009148 | Bacteria | 1398 |
| 126 | Ga0105241_10248442 | 3300009174 | Bacteria | 1507 |
| 127 | Ga0105242_10384643 | 3300009176 | Bacteria | 1305 |
| 128 | Ga0105248_10089840 | 3300009177 | Bacteria | 3458 |
| 129 | Ga0105237_10014093 | 3300009545 | Bacteria | 8363 |
| 130 | Ga0105237_10067917 | 3300009545 | Bacteria | 3559 |
| 131 | Ga0105237_10090926 | 3300009545 | Bacteria | 3042 |
| 132 | Ga0105238_10025466 | 3300009551 | Bacteria | 6031 |
| 133 | Ga0105238_10141570 | 3300009551 | Bacteria | 2382 |
| 134 | Ga0105238_10323288 | 3300009551 | Bacteria | 1529 |
| 135 | Ga0099796_10017660 | 3300010159 | Bacteria | 2128 |
| 136 | Ga0099796_10018360 | 3300010159 | Bacteria | 2099 |
| 137 | Ga0105239_10182513 | 3300010375 | Bacteria | 2348 |
| 138 | Ga0105239_10231702 | 3300010375 | Bacteria | 2072 |
| 139 | Ga0105239_10293783 | 3300010375 | Bacteria | 1830 |
| 140 | Ga0105239_10427226 | 3300010375 | Bacteria | 1501 |
| 141 | Ga0105239_10448061 | 3300010375 | Bacteria | 1464 |
| 142 | Ga0157371_10118731 | 3300013102 | Bacteria | 1880 |
| 143 | Ga0157369_10016441 | 3300013105 | Bacteria | 8320 |
| 144 | Ga0157369_10183167 | 3300013105 | Bacteria | 2203 |
| 145 | Ga0157374_10136923 | 3300013296 | Bacteria | 2374 |
| 146 | Ga0157378_10079518 | 3300013297 | Bacteria | 2960 |
| 147 | Ga0157378_10220201 | 3300013297 | Bacteria | 1804 |
| 148 | Ga0163162_10049675 | 3300013306 | Bacteria | 4204 |
| 149 | Ga0163162_10106859 | 3300013306 | Bacteria | 2894 |
| 150 | Ga0157372_10089357 | 3300013307 | Bacteria | 3500 |
| 151 | Ga0157375_10567184 | 3300013308 | Bacteria | 1296 |
| 152 | Ga0163163_10034163 | 3300014325 | Bacteria | 4923 |
| 153 | Ga0163163_10130093 | 3300014325 | Bacteria | 2557 |
| 154 | Ga0157380_10266966 | 3300014326 | Bacteria | 1558 |
| 155 | Ga0157377_10243697 | 3300014745 | Bacteria | 1162 |
| 156 | Ga0157379_10330439 | 3300014968 | Bacteria | 1393 |
| 157 | Ga0157376_10309365 | 3300014969 | Bacteria | 1498 |
| 158 | Ga0163161_10086174 | 3300017792 | Bacteria | 2318 |
| 159 | Ga0214542_1000606 | 3300021321 | Bacteria | 66272 |
| 160 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 161 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 162 | Ga0213871_10000172 | 3300021441 | Bacteria | 7098 |
| 163 | Ga0209677_109175 | 3300025253 | Bacteria | 1810 |
| 164 | Ga0209673_1031986 | 3300025273 | Bacteria | 1627 |
| 165 | Ga0209564_1006619 | 3300025295 | Bacteria | 6196 |
| 166 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 167 | Ga0209758_1000477 | 3300025297 | Bacteria | 66111 |
| 168 | Ga0209758_1001198 | 3300025297 | Bacteria | 32768 |
| 169 | Ga0209758_1009643 | 3300025297 | Bacteria | 5950 |
| 170 | Ga0209758_1010946 | 3300025297 | Bacteria | 5334 |
| 171 | Ga0209758_1040941 | 3300025297 | Bacteria | 1740 |
| 172 | Ga0209256_1001993 | 3300025299 | Bacteria | 18340 |
| 173 | Ga0207426_1000519 | 3300025302 | Bacteria | 56155 |
| 174 | Ga0207426_1005792 | 3300025302 | Bacteria | 5537 |
| 175 | Ga0207426_1014062 | 3300025302 | Bacteria | 2945 |
| 176 | Ga0209257_1000654 | 3300025304 | Bacteria | 54783 |
| 177 | Ga0207697_10021166 | 3300025315 | Bacteria | 2663 |
| 178 | Ga0207692_10029455 | 3300025898 | Bacteria | 2609 |
| 179 | Ga0207642_10034421 | 3300025899 | Bacteria | 2154 |
| 180 | Ga0207642_10130686 | 3300025899 | Bacteria | 1310 |
| 181 | Ga0207710_10021188 | 3300025900 | Bacteria | 2783 |
| 182 | Ga0207688_10034750 | 3300025901 | Bacteria | 2791 |
| 183 | Ga0207688_10197565 | 3300025901 | Bacteria | 1205 |
| 184 | Ga0207699_10001448 | 3300025906 | Bacteria | 11271 |
| 185 | Ga0207699_10020904 | 3300025906 | Bacteria | 3517 |
| 186 | Ga0207699_10116871 | 3300025906 | Bacteria | 1718 |
| 187 | Ga0207643_10036462 | 3300025908 | Bacteria | 2758 |
| 188 | Ga0207705_10006541 | 3300025909 | Bacteria | 8632 |
| 189 | Ga0207705_10216530 | 3300025909 | Bacteria | 1453 |
| 190 | Ga0207705_10251157 | 3300025909 | Bacteria | 1349 |
| 191 | Ga0207684_10119982 | 3300025910 | Bacteria | 2254 |
| 192 | Ga0207654_10003430 | 3300025911 | Bacteria | 8015 |
| 193 | Ga0207654_10068361 | 3300025911 | Bacteria | 2101 |
| 194 | Ga0207707_10015539 | 3300025912 | Bacteria | 6630 |
| 195 | Ga0207707_10017840 | 3300025912 | Bacteria | 6190 |
| 196 | Ga0207707_10059169 | 3300025912 | Bacteria | 3334 |
| 197 | Ga0207695_10175228 | 3300025913 | Bacteria | 2067 |
| 198 | Ga0207671_10110598 | 3300025914 | Bacteria | 2090 |
| 199 | Ga0207693_10003822 | 3300025915 | Bacteria | 12827 |
| 200 | Ga0207663_10039730 | 3300025916 | Bacteria | 2853 |
| 201 | Ga0207662_10040704 | 3300025918 | Bacteria | 2733 |
| 202 | Ga0207657_10016104 | 3300025919 | Bacteria | 7218 |
| 203 | Ga0207657_10409556 | 3300025919 | Bacteria | 1066 |
| 204 | Ga0207649_10081414 | 3300025920 | Bacteria | 2096 |
| 205 | Ga0207649_10117731 | 3300025920 | Bacteria | 1786 |
| 206 | Ga0207652_10006364 | 3300025921 | Bacteria | 9535 |
| 207 | Ga0207652_10017291 | 3300025921 | Bacteria | 5899 |
| 208 | Ga0207646_10053775 | 3300025922 | Bacteria | 3601 |
| 209 | Ga0207681_10063046 | 3300025923 | Bacteria | 2555 |
| 210 | Ga0207681_10089076 | 3300025923 | Bacteria | 2199 |
| 211 | Ga0207650_10193562 | 3300025925 | Bacteria | 1626 |
| 212 | Ga0207650_10316839 | 3300025925 | Bacteria | 1277 |
| 213 | Ga0207659_10083431 | 3300025926 | Bacteria | 2369 |
| 214 | Ga0207659_10127452 | 3300025926 | Bacteria | 1959 |
| 215 | Ga0207687_10051934 | 3300025927 | Bacteria | 2859 |
| 216 | Ga0207687_10240179 | 3300025927 | Bacteria | 1435 |
| 217 | Ga0207700_10047207 | 3300025928 | Bacteria | 3191 |
| 218 | Ga0207664_10062284 | 3300025929 | Bacteria | 2979 |
| 219 | Ga0207690_10115138 | 3300025932 | Bacteria | 1943 |
| 220 | Ga0207706_10028322 | 3300025933 | Bacteria | 5003 |
| 221 | Ga0207706_10107502 | 3300025933 | Bacteria | 2455 |
| 222 | Ga0207706_10282412 | 3300025933 | Bacteria | 1447 |
| 223 | Ga0207686_10068859 | 3300025934 | Bacteria | 2268 |
| 224 | Ga0207709_10027813 | 3300025935 | Bacteria | 3263 |
| 225 | Ga0207669_10004960 | 3300025937 | Bacteria | 5920 |
| 226 | Ga0207669_10052028 | 3300025937 | Bacteria | 2458 |
| 227 | Ga0207669_10205669 | 3300025937 | Bacteria | 1433 |
| 228 | Ga0207665_10003894 | 3300025939 | Bacteria | 9984 |
| 229 | Ga0207691_10016444 | 3300025940 | Bacteria | 7022 |
| 230 | Ga0207691_10239251 | 3300025940 | Bacteria | 1570 |
| 231 | Ga0207711_10082201 | 3300025941 | Bacteria | 2815 |
| 232 | Ga0207711_10131333 | 3300025941 | Bacteria | 2246 |
| 233 | Ga0207689_10181564 | 3300025942 | Bacteria | 1735 |
| 234 | Ga0207661_10000879 | 3300025944 | Bacteria | 19757 |
| 235 | Ga0207661_10141995 | 3300025944 | Bacteria | 2067 |
| 236 | Ga0207679_10038891 | 3300025945 | Bacteria | 3394 |
| 237 | Ga0207679_10067239 | 3300025945 | Bacteria | 2688 |
| 238 | Ga0207667_10015772 | 3300025949 | Bacteria | 8567 |
| 239 | Ga0207667_10058484 | 3300025949 | Bacteria | 4043 |
| 240 | Ga0207668_10072624 | 3300025972 | Bacteria | 2462 |
| 241 | Ga0207640_10264241 | 3300025981 | Bacteria | 1343 |
| 242 | Ga0207658_10025279 | 3300025986 | Bacteria | 4158 |
| 243 | Ga0207677_10065583 | 3300026023 | Bacteria | 2534 |
| 244 | Ga0207677_10126182 | 3300026023 | Bacteria | 1934 |
| 245 | Ga0207703_10083088 | 3300026035 | Bacteria | 2675 |
| 246 | Ga0207703_10116891 | 3300026035 | Bacteria | 2284 |
| 247 | Ga0207703_10227101 | 3300026035 | Bacteria | 1672 |
| 248 | Ga0207703_10320324 | 3300026035 | Bacteria | 1420 |
| 249 | Ga0207703_10340095 | 3300026035 | Bacteria | 1379 |
| 250 | Ga0207639_10085591 | 3300026041 | Bacteria | 2507 |
| 251 | Ga0207678_10003691 | 3300026067 | Bacteria | 13762 |
| 252 | Ga0207678_10076471 | 3300026067 | Bacteria | 2867 |
| 253 | Ga0207678_10206056 | 3300026067 | Bacteria | 1682 |
| 254 | Ga0207678_10261938 | 3300026067 | Bacteria | 1482 |
| 255 | Ga0207708_10157527 | 3300026075 | Bacteria | 1792 |
| 256 | Ga0207702_10000414 | 3300026078 | Bacteria | 48824 |
| 257 | Ga0207702_10191797 | 3300026078 | Bacteria | 1889 |
| 258 | Ga0207702_10277103 | 3300026078 | Bacteria | 1584 |
| 259 | Ga0207641_10124501 | 3300026088 | Bacteria | 2306 |
| 260 | Ga0207641_10153590 | 3300026088 | Bacteria | 2087 |
| 261 | Ga0207648_10111412 | 3300026089 | Bacteria | 2403 |
| 262 | Ga0207648_10237852 | 3300026089 | Bacteria | 1621 |
| 263 | Ga0207674_10023338 | 3300026116 | Bacteria | 6629 |
| 264 | Ga0207675_100171903 | 3300026118 | Bacteria | 2071 |
| 265 | Ga0207683_10229243 | 3300026121 | Bacteria | 1693 |
| 266 | Ga0207683_10366148 | 3300026121 | Bacteria | 1324 |
| 267 | Ga0207698_10127824 | 3300026142 | Bacteria | 2165 |
| 268 | Ga0207698_10306484 | 3300026142 | Bacteria | 1481 |
| 269 | Ga0209389_1000077 | 3300027296 | Bacteria | 91273 |
| 270 | Ga0209589_1000011 | 3300027357 | Bacteria | 236981 |
| 271 | Ga0209489_100012 | 3300027361 | Bacteria | 236981 |
| 272 | Ga0209489_100251 | 3300027361 | Bacteria | 91273 |
| 273 | Ga0209700_100019 | 3300027363 | Bacteria | 236981 |
| 274 | Ga0209700_100271 | 3300027363 | Bacteria | 91215 |
| 275 | Ga0207428_10224954 | 3300027907 | Bacteria | 1405 |
| 276 | Ga0268266_10002986 | 3300028379 | Bacteria | 17442 |
| 277 | Ga0268266_10232329 | 3300028379 | Bacteria | 1699 |
| 278 | Ga0268265_10013205 | 3300028380 | Bacteria | 5611 |
| 279 | Ga0268265_10044450 | 3300028380 | Bacteria | 3307 |
| 280 | Ga0268265_10289550 | 3300028380 | Bacteria | 1470 |
| 281 | Ga0268264_10000030 | 3300028381 | Bacteria | 418542 |
| 282 | Ga0307517_10000386 | 3300028786 | Bacteria | 75442 |
| 283 | Ga0307515_10009804 | 3300028794 | Bacteria | 18452 |
| 284 | Ga0307512_10144844 | 3300030522 | Bacteria | 1441 |
| 285 | Ga0265332_10046928 | 3300031238 | Bacteria | 1860 |
| 286 | Ga0307513_10196993 | 3300031456 | Bacteria | 1860 |
| 287 | Ga0307509_10075783 | 3300031507 | Bacteria | 3493 |
| 288 | Ga0307509_10269423 | 3300031507 | Bacteria | 1471 |
| 289 | Ga0307508_10115965 | 3300031616 | Bacteria | 2280 |
| 290 | Ga0307508_10157547 | 3300031616 | Bacteria | 1874 |
| 291 | Ga0265314_10001188 | 3300031711 | Bacteria | 29895 |
| 292 | Ga0265342_10055007 | 3300031712 | Bacteria | 2364 |
| 293 | Ga0307516_10000939 | 3300031730 | Bacteria | 40200 |
| 294 | Ga0307516_10076248 | 3300031730 | Bacteria | 3206 |
| 295 | Ga0307516_10206235 | 3300031730 | Bacteria | 1682 |
| 296 | Ga0307406_10113799 | 3300031901 | Bacteria | 1868 |
| 297 | Ga0307411_10025196 | 3300032005 | Bacteria | 3560 |
| 298 | Ga0307507_10085869 | 3300033179 | Bacteria | 2734 |
| 299 | Ga0307510_10030787 | 3300033180 | Bacteria | 6077 |
| 300 | Ga0307510_10057657 | 3300033180 | Bacteria | 4028 |
| 301 | Ga0307510_10138063 | 3300033180 | Bacteria | 2090 |
| 302 | Ga0315911_1000003 | 3300033442 | Bacteria | 502217 |
| 303 | Ga0316215_1003530 | 3300033544 | Bacteria | 1492 |
| 304 | Ga0373928_0027821 | 3300035084 | Bacteria | 1233 |
| 305 | Ga0373929_0016007 | 3300035085 | Bacteria | 1465 |
| 306 | Ga0373934_0040949 | 3300035086 | Bacteria | 1828 |
| 307 | Ga0373944_0008813 | 3300035089 | Bacteria | 2727 |
| 308 | Ga0373944_0026305 | 3300035089 | Bacteria | 1718 |
| 309 | Ga0373944_0029826 | 3300035089 | Bacteria | 1633 |
| 310 | Ga0373923_0001708 | 3300035111 | Bacteria | 6440 |
| 311 | Ga0373936_0009455 | 3300035113 | Bacteria | 3676 |
| 312 | Ga0373936_0053600 | 3300035113 | Bacteria | 1636 |
| 313 | Ga0373936_0055610 | 3300035113 | Bacteria | 1607 |
| 314 | Ga0373936_0073580 | 3300035113 | Bacteria | 1413 |
| 315 | Ga0373945_0017533 | 3300035116 | Bacteria | 2425 |
| 316 | Ga0373945_0031429 | 3300035116 | Bacteria | 1876 |
| 317 | Ga0373954_0013045 | 3300035118 | Bacteria | 3699 |
| 318 | Ga0373956_0014989 | 3300035119 | Bacteria | 3242 |
| 319 | Ga0373956_0020073 | 3300035119 | Bacteria | 2839 |
| 320 | Ga0373957_0001196 | 3300035120 | Bacteria | 6939 |
| 321 | Ga0373943_0013236 | 3300035170 | Bacteria | 3724 |
| 322 | Ga0373943_0025476 | 3300035170 | Bacteria | 2765 |
| 323 | Ga0373943_0069693 | 3300035170 | Bacteria | 1778 |
| 324 | Ga0373943_0092370 | 3300035170 | Bacteria | 1569 |
| 325 | Ga0373946_0002425 | 3300035171 | Bacteria | 6596 |
| 326 | Ga0373955_0000956 | 3300035172 | Bacteria | 12321 |
| 327 | Ga0373955_0007308 | 3300035172 | Bacteria | 5074 |
| 328 | Ga0373935_0000424 | 3300035692 | Bacteria | 22007 |
| 329 | Ga0373935_0049140 | 3300035692 | Bacteria | 2672 |
| 330 | Ga0373935_0284643 | 3300035692 | Bacteria | 1164 |
| 331 | Ga0373927_0010213 | 3300035695 | Bacteria | 6272 |
| 332 | Ga0373927_0017385 | 3300035695 | Bacteria | 4733 |
| 333 | Ga0373927_0018609 | 3300035695 | Bacteria | 4561 |
| 334 | Ga0373927_0019865 | 3300035695 | Bacteria | 4405 |
| 335 | Ga0373927_0021331 | 3300035695 | Bacteria | 4245 |
| 336 | Ga0373933_0003417 | 3300035724 | Bacteria | 8851 |
| 337 | Ga0373933_0023750 | 3300035724 | Bacteria | 3505 |
| 338 | Ga0373933_0069648 | 3300035724 | Bacteria | 2139 |
| 339 | Ga0373947_0001385 | 3300035725 | Bacteria | 14937 |
| 340 | Ga0373947_0006895 | 3300035725 | Bacteria | 6585 |
| 341 | Ga0373947_0050361 | 3300035725 | Bacteria | 2504 |
| 342 | Ga0373947_0063618 | 3300035725 | Bacteria | 2248 |
| 343 | Ga0373937_0027696 | 3300036401 | Bacteria | 5127 |
| 344 | Ga0373937_0034455 | 3300036401 | Bacteria | 4606 |
| 345 | Ga0373925_0012039 | 3300037068 | Bacteria | 6264 |
| 346 | Ga0373925_0023527 | 3300037068 | Bacteria | 4495 |
| 347 | Ga0373925_0029824 | 3300037068 | Bacteria | 4001 |
| 348 | Ga0373925_0032464 | 3300037068 | Bacteria | 3843 |
| 349 | Ga0373925_0034946 | 3300037068 | Bacteria | 3706 |
| 350 | Ga0373925_0056395 | 3300037068 | Bacteria | 2943 |
| 351 | Ga0395899_0006839 | 3300037312 | Bacteria | 8835 |
| 352 | Ga0395900_0005550 | 3300037418 | Bacteria | 13206 |
| 353 | Ga0395900_0006232 | 3300037418 | Bacteria | 12449 |
| 354 | Ga0395898_0032295 | 3300037466 | Bacteria | 5225 |
| 355 | Ga0395898_0104054 | 3300037466 | Bacteria | 2723 |
| 356 | Ga0395905_0003367 | 3300037471 | Bacteria | 17136 |
| 357 | Ga0395901_0028747 | 3300038443 | Bacteria | 5719 |
| 358 | Ga0395901_0041302 | 3300038443 | Bacteria | 4779 |
| 359 | Ga0395901_0100559 | 3300038443 | Bacteria | 3033 |
| 360 | Ga0395901_0188212 | 3300038443 | Bacteria | 2165 |
| 361 | Ga0436360_0462666 | 3300039438 | Bacteria | 13281 |
| 362 | Ga0451800_0868857 | 3300041459 | Bacteria | 1243 |
| 363 | Ga0451577_0014843 | 3300042876 | Bacteria | 7257 |
| 364 | Ga0466972_0000113 | 3300044658 | Bacteria | 69042 |
| 365 | Ga0466965_0008177 | 3300044683 | Bacteria | 4832 |
| 366 | Ga0466966_0000398 | 3300044684 | Bacteria | 28025 |
| 367 | Ga0466961_0000005 | 3300044693 | Bacteria | 173105 |
| 368 | Ga0466960_0022833 | 3300044901 | Bacteria | 2801 |
| 369 | Ga0466959_0000670 | 3300045049 | Bacteria | 20009 |
| 370 | Ga0451576_0029621 | 3300045051 | Bacteria | 5857 |
| 371 | Ga0451576_0129184 | 3300045051 | Bacteria | 2634 |
| 372 | Ga0466967_0056707 | 3300045976 | Bacteria | 3455 |
| 373 | Ga0466967_0058132 | 3300045976 | Bacteria | 3417 |
| 374 | Ga0466967_0280833 | 3300045976 | Bacteria | 1598 |
| 375 | Ga0495592_0010638 | 3300046454 | Bacteria | 6937 |
| 376 | Ga0495592_0018813 | 3300046454 | Bacteria | 5260 |
| 377 | Ga0495592_0058300 | 3300046454 | Bacteria | 2848 |
| 378 | Ga0495592_0238170 | 3300046454 | Bacteria | 1209 |
| 379 | Ga0495603_0000003 | 3300046455 | Bacteria | 83533 |
| 380 | Ga0495629_0002388 | 3300046459 | Bacteria | 14446 |
| 381 | Ga0495629_0009839 | 3300046459 | Bacteria | 6977 |
| 382 | Ga0495629_0086032 | 3300046459 | Bacteria | 2193 |
| 383 | Ga0495638_0000392 | 3300046460 | Bacteria | 53945 |
| 384 | Ga0495641_0009506 | 3300046461 | Bacteria | 5768 |
| 385 | Ga0495651_0002716 | 3300046462 | Bacteria | 13730 |
| 386 | Ga0495651_0075007 | 3300046462 | Bacteria | 2565 |
| 387 | Ga0495653_0095296 | 3300046463 | Bacteria | 2167 |
| 388 | Ga0495580_0001857 | 3300046472 | Bacteria | 18580 |
| 389 | Ga0495580_0011167 | 3300046472 | Bacteria | 6956 |
| 390 | Ga0495582_0000016 | 3300046473 | Bacteria | 100714 |
| 391 | Ga0495582_0044998 | 3300046473 | Bacteria | 2431 |
| 392 | Ga0495605_0062889 | 3300046474 | Bacteria | 1772 |
| 393 | Ga0495639_0000075 | 3300046475 | Bacteria | 46617 |
| 394 | Ga0495662_0011526 | 3300046476 | Bacteria | 4320 |
| 395 | Ga0495662_0033000 | 3300046476 | Bacteria | 2501 |
| 396 | Ga0495664_0003066 | 3300046477 | Bacteria | 9054 |
| 397 | Ga0495664_0008072 | 3300046477 | Bacteria | 5859 |
| 398 | Ga0495664_0011974 | 3300046477 | Bacteria | 4901 |
| 399 | Ga0495664_0019306 | 3300046477 | Bacteria | 3917 |
| 400 | Ga0495664_0075124 | 3300046477 | Bacteria | 2022 |
| 401 | Ga0495584_0049936 | 3300046491 | Bacteria | 2107 |
| 402 | Ga0495594_0000120 | 3300046499 | Bacteria | 36823 |
| 403 | Ga0495596_0036158 | 3300046500 | Bacteria | 1957 |
| 404 | Ga0495606_0001387 | 3300046507 | Bacteria | 32754 |
| 405 | Ga0495618_0048104 | 3300046514 | Bacteria | 2692 |
| 406 | Ga0495618_0062734 | 3300046514 | Bacteria | 2359 |
| 407 | Ga0495628_0051250 | 3300046516 | Bacteria | 3263 |
| 408 | Ga0495630_0037982 | 3300046517 | Bacteria | 3601 |
| 409 | Ga0495630_0321750 | 3300046517 | Bacteria | 1182 |
| 410 | Ga0495666_0127627 | 3300046526 | Bacteria | 1189 |
| 411 | Ga0495652_0011876 | 3300046529 | Bacteria | 7872 |
| 412 | Ga0495652_0014719 | 3300046529 | Bacteria | 7013 |
| 413 | Ga0495652_0060328 | 3300046529 | Bacteria | 3206 |
| 414 | Ga0495654_0087994 | 3300046530 | Bacteria | 1445 |
| 415 | Ga0495665_0000270 | 3300046531 | Bacteria | 26319 |
| 416 | Ga0495640_0000210 | 3300046533 | Bacteria | 38945 |
| 417 | Ga0495640_0020628 | 3300046533 | Bacteria | 4848 |
| 418 | Ga0495640_0034237 | 3300046533 | Bacteria | 3604 |
| 419 | Ga0495640_0038421 | 3300046533 | Bacteria | 3367 |
| 420 | Ga0495587_0039151 | 3300046536 | Bacteria | 2839 |
| 421 | Ga0495587_0043439 | 3300046536 | Bacteria | 2676 |
| 422 | Ga0495645_0012046 | 3300046543 | Bacteria | 6094 |
| 423 | Ga0495645_0020206 | 3300046543 | Bacteria | 4802 |
| 424 | Ga0495645_0155296 | 3300046543 | Bacteria | 1586 |
| 425 | Ga0495622_0003400 | 3300046557 | Bacteria | 7500 |
| 426 | Ga0495622_0062233 | 3300046557 | Bacteria | 1727 |
| 427 | Ga0495667_0024058 | 3300046559 | Bacteria | 4102 |
| 428 | Ga0495667_0054939 | 3300046559 | Bacteria | 2619 |
| 429 | Ga0495634_0000064 | 3300046642 | Bacteria | 85710 |
| 430 | Ga0495634_0008410 | 3300046642 | Bacteria | 7687 |
| 431 | Ga0495634_0023703 | 3300046642 | Bacteria | 4311 |
| 432 | Ga0495625_0140979 | 3300046660 | Bacteria | 1626 |
| 433 | Ga0495635_0000316 | 3300046663 | Bacteria | 31407 |
| 434 | Ga0495635_0031259 | 3300046663 | Bacteria | 3697 |
| 435 | Ga0495635_0104993 | 3300046663 | Bacteria | 1930 |
| 436 | Ga0495588_0004843 | 3300046674 | Bacteria | 5964 |
| 437 | Ga0495588_0014430 | 3300046674 | Bacteria | 3782 |
| 438 | Ga0495588_0048145 | 3300046674 | Bacteria | 2190 |
| 439 | Ga0495657_0010591 | 3300046675 | Bacteria | 6929 |
| 440 | Ga0495657_0103560 | 3300046675 | Bacteria | 1810 |
| 441 | Ga0495599_0065618 | 3300046678 | Bacteria | 2268 |
| 442 | Ga0495623_0020849 | 3300046679 | Bacteria | 4236 |
| 443 | Ga0495623_0071074 | 3300046679 | Bacteria | 2166 |
| 444 | Ga0495646_0055284 | 3300046680 | Bacteria | 2384 |
| 445 | Ga0495646_0057415 | 3300046680 | Bacteria | 2330 |
| 446 | Ga0495647_0023006 | 3300046681 | Bacteria | 2256 |
| 447 | Ga0495647_0053037 | 3300046681 | Bacteria | 1580 |
| 448 | Ga0495658_0002630 | 3300046683 | Bacteria | 9021 |
| 449 | Ga0495669_0037455 | 3300046684 | Bacteria | 2146 |
| 450 | Ga0495613_0004076 | 3300046689 | Bacteria | 10922 |
| 451 | Ga0495613_0072130 | 3300046689 | Bacteria | 2517 |
| 452 | Ga0495613_0084854 | 3300046689 | Bacteria | 2299 |
| 453 | Ga0495624_0010653 | 3300046690 | Bacteria | 6332 |
| 454 | Ga0495624_0024452 | 3300046690 | Bacteria | 3974 |
| 455 | Ga0495649_0145846 | 3300046694 | Bacteria | 1245 |
| 456 | Ga0495600_0086233 | 3300046809 | Bacteria | 2049 |
| 457 | Ga0495600_0117870 | 3300046809 | Bacteria | 1727 |
| 458 | Ga0495581_0000014 | 3300047315 | Bacteria | 60735 |
| 459 | Ga0495604_0019282 | 3300047317 | Bacteria | 5459 |
| 460 | Ga0495604_0045443 | 3300047317 | Bacteria | 3427 |
| 461 | Ga0495604_0220204 | 3300047317 | Bacteria | 1307 |
| 462 | Ga0495674_0001069 | 3300047319 | Bacteria | 26383 |
| 463 | Ga0495674_0002679 | 3300047319 | Bacteria | 17337 |
| 464 | Ga0495674_0007246 | 3300047319 | Bacteria | 10615 |
| 465 | Ga0495676_0059798 | 3300047321 | Bacteria | 2990 |
| 466 | Ga0495676_0088677 | 3300047321 | Bacteria | 2319 |
| 467 | Ga0495676_0211683 | 3300047321 | Bacteria | 1341 |
| 468 | Ga0495680_0002674 | 3300047322 | Bacteria | 17996 |
| 469 | Ga0495680_0011794 | 3300047322 | Bacteria | 7720 |
| 470 | Ga0495683_0124322 | 3300047323 | Bacteria | 1222 |
| 471 | Ga0495675_0007708 | 3300047444 | Bacteria | 6639 |
| 472 | Ga0495684_0002682 | 3300047471 | Bacteria | 14099 |
| 473 | Ga0495684_0007582 | 3300047471 | Bacteria | 8396 |
| 474 | Ga0495684_0026033 | 3300047471 | Bacteria | 4496 |
| 475 | Ga0495684_0215353 | 3300047471 | Bacteria | 1410 |
| 476 | Ga0495593_0000003 | 3300047673 | Bacteria | 120744 |
| 477 | Ga0495593_0001206 | 3300047673 | Bacteria | 15113 |
| 478 | Ga0495593_0005968 | 3300047673 | Bacteria | 7173 |
| 479 | Ga0495602_0031427 | 3300048088 | Bacteria | 5020 |
| 480 | Ga0495614_0013203 | 3300048089 | Bacteria | 3624 |
| 481 | Ga0496101_0061143 | 3300048904 | Bacteria | 2735 |
| 482 | Ga0496102_0066002 | 3300048905 | Bacteria | 3317 |
| 483 | Ga0496102_0179249 | 3300048905 | Bacteria | 1996 |
| 484 | Ga0496102_0200361 | 3300048905 | Bacteria | 1882 |
| 485 | Ga0496103_0024383 | 3300048906 | Bacteria | 3652 |
| 486 | Ga0496103_0026161 | 3300048906 | Bacteria | 3532 |
| 487 | Ga0496103_0137332 | 3300048906 | Bacteria | 1563 |
| 488 | Ga0496104_0007868 | 3300048907 | Bacteria | 9449 |
| 489 | Ga0496104_0039268 | 3300048907 | Bacteria | 4431 |
| 490 | Ga0496105_0007252 | 3300048908 | Bacteria | 8560 |
| 491 | Ga0496105_0139800 | 3300048908 | Bacteria | 1993 |
| 492 | Ga0496106_0019837 | 3300048909 | Bacteria | 4985 |
| 493 | Ga0496107_0002644 | 3300048910 | Bacteria | 11717 |
| 494 | Ga0496108_0153982 | 3300048911 | Bacteria | 1984 |
| 495 | Ga0496109_0030452 | 3300048912 | Bacteria | 4836 |
| 496 | Ga0496109_0220267 | 3300048912 | Bacteria | 1784 |
| 497 | Ga0496109_0294941 | 3300048912 | Bacteria | 1529 |
| 498 | Ga0496110_0020128 | 3300048913 | Bacteria | 5629 |
| 499 | Ga0496110_0026150 | 3300048913 | Bacteria | 4991 |
| 500 | Ga0496111_0010633 | 3300048914 | Bacteria | 6184 |
| 501 | Ga0496111_0177062 | 3300048914 | Bacteria | 1585 |
| 502 | Ga0496112_0027239 | 3300048915 | Bacteria | 5511 |
| 503 | Ga0496112_0124684 | 3300048915 | Bacteria | 2547 |
| 504 | Ga0496112_0242010 | 3300048915 | Bacteria | 1757 |
| 505 | Ga0496112_0425728 | 3300048915 | Bacteria | 1266 |
| 506 | Ga0496114_0081234 | 3300048917 | Bacteria | 2738 |
| 507 | Ga0496114_0127978 | 3300048917 | Bacteria | 2191 |
| 508 | Ga0496115_0003047 | 3300048918 | Bacteria | 12028 |
| 509 | Ga0496115_0107351 | 3300048918 | Bacteria | 2292 |
| 510 | Ga0496116_0023995 | 3300048919 | Bacteria | 4524 |
| 511 | Ga0496119_0017624 | 3300048922 | Bacteria | 5364 |
| 512 | Ga0496121_0029799 | 3300048924 | Bacteria | 5031 |
| 513 | Ga0496121_0034261 | 3300048924 | Bacteria | 4573 |
| 514 | Ga0496121_0035413 | 3300048924 | Bacteria | 4475 |
| 515 | Ga0496121_0038100 | 3300048924 | Bacteria | 4263 |
| 516 | Ga0496121_0144458 | 3300048924 | Bacteria | 1760 |
| 517 | Ga0496121_0155084 | 3300048924 | Bacteria | 1681 |
| 518 | Ga0496126_0007029 | 3300048929 | Bacteria | 12417 |
| 519 | Ga0496126_0020185 | 3300048929 | Bacteria | 6539 |
| 520 | Ga0496126_0129432 | 3300048929 | Bacteria | 2182 |
| 521 | Ga0496126_0252466 | 3300048929 | Bacteria | 1469 |
| 522 | Ga0496126_0383247 | 3300048929 | Bacteria | 1144 |
| 523 | Ga0501034_0378394 | 3300049571 | Bacteria | 1341 |
| 524 | Ga0501036_0143300 | 3300049572 | Bacteria | 2016 |
| 525 | Ga0501047_0006540 | 3300049581 | Bacteria | 10972 |
| 526 | Ga0501069_0090306 | 3300049585 | Bacteria | 1732 |
| 527 | Ga0501070_0004771 | 3300049586 | Bacteria | 11605 |
| 528 | Ga0501080_0058215 | 3300049742 | Bacteria | 3597 |
| 529 | Ga0501080_0277958 | 3300049742 | Bacteria | 1523 |
| 530 | Ga0501035_0120970 | 3300049822 | Bacteria | 2289 |
| 531 | nmdc:mga03n38_20946_c1 | 3300050490 | Bacteria | 2624 |
| 532 | nmdc:mga0yw44_173002_c1 | 3300050492 | Bacteria | 1419 |
| 533 | nmdc:mga0yw44_81973_c1 | 3300050492 | Bacteria | 2023 |
| 534 | nmdc:mga0k408_10653_c1 | 3300050493 | Bacteria | 4978 |
| 535 | nmdc:mga0k408_262871_c1 | 3300050493 | Bacteria | 1030 |
| 536 | nmdc:mga06z11_1257_c1 | 3300050494 | Bacteria | 9144 |
| 537 | nmdc:mga06z11_56355_c1 | 3300050494 | Bacteria | 2033 |
| 538 | nmdc:mga07m45_11460_c1 | 3300050496 | Bacteria | 4658 |
| 539 | nmdc:mga05p37_283809_c1 | 3300050507 | Bacteria | 1973 |
| 540 | nmdc:mga08y16_217282_c1 | 3300050511 | Bacteria | 1979 |
| 541 | nmdc:mga0n895_242940_c1 | 3300050512 | Bacteria | 1827 |
| 542 | nmdc:mga0n895_512365_c1 | 3300050512 | Bacteria | 1208 |
| 543 | nmdc:mga0rr50_61425_c1 | 3300050513 | Bacteria | 2831 |
| 544 | nmdc:mga0sz30_60358_c1 | 3300050516 | Bacteria | 1619 |
| 545 | Ga0495601_0032907 | 3300053077 | Bacteria | 3229 |
| 546 | Ga0495601_0080098 | 3300053077 | Bacteria | 2095 |
| 547 | Ga0495601_0106355 | 3300053077 | Bacteria | 1815 |
| 548 | Ga0500635_0030075 | 3300053080 | Bacteria | 1748 |
| 549 | Ga0500643_000218 | 3300053087 | Bacteria | 53579 |
| 550 | Ga0500583_0014376 | 3300053092 | Bacteria | 3097 |
| 551 | Ga0500566_0003699 | 3300053094 | Bacteria | 9135 |
| 552 | Ga0500566_0007050 | 3300053094 | Bacteria | 6655 |
| 553 | Ga0500566_0052932 | 3300053094 | Bacteria | 2318 |
| 554 | Ga0500641_0030039 | 3300053096 | Bacteria | 2132 |
| 555 | Ga0500555_011063 | 3300053103 | Bacteria | 2591 |
| 556 | Ga0500595_000898 | 3300053119 | Bacteria | 16951 |
| 557 | Ga0500595_010401 | 3300053119 | Bacteria | 3699 |
| 558 | Ga0500642_0000922 | 3300053130 | Bacteria | 8545 |
| 559 | Ga0500559_0083706 | 3300053136 | Bacteria | 1453 |
| 560 | Ga0500603_014567 | 3300053150 | Bacteria | 1838 |
| 561 | Ga0500616_0009445 | 3300053153 | Bacteria | 5932 |
| 562 | Ga0500616_0055964 | 3300053153 | Bacteria | 2060 |
| 563 | Ga0500637_0000103 | 3300053178 | Bacteria | 30634 |
| 564 | Ga0500637_0126908 | 3300053178 | Bacteria | 1479 |
| 565 | Ga0500599_002035 | 3300053736 | Bacteria | 2395 |
| 566 | Ga0500661_001897 | 3300055283 | Bacteria | 3944 |
| 567 | Ga0466962_0088834 | 3300061719 | Bacteria | 1480 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041459 | Ga0451800_0868857 | Ga0451800_0868857_294_1112 | 268 |
| 2 | 3300047321 | Ga0495676_0088677 | Ga0495676_0088677_10_846 | 278 |
| 3 | 3300050492 | nmdc:mga0yw44_173002_c1 | nmdc:mga0yw44_173002_c1_543_1409 | 288 |
| 4 | 3300050493 | nmdc:mga0k408_262871_c1 | nmdc:mga0k408_262871_c1_150_1016 | 288 |
| 5 | 3300005937 | Ga0081455_10000391 | Ga0081455_1000039141 | 292 |
| 6 | 3300050512 | nmdc:mga0n895_512365_c1 | nmdc:mga0n895_512365_c1_35_925 | 295 |
| 7 | 3300005937 | Ga0081455_10049326 | Ga0081455_100493263 | 298 |
| 8 | 3300047673 | Ga0495593_0001206 | Ga0495593_0001206_13327_14250 | 303 |
| 9 | 3300050496 | nmdc:mga07m45_11460_c1 | nmdc:mga07m45_11460_c1_2891_3829 | 308 |
| 10 | 3300046460 | Ga0495638_0000392 | Ga0495638_0000392_42981_43976 | 309 |
| 11 | 3300053153 | Ga0500616_0009445 | Ga0500616_0009445_1074_2060 | 309 |
| 12 | 3300053153 | Ga0500616_0055964 | Ga0500616_0055964_412_1407 | 309 |
| 13 | 3300039438 | Ga0436360_0462666 | Ga0436360_0462666_8141_9076 | 310 |
| 14 | 3300045051 | Ga0451576_0129184 | Ga0451576_0129184_1282_2277 | 312 |
| 15 | 3300048929 | Ga0496126_0252466 | Ga0496126_0252466_517_1455 | 312 |
| 16 | 3300049742 | Ga0501080_0277958 | Ga0501080_0277958_12_953 | 313 |
| 17 | 3300042876 | Ga0451577_0014843 | Ga0451577_0014843_4714_5679 | 314 |
| 18 | 3300005329 | Ga0070683_100022696 | Ga0070683_1000226964 | 315 |
| 19 | 3300005616 | Ga0068852_100026620 | Ga0068852_1000266203 | 315 |
| 20 | 3300005719 | Ga0068861_100248684 | Ga0068861_1002486842 | 315 |
| 21 | 3300005843 | Ga0068860_100329767 | Ga0068860_1003297672 | 315 |
| 22 | 3300009551 | Ga0105238_10025466 | Ga0105238_100254663 | 315 |
| 23 | 3300010375 | Ga0105239_10427226 | Ga0105239_104272262 | 315 |
| 24 | 3300013102 | Ga0157371_10118731 | Ga0157371_101187312 | 315 |
| 25 | 3300013105 | Ga0157369_10183167 | Ga0157369_101831673 | 315 |
| 26 | 3300025944 | Ga0207661_10141995 | Ga0207661_101419952 | 315 |
| 27 | 3300025945 | Ga0207679_10067239 | Ga0207679_100672392 | 315 |
| 28 | 3300026078 | Ga0207702_10277103 | Ga0207702_102771032 | 315 |
| 29 | 3300026142 | Ga0207698_10127824 | Ga0207698_101278242 | 315 |
| 30 | 3300035113 | Ga0373936_0055610 | Ga0373936_0055610_16_987 | 315 |
| 31 | 3300035170 | Ga0373943_0013236 | Ga0373943_0013236_1623_2594 | 315 |
| 32 | 3300035692 | Ga0373935_0049140 | Ga0373935_0049140_1627_2598 | 315 |
| 33 | 3300035695 | Ga0373927_0018609 | Ga0373927_0018609_3297_4268 | 315 |
| 34 | 3300035724 | Ga0373933_0069648 | Ga0373933_0069648_149_1120 | 315 |
| 35 | 3300035725 | Ga0373947_0006895 | Ga0373947_0006895_4078_5049 | 315 |
| 36 | 3300037068 | Ga0373925_0023527 | Ga0373925_0023527_3407_4378 | 315 |
| 37 | 3300037418 | Ga0395900_0005550 | Ga0395900_0005550_10634_11581 | 315 |
| 38 | 3300038443 | Ga0395901_0028747 | Ga0395901_0028747_3562_4509 | 315 |
| 39 | 3300045976 | Ga0466967_0056707 | Ga0466967_0056707_2123_3070 | 315 |
| 40 | 3300049571 | Ga0501034_0378394 | Ga0501034_0378394_273_1220 | 315 |
| 41 | 3300005327 | Ga0070658_10022995 | Ga0070658_100229952 | 316 |
| 42 | 3300005336 | Ga0070680_100003467 | Ga0070680_1000034679 | 316 |
| 43 | 3300005341 | Ga0070691_10098321 | Ga0070691_100983212 | 316 |
| 44 | 3300005355 | Ga0070671_100130024 | Ga0070671_1001300242 | 316 |
| 45 | 3300005471 | Ga0070698_100031688 | Ga0070698_1000316883 | 316 |
| 46 | 3300005518 | Ga0070699_100010113 | Ga0070699_1000101136 | 316 |
| 47 | 3300005536 | Ga0070697_100018658 | Ga0070697_1000186582 | 316 |
| 48 | 3300005563 | Ga0068855_100089170 | Ga0068855_1000891704 | 316 |
| 49 | 3300005841 | Ga0068863_100455703 | Ga0068863_1004557032 | 316 |
| 50 | 3300006195 | Ga0075366_10228167 | Ga0075366_102281671 | 316 |
| 51 | 3300009093 | Ga0105240_10026930 | Ga0105240_100269305 | 316 |
| 52 | 3300009093 | Ga0105240_10075210 | Ga0105240_100752102 | 316 |
| 53 | 3300025909 | Ga0207705_10006541 | Ga0207705_100065415 | 316 |
| 54 | 3300025910 | Ga0207684_10119982 | Ga0207684_101199822 | 316 |
| 55 | 3300025912 | Ga0207707_10017840 | Ga0207707_100178404 | 316 |
| 56 | 3300025913 | Ga0207695_10175228 | Ga0207695_101752282 | 316 |
| 57 | 3300025919 | Ga0207657_10409556 | Ga0207657_104095562 | 316 |
| 58 | 3300025921 | Ga0207652_10006364 | Ga0207652_100063645 | 316 |
| 59 | 3300025925 | Ga0207650_10193562 | Ga0207650_101935622 | 316 |
| 60 | 3300025949 | Ga0207667_10015772 | Ga0207667_100157724 | 316 |
| 61 | 3300026088 | Ga0207641_10153590 | Ga0207641_101535902 | 316 |
| 62 | 3300028380 | Ga0268265_10289550 | Ga0268265_102895502 | 316 |
| 63 | 3300037312 | Ga0395899_0006839 | Ga0395899_0006839_6013_6975 | 316 |
| 64 | 3300038443 | Ga0395901_0041302 | Ga0395901_0041302_1944_2906 | 316 |
| 65 | 3300045051 | Ga0451576_0029621 | Ga0451576_0029621_2848_3819 | 316 |
| 66 | iso_pu_bacteria | 2922386360 | 2922386960 | 316 |
| 67 | 3300005366 | Ga0070659_100165406 | Ga0070659_1001654062 | 317 |
| 68 | 3300005564 | Ga0070664_100017524 | Ga0070664_1000175243 | 317 |
| 69 | 3300005843 | Ga0068860_100022237 | Ga0068860_1000222375 | 317 |
| 70 | 3300006051 | Ga0075364_10117840 | Ga0075364_101178402 | 317 |
| 71 | 3300013307 | Ga0157372_10089357 | Ga0157372_100893572 | 317 |
| 72 | 3300050493 | nmdc:mga0k408_10653_c1 | nmdc:mga0k408_10653_c1_1530_2486 | 317 |
| 73 | iso_pu_bacteria | 2791355197 | 2793066532 | 317 |
| 74 | iso_pu_bacteria | 2904699407 | 2904701075 | 317 |
| 75 | iso_pu_bacteria | 3005474847 | 3005481432 | 317 |
| 76 | 3300005578 | Ga0068854_100223156 | Ga0068854_1002231562 | 318 |
| 77 | 3300005614 | Ga0068856_100000147 | Ga0068856_1000001472 | 318 |
| 78 | 3300005983 | Ga0081540_1041454 | Ga0081540_10414542 | 318 |
| 79 | 3300025981 | Ga0207640_10264241 | Ga0207640_102642411 | 318 |
| 80 | 3300026078 | Ga0207702_10000414 | Ga0207702_1000041442 | 318 |
| 81 | 3300031711 | Ga0265314_10001188 | Ga0265314_1000118813 | 318 |
| 82 | 3300031712 | Ga0265342_10055007 | Ga0265342_100550072 | 318 |
| 83 | iso_pu_bacteria | 2513237096 | 2513657108 | 318 |
| 84 | iso_pu_bacteria | 2513237137 | 2513856996 | 318 |
| 85 | iso_pu_bacteria | 2513237145 | 2513919116 | 318 |
| 86 | iso_pu_bacteria | 2517572143 | 2517891189 | 318 |
| 87 | iso_pu_bacteria | 2524023228 | 2524533624 | 318 |
| 88 | iso_pu_bacteria | 2667528175 | 2671123210 | 318 |
| 89 | iso_pu_bacteria | 2728368998 | 2728755556 | 318 |
| 90 | iso_pu_bacteria | 2885374607 | 2885376881 | 318 |
| 91 | iso_pu_bacteria | 2903748898 | 2903749690 | 318 |
| 92 | iso_pu_bacteria | 2904690495 | 2904698900 | 318 |
| 93 | iso_pu_bacteria | 2906610324 | 2906616368 | 318 |
| 94 | iso_pu_bacteria | 2906635258 | 2906638173 | 318 |
| 95 | iso_pu_bacteria | 2906660503 | 2906662848 | 318 |
| 96 | iso_pu_bacteria | 2908739725 | 2908741507 | 318 |
| 97 | iso_pu_bacteria | 2908756301 | 2908758696 | 318 |
| 98 | iso_pu_bacteria | 2922425934 | 2922431631 | 318 |
| 99 | iso_pu_bacteria | 2935630451 | 2935635815 | 318 |
| 100 | iso_pu_bacteria | 2941507105 | 2941512348 | 318 |
| 101 | iso_pu_bacteria | 2941515067 | 2941520147 | 318 |
| 102 | iso_pu_bacteria | 2941523033 | 2941528296 | 318 |
| 103 | iso_pu_bacteria | 3005718088 | 3005723314 | 318 |
| 104 | iso_pu_bacteria | 8006933436 | 8006939285 | 318 |
| 105 | iso_pu_bacteria | 8006973647 | 8006978943 | 318 |
| 106 | iso_pu_bacteria | 8019565922 | 8019575250 | 318 |
| 107 | iso_pu_bacteria | 8056689827 | 8056690644 | 318 |
| 108 | 3300006943 | Ga0099822_1005398 | Ga0099822_10053982 | 319 |
| 109 | 3300007788 | Ga0099795_10028287 | Ga0099795_100282872 | 319 |
| 110 | 3300009177 | Ga0105248_10089840 | Ga0105248_100898402 | 319 |
| 111 | 3300009545 | Ga0105237_10090926 | Ga0105237_100909264 | 319 |
| 112 | 3300013297 | Ga0157378_10079518 | Ga0157378_100795182 | 319 |
| 113 | 3300021441 | Ga0213871_10000172 | Ga0213871_100001724 | 319 |
| 114 | 3300025899 | Ga0207642_10130686 | Ga0207642_101306862 | 319 |
| 115 | 3300025941 | Ga0207711_10131333 | Ga0207711_101313332 | 319 |
| 116 | 3300026035 | Ga0207703_10340095 | Ga0207703_103400952 | 319 |
| 117 | 3300026121 | Ga0207683_10229243 | Ga0207683_102292431 | 319 |
| 118 | 3300027357 | Ga0209589_1000011 | Ga0209589_100001173 | 319 |
| 119 | 3300027361 | Ga0209489_100012 | Ga0209489_10001273 | 319 |
| 120 | 3300027363 | Ga0209700_100019 | Ga0209700_10001973 | 319 |
| 121 | 3300028786 | Ga0307517_10000386 | Ga0307517_1000038610 | 319 |
| 122 | 3300028794 | Ga0307515_10009804 | Ga0307515_100098046 | 319 |
| 123 | 3300031616 | Ga0307508_10115965 | Ga0307508_101159652 | 319 |
| 124 | 3300033180 | Ga0307510_10057657 | Ga0307510_100576573 | 319 |
| 125 | 3300033442 | Ga0315911_1000003 | Ga0315911_1000003477 | 319 |
| 126 | 3300035084 | Ga0373928_0027821 | Ga0373928_0027821_238_1215 | 319 |
| 127 | 3300035113 | Ga0373936_0009455 | Ga0373936_0009455_1176_2174 | 319 |
| 128 | 3300037068 | Ga0373925_0034946 | Ga0373925_0034946_621_1598 | 319 |
| 129 | 3300048904 | Ga0496101_0061143 | Ga0496101_0061143_743_1720 | 319 |
| 130 | 3300048906 | Ga0496103_0026161 | Ga0496103_0026161_1072_2049 | 319 |
| 131 | 3300048910 | Ga0496107_0002644 | Ga0496107_0002644_7603_8580 | 319 |
| 132 | 3300048911 | Ga0496108_0153982 | Ga0496108_0153982_20_997 | 319 |
| 133 | 3300048913 | Ga0496110_0020128 | Ga0496110_0020128_1387_2364 | 319 |
| 134 | 3300048914 | Ga0496111_0010633 | Ga0496111_0010633_86_1063 | 319 |
| 135 | iso_pu_bacteria | 2511231028 | 2511398135 | 319 |
| 136 | iso_pu_bacteria | 2513237101 | 2513693683 | 319 |
| 137 | iso_pu_bacteria | 2513237102 | 2513703426 | 319 |
| 138 | iso_pu_bacteria | 2513237104 | 2513720828 | 319 |
| 139 | iso_pu_bacteria | 2513237139 | 2513878306 | 319 |
| 140 | iso_pu_bacteria | 2528768022 | 2528855245 | 319 |
| 141 | iso_pu_bacteria | 2617270735 | 2617352767 | 319 |
| 142 | iso_pu_bacteria | 2617270741 | 2617372890 | 319 |
| 143 | iso_pu_bacteria | 2721755755 | 2723843544 | 319 |
| 144 | iso_pu_bacteria | 2791355196 | 2793061037 | 319 |
| 145 | iso_pu_bacteria | 2802429603 | 2805920529 | 319 |
| 146 | iso_pu_bacteria | 2824600985 | 2824602945 | 319 |
| 147 | iso_pu_bacteria | 2824609381 | 2824611832 | 319 |
| 148 | iso_pu_bacteria | 2824617872 | 2824621534 | 319 |
| 149 | iso_pu_bacteria | 2824626560 | 2824630646 | 319 |
| 150 | iso_pu_bacteria | 2824635225 | 2824638650 | 319 |
| 151 | iso_pu_bacteria | 2824644064 | 2824646574 | 319 |
| 152 | iso_pu_bacteria | 2824653114 | 2824655063 | 319 |
| 153 | iso_pu_bacteria | 2824661429 | 2824664447 | 319 |
| 154 | iso_pu_bacteria | 2824679649 | 2824682212 | 319 |
| 155 | iso_pu_bacteria | 2824696289 | 2824697686 | 319 |
| 156 | iso_pu_bacteria | 2824714736 | 2824717044 | 319 |
| 157 | iso_pu_bacteria | 2824723954 | 2824727188 | 319 |
| 158 | iso_pu_bacteria | 2824732956 | 2824733975 | 319 |
| 159 | iso_pu_bacteria | 2824746037 | 2824748407 | 319 |
| 160 | iso_pu_bacteria | 2824773399 | 2824776626 | 319 |
| 161 | iso_pu_bacteria | 2842038055 | 2842040803 | 319 |
| 162 | iso_pu_bacteria | 2842045827 | 2842046251 | 319 |
| 163 | iso_pu_bacteria | 2847930680 | 2847937485 | 319 |
| 164 | iso_pu_bacteria | 2847939898 | 2847947910 | 319 |
| 165 | iso_pu_bacteria | 2849076700 | 2849078243 | 319 |
| 166 | iso_pu_bacteria | 2857509624 | 2857511393 | 319 |
| 167 | iso_pu_bacteria | 2874604998 | 2874611547 | 319 |
| 168 | iso_pu_bacteria | 2874620515 | 2874628232 | 319 |
| 169 | iso_pu_bacteria | 2879083081 | 2879084898 | 319 |
| 170 | iso_pu_bacteria | 2879099564 | 2879107873 | 319 |
| 171 | iso_pu_bacteria | 2881364244 | 2881370063 | 319 |
| 172 | iso_pu_bacteria | 2885366525 | 2885370124 | 319 |
| 173 | iso_pu_bacteria | 2888388044 | 2888392629 | 319 |
| 174 | iso_pu_bacteria | 2888419890 | 2888425758 | 319 |
| 175 | iso_pu_bacteria | 2889033259 | 2889037849 | 319 |
| 176 | iso_pu_bacteria | 2904666416 | 2904674149 | 319 |
| 177 | iso_pu_bacteria | 2906643746 | 2906645559 | 319 |
| 178 | iso_pu_bacteria | 2908775508 | 2908781339 | 319 |
| 179 | iso_pu_bacteria | 2922361189 | 2922361798 | 319 |
| 180 | iso_pu_bacteria | 2922393267 | 2922396912 | 319 |
| 181 | iso_pu_bacteria | 2929615660 | 2929621199 | 319 |
| 182 | iso_pu_bacteria | 2929624759 | 2929625970 | 319 |
| 183 | iso_pu_bacteria | 2932784394 | 2932785145 | 319 |
| 184 | iso_pu_bacteria | 2932809354 | 2932810171 | 319 |
| 185 | iso_pu_bacteria | 2932818245 | 2932821745 | 319 |
| 186 | iso_pu_bacteria | 2933577622 | 2933582932 | 319 |
| 187 | iso_pu_bacteria | 2935616580 | 2935619599 | 319 |
| 188 | iso_pu_bacteria | 2935638405 | 2935638579 | 319 |
| 189 | iso_pu_bacteria | 2935665750 | 2935666569 | 319 |
| 190 | iso_pu_bacteria | 2935675223 | 2935676386 | 319 |
| 191 | iso_pu_bacteria | 2935684952 | 2935691097 | 319 |
| 192 | iso_pu_bacteria | 2935694250 | 2935694472 | 319 |
| 193 | iso_pu_bacteria | 2935703347 | 2935703585 | 319 |
| 194 | iso_pu_bacteria | 2935713505 | 2935718478 | 319 |
| 195 | iso_pu_bacteria | 2935722832 | 2935727542 | 319 |
| 196 | iso_pu_bacteria | 2935732158 | 2935736245 | 319 |
| 197 | iso_pu_bacteria | 2935741537 | 2935745625 | 319 |
| 198 | iso_pu_bacteria | 2935750917 | 2935756006 | 319 |
| 199 | iso_pu_bacteria | 2935760218 | 2935760732 | 319 |
| 200 | iso_pu_bacteria | 2935801545 | 2935801722 | 319 |
| 201 | iso_pu_bacteria | 2935810662 | 2935814862 | 319 |
| 202 | iso_pu_bacteria | 2935827899 | 2935828073 | 319 |
| 203 | iso_pu_bacteria | 2935837841 | 2935842279 | 319 |
| 204 | iso_pu_bacteria | 2935855204 | 2935858085 | 319 |
| 205 | iso_pu_bacteria | 2935864058 | 2935867990 | 319 |
| 206 | iso_pu_bacteria | 2935873716 | 2935873987 | 319 |
| 207 | iso_pu_bacteria | 2935992306 | 2935993089 | 319 |
| 208 | iso_pu_bacteria | 2936002035 | 2936003001 | 319 |
| 209 | iso_pu_bacteria | 2936037263 | 2936040495 | 319 |
| 210 | iso_pu_bacteria | 2940556831 | 2940562019 | 319 |
| 211 | iso_pu_bacteria | 2941531003 | 2941531353 | 319 |
| 212 | iso_pu_bacteria | 2941538514 | 2941542327 | 319 |
| 213 | iso_pu_bacteria | 3005483717 | 3005485557 | 319 |
| 214 | iso_pu_bacteria | 3005506211 | 3005508277 | 319 |
| 215 | iso_pu_bacteria | 3005587118 | 3005588220 | 319 |
| 216 | iso_pu_bacteria | 3005594810 | 3005600479 | 319 |
| 217 | iso_pu_bacteria | 8006926726 | 8006928589 | 319 |
| 218 | iso_pu_bacteria | 8006964411 | 8006966909 | 319 |
| 219 | iso_pu_bacteria | 8006984368 | 8006984587 | 319 |
| 220 | iso_pu_bacteria | 8006994254 | 8006994580 | 319 |
| 221 | iso_pu_bacteria | 8016511872 | 8016520479 | 319 |
| 222 | iso_pu_bacteria | 8017057580 | 8017065095 | 319 |
| 223 | iso_pu_bacteria | 8019576017 | 8019584481 | 319 |
| 224 | iso_pu_bacteria | 8019586578 | 8019592252 | 319 |
| 225 | iso_pu_bacteria | 8019597564 | 8019599033 | 319 |
| 226 | iso_pu_bacteria | 8019608314 | 8019609338 | 319 |
| 227 | iso_pu_bacteria | 8019648815 | 8019649538 | 319 |
| 228 | iso_pu_bacteria | 8055742211 | 8055744939 | 319 |
| 229 | iso_pu_bacteria | 8056673599 | 8056680953 | 319 |
| 230 | iso_pu_bacteria | 8056967851 | 8056974909 | 319 |
| 231 | 3300005937 | Ga0081455_10098396 | Ga0081455_100983962 | 320 |
| 232 | 3300010159 | Ga0099796_10017660 | Ga0099796_100176602 | 320 |
| 233 | iso_pu_bacteria | 2791355199 | 2793083927 | 320 |
| 234 | iso_pu_bacteria | 2922368715 | 2922375881 | 320 |
| 235 | 3300005327 | Ga0070658_10216746 | Ga0070658_102167461 | 321 |
| 236 | 3300005329 | Ga0070683_100036748 | Ga0070683_1000367482 | 321 |
| 237 | 3300005337 | Ga0070682_100131787 | Ga0070682_1001317871 | 321 |
| 238 | 3300005338 | Ga0068868_100078424 | Ga0068868_1000784242 | 321 |
| 239 | 3300005435 | Ga0070714_100042784 | Ga0070714_1000427843 | 321 |
| 240 | 3300005445 | Ga0070708_100297092 | Ga0070708_1002970922 | 321 |
| 241 | 3300005455 | Ga0070663_100065039 | Ga0070663_1000650392 | 321 |
| 242 | 3300005455 | Ga0070663_100143052 | Ga0070663_1001430521 | 321 |
| 243 | 3300005467 | Ga0070706_100186252 | Ga0070706_1001862522 | 321 |
| 244 | 3300005548 | Ga0070665_100012029 | Ga0070665_1000120298 | 321 |
| 245 | 3300005564 | Ga0070664_100063866 | Ga0070664_1000638662 | 321 |
| 246 | 3300005985 | Ga0081539_10020643 | Ga0081539_100206432 | 321 |
| 247 | 3300006038 | Ga0075365_10236499 | Ga0075365_102364992 | 321 |
| 248 | 3300006048 | Ga0075363_100008417 | Ga0075363_1000084173 | 321 |
| 249 | 3300006178 | Ga0075367_10001189 | Ga0075367_100011898 | 321 |
| 250 | 3300006178 | Ga0075367_10026850 | Ga0075367_100268503 | 321 |
| 251 | 3300006353 | Ga0075370_10064177 | Ga0075370_100641772 | 321 |
| 252 | 3300006358 | Ga0068871_100090784 | Ga0068871_1000907842 | 321 |
| 253 | 3300007265 | Ga0099794_10001856 | Ga0099794_100018562 | 321 |
| 254 | 3300007265 | Ga0099794_10024905 | Ga0099794_100249052 | 321 |
| 255 | 3300009551 | Ga0105238_10323288 | Ga0105238_103232881 | 321 |
| 256 | 3300014968 | Ga0157379_10330439 | Ga0157379_103304392 | 321 |
| 257 | 3300025315 | Ga0207697_10021166 | Ga0207697_100211664 | 321 |
| 258 | 3300025909 | Ga0207705_10251157 | Ga0207705_102511572 | 321 |
| 259 | 3300025920 | Ga0207649_10081414 | Ga0207649_100814142 | 321 |
| 260 | 3300025922 | Ga0207646_10053775 | Ga0207646_100537753 | 321 |
| 261 | 3300025926 | Ga0207659_10127452 | Ga0207659_101274522 | 321 |
| 262 | 3300025927 | Ga0207687_10051934 | Ga0207687_100519342 | 321 |
| 263 | 3300025945 | Ga0207679_10038891 | Ga0207679_100388912 | 321 |
| 264 | 3300026023 | Ga0207677_10065583 | Ga0207677_100655832 | 321 |
| 265 | 3300026035 | Ga0207703_10227101 | Ga0207703_102271012 | 321 |
| 266 | 3300026035 | Ga0207703_10320324 | Ga0207703_103203241 | 321 |
| 267 | 3300026067 | Ga0207678_10003691 | Ga0207678_1000369111 | 321 |
| 268 | 3300026067 | Ga0207678_10076471 | Ga0207678_100764712 | 321 |
| 269 | 3300028379 | Ga0268266_10002986 | Ga0268266_100029866 | 321 |
| 270 | 3300035086 | Ga0373934_0040949 | Ga0373934_0040949_842_1807 | 321 |
| 271 | 3300035113 | Ga0373936_0073580 | Ga0373936_0073580_225_1190 | 321 |
| 272 | 3300035116 | Ga0373945_0017533 | Ga0373945_0017533_577_1542 | 321 |
| 273 | 3300035118 | Ga0373954_0013045 | Ga0373954_0013045_1750_2715 | 321 |
| 274 | 3300035119 | Ga0373956_0020073 | Ga0373956_0020073_1569_2534 | 321 |
| 275 | 3300035170 | Ga0373943_0025476 | Ga0373943_0025476_603_1568 | 321 |
| 276 | 3300035724 | Ga0373933_0023750 | Ga0373933_0023750_123_1088 | 321 |
| 277 | 3300035725 | Ga0373947_0050361 | Ga0373947_0050361_1333_2298 | 321 |
| 278 | 3300036401 | Ga0373937_0027696 | Ga0373937_0027696_117_1082 | 321 |
| 279 | 3300037068 | Ga0373925_0012039 | Ga0373925_0012039_2851_3816 | 321 |
| 280 | 3300046459 | Ga0495629_0086032 | Ga0495629_0086032_665_1642 | 321 |
| 281 | 3300046462 | Ga0495651_0075007 | Ga0495651_0075007_1477_2454 | 321 |
| 282 | 3300046472 | Ga0495580_0011167 | Ga0495580_0011167_1137_2102 | 321 |
| 283 | 3300046477 | Ga0495664_0003066 | Ga0495664_0003066_1345_2310 | 321 |
| 284 | 3300046514 | Ga0495618_0048104 | Ga0495618_0048104_1713_2678 | 321 |
| 285 | 3300046543 | Ga0495645_0155296 | Ga0495645_0155296_601_1566 | 321 |
| 286 | 3300046681 | Ga0495647_0053037 | Ga0495647_0053037_165_1130 | 321 |
| 287 | 3300046694 | Ga0495649_0145846 | Ga0495649_0145846_28_1017 | 321 |
| 288 | 3300047319 | Ga0495674_0007246 | Ga0495674_0007246_1534_2499 | 321 |
| 289 | 3300047471 | Ga0495684_0002682 | Ga0495684_0002682_4128_5093 | 321 |
| 290 | 3300047673 | Ga0495593_0005968 | Ga0495593_0005968_4936_5901 | 321 |
| 291 | 3300048914 | Ga0496111_0177062 | Ga0496111_0177062_421_1407 | 321 |
| 292 | 3300048915 | Ga0496112_0425728 | Ga0496112_0425728_142_1119 | 321 |
| 293 | 3300048924 | Ga0496121_0038100 | Ga0496121_0038100_2763_3740 | 321 |
| 294 | 3300048929 | Ga0496126_0383247 | Ga0496126_0383247_75_1052 | 321 |
| 295 | 3300049585 | Ga0501069_0090306 | Ga0501069_0090306_216_1196 | 321 |
| 296 | 3300050490 | nmdc:mga03n38_20946_c1 | nmdc:mga03n38_20946_c1_1294_2271 | 321 |
| 297 | 3300050492 | nmdc:mga0yw44_81973_c1 | nmdc:mga0yw44_81973_c1_34_1011 | 321 |
| 298 | 3300050494 | nmdc:mga06z11_1257_c1 | nmdc:mga06z11_1257_c1_4448_5425 | 321 |
| 299 | 3300053077 | Ga0495601_0106355 | Ga0495601_0106355_559_1545 | 321 |
| 300 | 3300053096 | Ga0500641_0030039 | Ga0500641_0030039_142_1119 | 321 |
| 301 | 3300061719 | Ga0466962_0088834 | Ga0466962_0088834_330_1295 | 321 |
| 302 | 3300003215 | JGI25153J46596_10005917 | JGI25153J46596_100059176 | 322 |
| 303 | 3300005327 | Ga0070658_10062264 | Ga0070658_100622643 | 322 |
| 304 | 3300005327 | Ga0070658_10234674 | Ga0070658_102346742 | 322 |
| 305 | 3300005329 | Ga0070683_100120693 | Ga0070683_1001206932 | 322 |
| 306 | 3300005336 | Ga0070680_100014244 | Ga0070680_1000142445 | 322 |
| 307 | 3300005338 | Ga0068868_100134936 | Ga0068868_1001349362 | 322 |
| 308 | 3300005339 | Ga0070660_100066336 | Ga0070660_1000663362 | 322 |
| 309 | 3300005344 | Ga0070661_100300794 | Ga0070661_1003007941 | 322 |
| 310 | 3300005347 | Ga0070668_100018396 | Ga0070668_1000183962 | 322 |
| 311 | 3300005353 | Ga0070669_100114490 | Ga0070669_1001144902 | 322 |
| 312 | 3300005353 | Ga0070669_100152403 | Ga0070669_1001524032 | 322 |
| 313 | 3300005355 | Ga0070671_100436938 | Ga0070671_1004369381 | 322 |
| 314 | 3300005434 | Ga0070709_10000242 | Ga0070709_1000024222 | 322 |
| 315 | 3300005434 | Ga0070709_10006317 | Ga0070709_100063175 | 322 |
| 316 | 3300005435 | Ga0070714_100010247 | Ga0070714_1000102472 | 322 |
| 317 | 3300005436 | Ga0070713_100035256 | Ga0070713_1000352563 | 322 |
| 318 | 3300005439 | Ga0070711_100018414 | Ga0070711_1000184142 | 322 |
| 319 | 3300005458 | Ga0070681_10061957 | Ga0070681_100619572 | 322 |
| 320 | 3300005536 | Ga0070697_100031560 | Ga0070697_1000315602 | 322 |
| 321 | 3300005539 | Ga0068853_100172818 | Ga0068853_1001728182 | 322 |
| 322 | 3300005539 | Ga0068853_100196319 | Ga0068853_1001963192 | 322 |
| 323 | 3300005543 | Ga0070672_100181951 | Ga0070672_1001819512 | 322 |
| 324 | 3300005548 | Ga0070665_100095772 | Ga0070665_1000957723 | 322 |
| 325 | 3300005548 | Ga0070665_100158189 | Ga0070665_1001581892 | 322 |
| 326 | 3300005563 | Ga0068855_100074068 | Ga0068855_1000740682 | 322 |
| 327 | 3300005614 | Ga0068856_100172825 | Ga0068856_1001728252 | 322 |
| 328 | 3300005615 | Ga0070702_100186158 | Ga0070702_1001861581 | 322 |
| 329 | 3300005617 | Ga0068859_100138921 | Ga0068859_1001389212 | 322 |
| 330 | 3300005617 | Ga0068859_100320727 | Ga0068859_1003207272 | 322 |
| 331 | 3300005719 | Ga0068861_100162643 | Ga0068861_1001626432 | 322 |
| 332 | 3300005840 | Ga0068870_10059161 | Ga0068870_100591612 | 322 |
| 333 | 3300005843 | Ga0068860_100000360 | Ga0068860_1000003602 | 322 |
| 334 | 3300005844 | Ga0068862_100023046 | Ga0068862_1000230465 | 322 |
| 335 | 3300005937 | Ga0081455_10022037 | Ga0081455_100220372 | 322 |
| 336 | 3300005983 | Ga0081540_1000563 | Ga0081540_100056310 | 322 |
| 337 | 3300005983 | Ga0081540_1005358 | Ga0081540_10053582 | 322 |
| 338 | 3300005983 | Ga0081540_1017091 | Ga0081540_10170913 | 322 |
| 339 | 3300005985 | Ga0081539_10029092 | Ga0081539_100290921 | 322 |
| 340 | 3300006028 | Ga0070717_10201255 | Ga0070717_102012552 | 322 |
| 341 | 3300006173 | Ga0070716_100035770 | Ga0070716_1000357703 | 322 |
| 342 | 3300006844 | Ga0075428_100067667 | Ga0075428_1000676673 | 322 |
| 343 | 3300006931 | Ga0097620_100138923 | Ga0097620_1001389232 | 322 |
| 344 | 3300006931 | Ga0097620_100320698 | Ga0097620_1003206982 | 322 |
| 345 | 3300009093 | Ga0105240_10148446 | Ga0105240_101484462 | 322 |
| 346 | 3300009098 | Ga0105245_10075121 | Ga0105245_100751212 | 322 |
| 347 | 3300009098 | Ga0105245_10261193 | Ga0105245_102611932 | 322 |
| 348 | 3300009101 | Ga0105247_10074443 | Ga0105247_100744432 | 322 |
| 349 | 3300009101 | Ga0105247_10130806 | Ga0105247_101308062 | 322 |
| 350 | 3300009174 | Ga0105241_10248442 | Ga0105241_102484422 | 322 |
| 351 | 3300009545 | Ga0105237_10014093 | Ga0105237_100140935 | 322 |
| 352 | 3300009545 | Ga0105237_10067917 | Ga0105237_100679172 | 322 |
| 353 | 3300009551 | Ga0105238_10141570 | Ga0105238_101415702 | 322 |
| 354 | 3300010159 | Ga0099796_10018360 | Ga0099796_100183602 | 322 |
| 355 | 3300010375 | Ga0105239_10182513 | Ga0105239_101825132 | 322 |
| 356 | 3300010375 | Ga0105239_10293783 | Ga0105239_102937832 | 322 |
| 357 | 3300010375 | Ga0105239_10448061 | Ga0105239_104480612 | 322 |
| 358 | 3300013105 | Ga0157369_10016441 | Ga0157369_100164415 | 322 |
| 359 | 3300013296 | Ga0157374_10136923 | Ga0157374_101369232 | 322 |
| 360 | 3300013297 | Ga0157378_10220201 | Ga0157378_102202012 | 322 |
| 361 | 3300013306 | Ga0163162_10049675 | Ga0163162_100496752 | 322 |
| 362 | 3300013308 | Ga0157375_10567184 | Ga0157375_105671842 | 322 |
| 363 | 3300014325 | Ga0163163_10034163 | Ga0163163_100341634 | 322 |
| 364 | 3300014745 | Ga0157377_10243697 | Ga0157377_102436972 | 322 |
| 365 | 3300025297 | Ga0209758_1009643 | Ga0209758_10096435 | 322 |
| 366 | 3300025297 | Ga0209758_1010946 | Ga0209758_10109465 | 322 |
| 367 | 3300025898 | Ga0207692_10029455 | Ga0207692_100294552 | 322 |
| 368 | 3300025899 | Ga0207642_10034421 | Ga0207642_100344212 | 322 |
| 369 | 3300025900 | Ga0207710_10021188 | Ga0207710_100211882 | 322 |
| 370 | 3300025901 | Ga0207688_10197565 | Ga0207688_101975651 | 322 |
| 371 | 3300025906 | Ga0207699_10001448 | Ga0207699_1000144812 | 322 |
| 372 | 3300025906 | Ga0207699_10020904 | Ga0207699_100209042 | 322 |
| 373 | 3300025906 | Ga0207699_10116871 | Ga0207699_101168712 | 322 |
| 374 | 3300025908 | Ga0207643_10036462 | Ga0207643_100364622 | 322 |
| 375 | 3300025909 | Ga0207705_10216530 | Ga0207705_102165302 | 322 |
| 376 | 3300025911 | Ga0207654_10068361 | Ga0207654_100683612 | 322 |
| 377 | 3300025912 | Ga0207707_10015539 | Ga0207707_100155397 | 322 |
| 378 | 3300025912 | Ga0207707_10059169 | Ga0207707_100591692 | 322 |
| 379 | 3300025914 | Ga0207671_10110598 | Ga0207671_101105982 | 322 |
| 380 | 3300025915 | Ga0207693_10003822 | Ga0207693_1000382211 | 322 |
| 381 | 3300025916 | Ga0207663_10039730 | Ga0207663_100397302 | 322 |
| 382 | 3300025919 | Ga0207657_10016104 | Ga0207657_100161046 | 322 |
| 383 | 3300025920 | Ga0207649_10117731 | Ga0207649_101177312 | 322 |
| 384 | 3300025921 | Ga0207652_10017291 | Ga0207652_100172912 | 322 |
| 385 | 3300025923 | Ga0207681_10063046 | Ga0207681_100630462 | 322 |
| 386 | 3300025925 | Ga0207650_10316839 | Ga0207650_103168392 | 322 |
| 387 | 3300025926 | Ga0207659_10083431 | Ga0207659_100834312 | 322 |
| 388 | 3300025927 | Ga0207687_10240179 | Ga0207687_102401792 | 322 |
| 389 | 3300025928 | Ga0207700_10047207 | Ga0207700_100472074 | 322 |
| 390 | 3300025929 | Ga0207664_10062284 | Ga0207664_100622843 | 322 |
| 391 | 3300025933 | Ga0207706_10107502 | Ga0207706_101075022 | 322 |
| 392 | 3300025933 | Ga0207706_10282412 | Ga0207706_102824122 | 322 |
| 393 | 3300025937 | Ga0207669_10052028 | Ga0207669_100520282 | 322 |
| 394 | 3300025937 | Ga0207669_10205669 | Ga0207669_102056692 | 322 |
| 395 | 3300025939 | Ga0207665_10003894 | Ga0207665_100038942 | 322 |
| 396 | 3300025940 | Ga0207691_10239251 | Ga0207691_102392511 | 322 |
| 397 | 3300025941 | Ga0207711_10082201 | Ga0207711_100822012 | 322 |
| 398 | 3300025942 | Ga0207689_10181564 | Ga0207689_101815642 | 322 |
| 399 | 3300025944 | Ga0207661_10000879 | Ga0207661_100008799 | 322 |
| 400 | 3300025949 | Ga0207667_10058484 | Ga0207667_100584842 | 322 |
| 401 | 3300025972 | Ga0207668_10072624 | Ga0207668_100726242 | 322 |
| 402 | 3300026023 | Ga0207677_10126182 | Ga0207677_101261822 | 322 |
| 403 | 3300026035 | Ga0207703_10083088 | Ga0207703_100830881 | 322 |
| 404 | 3300026041 | Ga0207639_10085591 | Ga0207639_100855912 | 322 |
| 405 | 3300026067 | Ga0207678_10206056 | Ga0207678_102060562 | 322 |
| 406 | 3300026075 | Ga0207708_10157527 | Ga0207708_101575272 | 322 |
| 407 | 3300026078 | Ga0207702_10191797 | Ga0207702_101917972 | 322 |
| 408 | 3300026088 | Ga0207641_10124501 | Ga0207641_101245012 | 322 |
| 409 | 3300026116 | Ga0207674_10023338 | Ga0207674_100233385 | 322 |
| 410 | 3300026118 | Ga0207675_100171903 | Ga0207675_1001719032 | 322 |
| 411 | 3300026142 | Ga0207698_10306484 | Ga0207698_103064842 | 322 |
| 412 | 3300027907 | Ga0207428_10224954 | Ga0207428_102249541 | 322 |
| 413 | 3300028380 | Ga0268265_10013205 | Ga0268265_100132052 | 322 |
| 414 | 3300028380 | Ga0268265_10044450 | Ga0268265_100444502 | 322 |
| 415 | 3300028381 | Ga0268264_10000030 | Ga0268264_10000030281 | 322 |
| 416 | 3300030522 | Ga0307512_10144844 | Ga0307512_101448441 | 322 |
| 417 | 3300031238 | Ga0265332_10046928 | Ga0265332_100469281 | 322 |
| 418 | 3300031456 | Ga0307513_10196993 | Ga0307513_101969932 | 322 |
| 419 | 3300031507 | Ga0307509_10075783 | Ga0307509_100757832 | 322 |
| 420 | 3300031507 | Ga0307509_10269423 | Ga0307509_102694232 | 322 |
| 421 | 3300031616 | Ga0307508_10157547 | Ga0307508_101575472 | 322 |
| 422 | 3300031730 | Ga0307516_10000939 | Ga0307516_1000093921 | 322 |
| 423 | 3300031730 | Ga0307516_10076248 | Ga0307516_100762483 | 322 |
| 424 | 3300031730 | Ga0307516_10206235 | Ga0307516_102062351 | 322 |
| 425 | 3300031901 | Ga0307406_10113799 | Ga0307406_101137992 | 322 |
| 426 | 3300032005 | Ga0307411_10025196 | Ga0307411_100251962 | 322 |
| 427 | 3300033179 | Ga0307507_10085869 | Ga0307507_100858692 | 322 |
| 428 | 3300033180 | Ga0307510_10030787 | Ga0307510_100307872 | 322 |
| 429 | 3300033180 | Ga0307510_10138063 | Ga0307510_101380632 | 322 |
| 430 | 3300033544 | Ga0316215_1003530 | Ga0316215_10035302 | 322 |
| 431 | 3300035085 | Ga0373929_0016007 | Ga0373929_0016007_394_1374 | 322 |
| 432 | 3300035089 | Ga0373944_0008813 | Ga0373944_0008813_1161_2129 | 322 |
| 433 | 3300035089 | Ga0373944_0026305 | Ga0373944_0026305_142_1131 | 322 |
| 434 | 3300035089 | Ga0373944_0029826 | Ga0373944_0029826_228_1208 | 322 |
| 435 | 3300035111 | Ga0373923_0001708 | Ga0373923_0001708_892_1860 | 322 |
| 436 | 3300035113 | Ga0373936_0053600 | Ga0373936_0053600_101_1090 | 322 |
| 437 | 3300035116 | Ga0373945_0031429 | Ga0373945_0031429_714_1694 | 322 |
| 438 | 3300035119 | Ga0373956_0014989 | Ga0373956_0014989_1031_2020 | 322 |
| 439 | 3300035120 | Ga0373957_0001196 | Ga0373957_0001196_84_1073 | 322 |
| 440 | 3300035170 | Ga0373943_0069693 | Ga0373943_0069693_188_1168 | 322 |
| 441 | 3300035170 | Ga0373943_0092370 | Ga0373943_0092370_263_1252 | 322 |
| 442 | 3300035171 | Ga0373946_0002425 | Ga0373946_0002425_2768_3757 | 322 |
| 443 | 3300035172 | Ga0373955_0000956 | Ga0373955_0000956_547_1536 | 322 |
| 444 | 3300035172 | Ga0373955_0007308 | Ga0373955_0007308_192_1160 | 322 |
| 445 | 3300035692 | Ga0373935_0000424 | Ga0373935_0000424_4860_5849 | 322 |
| 446 | 3300035692 | Ga0373935_0284643 | Ga0373935_0284643_120_1088 | 322 |
| 447 | 3300035695 | Ga0373927_0010213 | Ga0373927_0010213_1188_2177 | 322 |
| 448 | 3300035695 | Ga0373927_0017385 | Ga0373927_0017385_1511_2491 | 322 |
| 449 | 3300035695 | Ga0373927_0019865 | Ga0373927_0019865_2993_3973 | 322 |
| 450 | 3300035695 | Ga0373927_0021331 | Ga0373927_0021331_1357_2346 | 322 |
| 451 | 3300035724 | Ga0373933_0003417 | Ga0373933_0003417_6713_7702 | 322 |
| 452 | 3300035725 | Ga0373947_0001385 | Ga0373947_0001385_2060_3049 | 322 |
| 453 | 3300035725 | Ga0373947_0063618 | Ga0373947_0063618_702_1691 | 322 |
| 454 | 3300036401 | Ga0373937_0034455 | Ga0373937_0034455_1597_2586 | 322 |
| 455 | 3300037068 | Ga0373925_0029824 | Ga0373925_0029824_2300_3289 | 322 |
| 456 | 3300037068 | Ga0373925_0032464 | Ga0373925_0032464_2205_3185 | 322 |
| 457 | 3300037068 | Ga0373925_0056395 | Ga0373925_0056395_320_1300 | 322 |
| 458 | 3300037466 | Ga0395898_0104054 | Ga0395898_0104054_725_1705 | 322 |
| 459 | 3300044658 | Ga0466972_0000113 | Ga0466972_0000113_61155_62123 | 322 |
| 460 | 3300045976 | Ga0466967_0058132 | Ga0466967_0058132_2119_3087 | 322 |
| 461 | 3300046454 | Ga0495592_0010638 | Ga0495592_0010638_3785_4774 | 322 |
| 462 | 3300046454 | Ga0495592_0018813 | Ga0495592_0018813_3203_4192 | 322 |
| 463 | 3300046454 | Ga0495592_0058300 | Ga0495592_0058300_1340_2308 | 322 |
| 464 | 3300046455 | Ga0495603_0000003 | Ga0495603_0000003_15367_16356 | 322 |
| 465 | 3300046459 | Ga0495629_0002388 | Ga0495629_0002388_12260_13249 | 322 |
| 466 | 3300046461 | Ga0495641_0009506 | Ga0495641_0009506_3013_4002 | 322 |
| 467 | 3300046463 | Ga0495653_0095296 | Ga0495653_0095296_92_1081 | 322 |
| 468 | 3300046472 | Ga0495580_0001857 | Ga0495580_0001857_8367_9356 | 322 |
| 469 | 3300046473 | Ga0495582_0000016 | Ga0495582_0000016_14186_15175 | 322 |
| 470 | 3300046473 | Ga0495582_0044998 | Ga0495582_0044998_1448_2416 | 322 |
| 471 | 3300046474 | Ga0495605_0062889 | Ga0495605_0062889_488_1468 | 322 |
| 472 | 3300046475 | Ga0495639_0000075 | Ga0495639_0000075_10153_11142 | 322 |
| 473 | 3300046476 | Ga0495662_0011526 | Ga0495662_0011526_588_1556 | 322 |
| 474 | 3300046476 | Ga0495662_0033000 | Ga0495662_0033000_311_1300 | 322 |
| 475 | 3300046477 | Ga0495664_0008072 | Ga0495664_0008072_3655_4623 | 322 |
| 476 | 3300046477 | Ga0495664_0011974 | Ga0495664_0011974_2765_3754 | 322 |
| 477 | 3300046477 | Ga0495664_0075124 | Ga0495664_0075124_1041_2009 | 322 |
| 478 | 3300046491 | Ga0495584_0049936 | Ga0495584_0049936_470_1450 | 322 |
| 479 | 3300046499 | Ga0495594_0000120 | Ga0495594_0000120_3046_4035 | 322 |
| 480 | 3300046500 | Ga0495596_0036158 | Ga0495596_0036158_780_1760 | 322 |
| 481 | 3300046507 | Ga0495606_0001387 | Ga0495606_0001387_25883_26866 | 322 |
| 482 | 3300046514 | Ga0495618_0062734 | Ga0495618_0062734_1113_2102 | 322 |
| 483 | 3300046517 | Ga0495630_0321750 | Ga0495630_0321750_121_1089 | 322 |
| 484 | 3300046526 | Ga0495666_0127627 | Ga0495666_0127627_57_1046 | 322 |
| 485 | 3300046529 | Ga0495652_0060328 | Ga0495652_0060328_1542_2531 | 322 |
| 486 | 3300046530 | Ga0495654_0087994 | Ga0495654_0087994_375_1355 | 322 |
| 487 | 3300046531 | Ga0495665_0000270 | Ga0495665_0000270_196_1185 | 322 |
| 488 | 3300046533 | Ga0495640_0000210 | Ga0495640_0000210_37253_38242 | 322 |
| 489 | 3300046533 | Ga0495640_0020628 | Ga0495640_0020628_2093_3082 | 322 |
| 490 | 3300046533 | Ga0495640_0038421 | Ga0495640_0038421_1177_2145 | 322 |
| 491 | 3300046536 | Ga0495587_0043439 | Ga0495587_0043439_1187_2176 | 322 |
| 492 | 3300046543 | Ga0495645_0020206 | Ga0495645_0020206_1126_2094 | 322 |
| 493 | 3300046557 | Ga0495622_0062233 | Ga0495622_0062233_375_1343 | 322 |
| 494 | 3300046559 | Ga0495667_0054939 | Ga0495667_0054939_99_1088 | 322 |
| 495 | 3300046642 | Ga0495634_0000064 | Ga0495634_0000064_61994_62983 | 322 |
| 496 | 3300046642 | Ga0495634_0008410 | Ga0495634_0008410_2682_3671 | 322 |
| 497 | 3300046642 | Ga0495634_0023703 | Ga0495634_0023703_3282_4250 | 322 |
| 498 | 3300046660 | Ga0495625_0140979 | Ga0495625_0140979_144_1124 | 322 |
| 499 | 3300046663 | Ga0495635_0000316 | Ga0495635_0000316_11367_12356 | 322 |
| 500 | 3300046663 | Ga0495635_0104993 | Ga0495635_0104993_151_1140 | 322 |
| 501 | 3300046674 | Ga0495588_0004843 | Ga0495588_0004843_182_1162 | 322 |
| 502 | 3300046674 | Ga0495588_0014430 | Ga0495588_0014430_2641_3630 | 322 |
| 503 | 3300046674 | Ga0495588_0048145 | Ga0495588_0048145_804_1784 | 322 |
| 504 | 3300046675 | Ga0495657_0103560 | Ga0495657_0103560_321_1310 | 322 |
| 505 | 3300046679 | Ga0495623_0071074 | Ga0495623_0071074_1027_2016 | 322 |
| 506 | 3300046680 | Ga0495646_0057415 | Ga0495646_0057415_969_1958 | 322 |
| 507 | 3300046681 | Ga0495647_0023006 | Ga0495647_0023006_505_1494 | 322 |
| 508 | 3300046683 | Ga0495658_0002630 | Ga0495658_0002630_3989_4978 | 322 |
| 509 | 3300046689 | Ga0495613_0004076 | Ga0495613_0004076_6424_7413 | 322 |
| 510 | 3300046689 | Ga0495613_0084854 | Ga0495613_0084854_975_1964 | 322 |
| 511 | 3300046690 | Ga0495624_0010653 | Ga0495624_0010653_2579_3568 | 322 |
| 512 | 3300046809 | Ga0495600_0086233 | Ga0495600_0086233_54_1043 | 322 |
| 513 | 3300047315 | Ga0495581_0000014 | Ga0495581_0000014_22659_23648 | 322 |
| 514 | 3300047317 | Ga0495604_0220204 | Ga0495604_0220204_241_1209 | 322 |
| 515 | 3300047319 | Ga0495674_0001069 | Ga0495674_0001069_12148_13137 | 322 |
| 516 | 3300047321 | Ga0495676_0059798 | Ga0495676_0059798_839_1828 | 322 |
| 517 | 3300047321 | Ga0495676_0211683 | Ga0495676_0211683_162_1142 | 322 |
| 518 | 3300047322 | Ga0495680_0011794 | Ga0495680_0011794_5963_6952 | 322 |
| 519 | 3300047471 | Ga0495684_0007582 | Ga0495684_0007582_2507_3496 | 322 |
| 520 | 3300047471 | Ga0495684_0026033 | Ga0495684_0026033_3011_4000 | 322 |
| 521 | 3300047673 | Ga0495593_0000003 | Ga0495593_0000003_51441_52430 | 322 |
| 522 | 3300048089 | Ga0495614_0013203 | Ga0495614_0013203_949_1938 | 322 |
| 523 | 3300048905 | Ga0496102_0066002 | Ga0496102_0066002_885_1871 | 322 |
| 524 | 3300048905 | Ga0496102_0200361 | Ga0496102_0200361_599_1579 | 322 |
| 525 | 3300048906 | Ga0496103_0024383 | Ga0496103_0024383_2067_3053 | 322 |
| 526 | 3300048906 | Ga0496103_0137332 | Ga0496103_0137332_564_1544 | 322 |
| 527 | 3300048907 | Ga0496104_0039268 | Ga0496104_0039268_1011_1997 | 322 |
| 528 | 3300048908 | Ga0496105_0139800 | Ga0496105_0139800_79_1065 | 322 |
| 529 | 3300048909 | Ga0496106_0019837 | Ga0496106_0019837_3026_4012 | 322 |
| 530 | 3300048912 | Ga0496109_0030452 | Ga0496109_0030452_2630_3616 | 322 |
| 531 | 3300048912 | Ga0496109_0294941 | Ga0496109_0294941_465_1445 | 322 |
| 532 | 3300048913 | Ga0496110_0026150 | Ga0496110_0026150_3606_4592 | 322 |
| 533 | 3300048915 | Ga0496112_0027239 | Ga0496112_0027239_3925_4911 | 322 |
| 534 | 3300048915 | Ga0496112_0124684 | Ga0496112_0124684_824_1813 | 322 |
| 535 | 3300048915 | Ga0496112_0242010 | Ga0496112_0242010_731_1711 | 322 |
| 536 | 3300048917 | Ga0496114_0127978 | Ga0496114_0127978_388_1374 | 322 |
| 537 | 3300048918 | Ga0496115_0003047 | Ga0496115_0003047_3004_3990 | 322 |
| 538 | 3300048924 | Ga0496121_0034261 | Ga0496121_0034261_2454_3434 | 322 |
| 539 | 3300048924 | Ga0496121_0144458 | Ga0496121_0144458_507_1487 | 322 |
| 540 | 3300048924 | Ga0496121_0155084 | Ga0496121_0155084_679_1647 | 322 |
| 541 | 3300048929 | Ga0496126_0007029 | Ga0496126_0007029_11406_12386 | 322 |
| 542 | 3300048929 | Ga0496126_0129432 | Ga0496126_0129432_52_1032 | 322 |
| 543 | 3300049581 | Ga0501047_0006540 | Ga0501047_0006540_2458_3426 | 322 |
| 544 | 3300049586 | Ga0501070_0004771 | Ga0501070_0004771_1389_2357 | 322 |
| 545 | 3300049742 | Ga0501080_0058215 | Ga0501080_0058215_1999_2967 | 322 |
| 546 | 3300049822 | Ga0501035_0120970 | Ga0501035_0120970_85_1053 | 322 |
| 547 | 3300050494 | nmdc:mga06z11_56355_c1 | nmdc:mga06z11_56355_c1_244_1224 | 322 |
| 548 | 3300050507 | nmdc:mga05p37_283809_c1 | nmdc:mga05p37_283809_c1_592_1572 | 322 |
| 549 | 3300050512 | nmdc:mga0n895_242940_c1 | nmdc:mga0n895_242940_c1_236_1216 | 322 |
| 550 | 3300050513 | nmdc:mga0rr50_61425_c1 | nmdc:mga0rr50_61425_c1_274_1254 | 322 |
| 551 | 3300053077 | Ga0495601_0032907 | Ga0495601_0032907_110_1078 | 322 |
| 552 | 3300053077 | Ga0495601_0080098 | Ga0495601_0080098_1104_2072 | 322 |
| 553 | 3300053080 | Ga0500635_0030075 | Ga0500635_0030075_62_1042 | 322 |
| 554 | 3300053094 | Ga0500566_0007050 | Ga0500566_0007050_3531_4511 | 322 |
| 555 | 3300053094 | Ga0500566_0052932 | Ga0500566_0052932_356_1336 | 322 |
| 556 | 3300053119 | Ga0500595_000898 | Ga0500595_000898_586_1566 | 322 |
| 557 | 3300053119 | Ga0500595_010401 | Ga0500595_010401_1351_2331 | 322 |
| 558 | 3300053150 | Ga0500603_014567 | Ga0500603_014567_598_1587 | 322 |
| 559 | 3300053178 | Ga0500637_0000103 | Ga0500637_0000103_12665_13645 | 322 |
| 560 | 3300053178 | Ga0500637_0126908 | Ga0500637_0126908_359_1348 | 322 |
| 561 | 3300055283 | Ga0500661_001897 | Ga0500661_001897_2222_3202 | 322 |
| 562 | 3300003215 | JGI25153J46596_10001542 | JGI25153J46596_1000154212 | 323 |
| 563 | 3300003215 | JGI25153J46596_10001551 | JGI25153J46596_1000155112 | 323 |
| 564 | 3300003215 | JGI25153J46596_10003383 | JGI25153J46596_100033837 | 323 |
| 565 | 3300003215 | JGI25153J46596_10036462 | JGI25153J46596_100364621 | 323 |
| 566 | 3300003354 | JGI25160J50197_1005959 | JGI25160J50197_10059592 | 323 |
| 567 | 3300003354 | JGI25160J50197_1013050 | JGI25160J50197_10130502 | 323 |
| 568 | 3300003752 | Ga0055539_1008103 | Ga0055539_10081031 | 323 |
| 569 | 3300003794 | Ga0055531_10021688 | Ga0055531_100216882 | 323 |
| 570 | 3300005262 | Ga0065165_1000890 | Ga0065165_100089016 | 323 |
| 571 | 3300005262 | Ga0065165_1002830 | Ga0065165_100283010 | 323 |
| 572 | 3300005366 | Ga0070659_100137588 | Ga0070659_1001375882 | 323 |
| 573 | 3300005445 | Ga0070708_100572818 | Ga0070708_1005728181 | 323 |
| 574 | 3300005455 | Ga0070663_100203633 | Ga0070663_1002036332 | 323 |
| 575 | 3300005456 | Ga0070678_100268545 | Ga0070678_1002685451 | 323 |
| 576 | 3300005459 | Ga0068867_100153822 | Ga0068867_1001538222 | 323 |
| 577 | 3300005459 | Ga0068867_100182203 | Ga0068867_1001822032 | 323 |
| 578 | 3300005548 | Ga0070665_100316578 | Ga0070665_1003165782 | 323 |
| 579 | 3300005564 | Ga0070664_100090212 | Ga0070664_1000902122 | 323 |
| 580 | 3300005618 | Ga0068864_100201235 | Ga0068864_1002012352 | 323 |
| 581 | 3300005718 | Ga0068866_10039415 | Ga0068866_100394152 | 323 |
| 582 | 3300006051 | Ga0075364_10136761 | Ga0075364_101367612 | 323 |
| 583 | 3300006186 | Ga0075369_10089729 | Ga0075369_100897292 | 323 |
| 584 | 3300006353 | Ga0075370_10251005 | Ga0075370_102510051 | 323 |
| 585 | 3300006881 | Ga0068865_100010846 | Ga0068865_1000108464 | 323 |
| 586 | 3300006941 | Ga0099825_1023845 | Ga0099825_10238453 | 323 |
| 587 | 3300006944 | Ga0099823_1016101 | Ga0099823_10161016 | 323 |
| 588 | 3300009094 | Ga0111539_10045303 | Ga0111539_100453032 | 323 |
| 589 | 3300009101 | Ga0105247_10077345 | Ga0105247_100773452 | 323 |
| 590 | 3300009148 | Ga0105243_10327388 | Ga0105243_103273882 | 323 |
| 591 | 3300009176 | Ga0105242_10384643 | Ga0105242_103846432 | 323 |
| 592 | 3300010375 | Ga0105239_10231702 | Ga0105239_102317022 | 323 |
| 593 | 3300013306 | Ga0163162_10106859 | Ga0163162_101068593 | 323 |
| 594 | 3300014325 | Ga0163163_10130093 | Ga0163163_101300933 | 323 |
| 595 | 3300014326 | Ga0157380_10266966 | Ga0157380_102669662 | 323 |
| 596 | 3300014969 | Ga0157376_10309365 | Ga0157376_103093651 | 323 |
| 597 | 3300017792 | Ga0163161_10086174 | Ga0163161_100861742 | 323 |
| 598 | 3300021321 | Ga0214542_1000606 | Ga0214542_100060646 | 323 |
| 599 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003163 | 323 |
| 600 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002602 | 323 |
| 601 | 3300025253 | Ga0209677_109175 | Ga0209677_1091751 | 323 |
| 602 | 3300025273 | Ga0209673_1031986 | Ga0209673_10319862 | 323 |
| 603 | 3300025295 | Ga0209564_1006619 | Ga0209564_10066194 | 323 |
| 604 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011478 | 323 |
| 605 | 3300025297 | Ga0209758_1000477 | Ga0209758_100047723 | 323 |
| 606 | 3300025297 | Ga0209758_1001198 | Ga0209758_10011982 | 323 |
| 607 | 3300025297 | Ga0209758_1040941 | Ga0209758_10409412 | 323 |
| 608 | 3300025299 | Ga0209256_1001993 | Ga0209256_10019937 | 323 |
| 609 | 3300025302 | Ga0207426_1000519 | Ga0207426_100051936 | 323 |
| 610 | 3300025302 | Ga0207426_1005792 | Ga0207426_10057922 | 323 |
| 611 | 3300025302 | Ga0207426_1014062 | Ga0207426_10140623 | 323 |
| 612 | 3300025304 | Ga0209257_1000654 | Ga0209257_10006547 | 323 |
| 613 | 3300025901 | Ga0207688_10034750 | Ga0207688_100347503 | 323 |
| 614 | 3300025911 | Ga0207654_10003430 | Ga0207654_100034307 | 323 |
| 615 | 3300025918 | Ga0207662_10040704 | Ga0207662_100407042 | 323 |
| 616 | 3300025923 | Ga0207681_10089076 | Ga0207681_100890762 | 323 |
| 617 | 3300025932 | Ga0207690_10115138 | Ga0207690_101151382 | 323 |
| 618 | 3300025933 | Ga0207706_10028322 | Ga0207706_100283225 | 323 |
| 619 | 3300025934 | Ga0207686_10068859 | Ga0207686_100688592 | 323 |
| 620 | 3300025935 | Ga0207709_10027813 | Ga0207709_100278132 | 323 |
| 621 | 3300025937 | Ga0207669_10004960 | Ga0207669_100049605 | 323 |
| 622 | 3300025940 | Ga0207691_10016444 | Ga0207691_100164445 | 323 |
| 623 | 3300025986 | Ga0207658_10025279 | Ga0207658_100252794 | 323 |
| 624 | 3300026035 | Ga0207703_10116891 | Ga0207703_101168912 | 323 |
| 625 | 3300026067 | Ga0207678_10261938 | Ga0207678_102619381 | 323 |
| 626 | 3300026089 | Ga0207648_10111412 | Ga0207648_101114122 | 323 |
| 627 | 3300026089 | Ga0207648_10237852 | Ga0207648_102378522 | 323 |
| 628 | 3300026121 | Ga0207683_10366148 | Ga0207683_103661481 | 323 |
| 629 | 3300027296 | Ga0209389_1000077 | Ga0209389_100007733 | 323 |
| 630 | 3300027361 | Ga0209489_100251 | Ga0209489_10025133 | 323 |
| 631 | 3300027363 | Ga0209700_100271 | Ga0209700_10027132 | 323 |
| 632 | 3300028379 | Ga0268266_10232329 | Ga0268266_102323292 | 323 |
| 633 | 3300037418 | Ga0395900_0006232 | Ga0395900_0006232_9829_10809 | 323 |
| 634 | 3300037466 | Ga0395898_0032295 | Ga0395898_0032295_2346_3326 | 323 |
| 635 | 3300037471 | Ga0395905_0003367 | Ga0395905_0003367_4006_4977 | 323 |
| 636 | 3300038443 | Ga0395901_0100559 | Ga0395901_0100559_1010_1990 | 323 |
| 637 | 3300038443 | Ga0395901_0188212 | Ga0395901_0188212_1003_1974 | 323 |
| 638 | 3300044683 | Ga0466965_0008177 | Ga0466965_0008177_2358_3329 | 323 |
| 639 | 3300044684 | Ga0466966_0000398 | Ga0466966_0000398_22949_23920 | 323 |
| 640 | 3300044693 | Ga0466961_0000005 | Ga0466961_0000005_13887_14858 | 323 |
| 641 | 3300044901 | Ga0466960_0022833 | Ga0466960_0022833_1299_2270 | 323 |
| 642 | 3300045049 | Ga0466959_0000670 | Ga0466959_0000670_4125_5096 | 323 |
| 643 | 3300045976 | Ga0466967_0280833 | Ga0466967_0280833_194_1165 | 323 |
| 644 | 3300046454 | Ga0495592_0238170 | Ga0495592_0238170_221_1192 | 323 |
| 645 | 3300046459 | Ga0495629_0009839 | Ga0495629_0009839_4817_5788 | 323 |
| 646 | 3300046462 | Ga0495651_0002716 | Ga0495651_0002716_12032_13012 | 323 |
| 647 | 3300046477 | Ga0495664_0019306 | Ga0495664_0019306_2676_3656 | 323 |
| 648 | 3300046516 | Ga0495628_0051250 | Ga0495628_0051250_1611_2591 | 323 |
| 649 | 3300046517 | Ga0495630_0037982 | Ga0495630_0037982_544_1524 | 323 |
| 650 | 3300046529 | Ga0495652_0011876 | Ga0495652_0011876_10_981 | 323 |
| 651 | 3300046529 | Ga0495652_0014719 | Ga0495652_0014719_2912_3892 | 323 |
| 652 | 3300046533 | Ga0495640_0034237 | Ga0495640_0034237_1772_2752 | 323 |
| 653 | 3300046536 | Ga0495587_0039151 | Ga0495587_0039151_812_1792 | 323 |
| 654 | 3300046543 | Ga0495645_0012046 | Ga0495645_0012046_2886_3866 | 323 |
| 655 | 3300046557 | Ga0495622_0003400 | Ga0495622_0003400_1575_2546 | 323 |
| 656 | 3300046559 | Ga0495667_0024058 | Ga0495667_0024058_166_1146 | 323 |
| 657 | 3300046663 | Ga0495635_0031259 | Ga0495635_0031259_2231_3211 | 323 |
| 658 | 3300046675 | Ga0495657_0010591 | Ga0495657_0010591_4246_5226 | 323 |
| 659 | 3300046678 | Ga0495599_0065618 | Ga0495599_0065618_83_1063 | 323 |
| 660 | 3300046679 | Ga0495623_0020849 | Ga0495623_0020849_970_1950 | 323 |
| 661 | 3300046680 | Ga0495646_0055284 | Ga0495646_0055284_1020_2000 | 323 |
| 662 | 3300046684 | Ga0495669_0037455 | Ga0495669_0037455_478_1470 | 323 |
| 663 | 3300046689 | Ga0495613_0072130 | Ga0495613_0072130_1193_2173 | 323 |
| 664 | 3300046690 | Ga0495624_0024452 | Ga0495624_0024452_963_1934 | 323 |
| 665 | 3300046809 | Ga0495600_0117870 | Ga0495600_0117870_54_1025 | 323 |
| 666 | 3300047317 | Ga0495604_0019282 | Ga0495604_0019282_1704_2684 | 323 |
| 667 | 3300047317 | Ga0495604_0045443 | Ga0495604_0045443_1426_2397 | 323 |
| 668 | 3300047319 | Ga0495674_0002679 | Ga0495674_0002679_14038_15018 | 323 |
| 669 | 3300047322 | Ga0495680_0002674 | Ga0495680_0002674_3984_4964 | 323 |
| 670 | 3300047323 | Ga0495683_0124322 | Ga0495683_0124322_159_1130 | 323 |
| 671 | 3300047444 | Ga0495675_0007708 | Ga0495675_0007708_2229_3209 | 323 |
| 672 | 3300047471 | Ga0495684_0215353 | Ga0495684_0215353_393_1373 | 323 |
| 673 | 3300048088 | Ga0495602_0031427 | Ga0495602_0031427_2682_3662 | 323 |
| 674 | 3300048905 | Ga0496102_0179249 | Ga0496102_0179249_533_1525 | 323 |
| 675 | 3300048907 | Ga0496104_0007868 | Ga0496104_0007868_5082_6053 | 323 |
| 676 | 3300048908 | Ga0496105_0007252 | Ga0496105_0007252_6638_7609 | 323 |
| 677 | 3300048912 | Ga0496109_0220267 | Ga0496109_0220267_130_1101 | 323 |
| 678 | 3300048917 | Ga0496114_0081234 | Ga0496114_0081234_776_1768 | 323 |
| 679 | 3300048918 | Ga0496115_0107351 | Ga0496115_0107351_1184_2155 | 323 |
| 680 | 3300048919 | Ga0496116_0023995 | Ga0496116_0023995_1455_2426 | 323 |
| 681 | 3300048922 | Ga0496119_0017624 | Ga0496119_0017624_1166_2137 | 323 |
| 682 | 3300048924 | Ga0496121_0029799 | Ga0496121_0029799_299_1270 | 323 |
| 683 | 3300048924 | Ga0496121_0035413 | Ga0496121_0035413_2057_3028 | 323 |
| 684 | 3300048929 | Ga0496126_0020185 | Ga0496126_0020185_4945_5916 | 323 |
| 685 | 3300049572 | Ga0501036_0143300 | Ga0501036_0143300_519_1511 | 323 |
| 686 | 3300050511 | nmdc:mga08y16_217282_c1 | nmdc:mga08y16_217282_c1_391_1383 | 323 |
| 687 | 3300050516 | nmdc:mga0sz30_60358_c1 | nmdc:mga0sz30_60358_c1_601_1572 | 323 |
| 688 | 3300053087 | Ga0500643_000218 | Ga0500643_000218_7469_8440 | 323 |
| 689 | 3300053092 | Ga0500583_0014376 | Ga0500583_0014376_1144_2115 | 323 |
| 690 | 3300053094 | Ga0500566_0003699 | Ga0500566_0003699_7629_8600 | 323 |
| 691 | 3300053103 | Ga0500555_011063 | Ga0500555_011063_418_1389 | 323 |
| 692 | 3300053130 | Ga0500642_0000922 | Ga0500642_0000922_2913_3884 | 323 |
| 693 | 3300053136 | Ga0500559_0083706 | Ga0500559_0083706_279_1250 | 323 |
| 694 | 3300053736 | Ga0500599_002035 | Ga0500599_002035_716_1687 | 323 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tuj-assembly1.cif.gz_C | inward facing conformations of the metni methionine abc transporter: dm crystal form | 0.9685 | 11 | 263 |
| 7ch8-assembly1.cif.gz_I | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.9571 | 10 | 243 |
| 5x41-assembly1.cif.gz_B | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9505 | 10 | 245 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9483 | 10 | 240 |
| 4fwi-assembly1.cif.gz_B | crystal structure of the nucleotide-binding domain of a dipeptide abc transporter | 0.948 | 9 | 319 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1F8_275_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9756 | 11 | 261 | 3.40.50.300 |
| 3tujC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9743 | 12 | 247 | 3.40.50.300 |
| 3tujC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.966 | 12 | 247 | 3.40.50.300 |
| af_P75957_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9643 | 9 | 234 | 3.40.50.300 |
| af_P75796_311_605_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9638 | 9 | 282 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A117L021-F1-model_v4 | deleted | 0.9858 | 10 | 215 |
|
| AF-A0A2E7WFK6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9789 | 10 | 260 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A537WAU2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9773 | 28 | 261 |
GO:0005524
GO:0005886 GO:0015833 GO:0016887 |
| AF-A0A212DUA4-F1-model_v4 | deleted | 0.9732 | 92 | 234 |
|
| AF-A0A3M2ANL3-F1-model_v4 | ABC transporter ATP-binding protein | 0.9726 | 8 | 258 |
GO:0005524
GO:0016887 GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar