F475650

General Info

Members Datasets Scaffolds Average Seq Length
693 285 1386 179

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10039082|Ga0213872_100390824
Length 186
Sequence MSRIGRLSIAIPSGVTVQVADHEVKVKGPKGELSLRYASPIEVAVDAGAVTVARPDEGKRSRQLHGLTRTLIANMVNGVTRGFSKQLEIQGVGYRAQMQGKSLGLQLGFSHPVSFEPPKGIDIKVEGTNKILISGADKQQVGQIAAQIRGLRPPEPYKGKGIRYEGERVRRKLGKAGKTAGAGGKK

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
173 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
174 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
175 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
185 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
203 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
214 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
215 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
253 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
254 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
267 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
268 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
269 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
270 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
271 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
272 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
273 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 5.63
Rhizosphere 94.08
Stem 0
Stem Tuber 0
Unclassified 9.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10039082 3300021361 Bacteria 2166
2 JGI24750J21931_1020039 3300002070 Bacteria 930
3 JGI24744J21845_10009043 3300002077 Bacteria 2047
4 JGI24035J26624_1000379 3300002126 Bacteria 4177
5 JGI25406J46586_10000007 3300003203 Bacteria 112227
6 JGI25404J52841_10007266 3300003659 Bacteria 2340
7 JGI25405J52794_10003510 3300003911 Bacteria 2754
8 Ga0065714_10088479 3300005288 Unclassified 2016
9 Ga0065714_10099910 3300005288 Bacteria 1663
10 Ga0065704_10021737 3300005289 Bacteria 1174
11 Ga0065704_10048519 3300005289 Bacteria 843
12 Ga0065704_10114841 3300005289 Bacteria 1883
13 Ga0065704_10388336 3300005289 Unclassified 765
14 Ga0065712_10001268 3300005290 Bacteria 7745
15 Ga0065712_10006848 3300005290 Unclassified 2525
16 Ga0065712_10040837 3300005290 Unclassified 1298
17 Ga0065712_10070849 3300005290 Bacteria 5654
18 Ga0065712_10130323 3300005290 Bacteria 1557
19 Ga0065712_10160189 3300005290 Bacteria 1308
20 Ga0065715_10005423 3300005293 Bacteria 7616
21 Ga0065715_10090524 3300005293 Bacteria 6854
22 Ga0065715_10136006 3300005293 Unclassified 1929
23 Ga0065715_10159921 3300005293 Bacteria 1638
24 Ga0065715_10242281 3300005293 Unclassified 1195
25 Ga0065715_10303848 3300005293 Bacteria 1035
26 Ga0065715_10513565 3300005293 Bacteria 726
27 Ga0065707_10044235 3300005295 Bacteria 1130
28 Ga0065707_10102203 3300005295 Bacteria 2810
29 Ga0065707_10211038 3300005295 Bacteria 1262
30 Ga0065707_10275017 3300005295 Bacteria 1062
31 Ga0065707_10338897 3300005295 Bacteria 937
32 Ga0065707_10375548 3300005295 Bacteria 884
33 Ga0070658_10439210 3300005327 Bacteria 1124
34 Ga0070658_10478336 3300005327 Bacteria 1075
35 Ga0070676_10108518 3300005328 Bacteria 1725
36 Ga0070683_100026491 3300005329 Bacteria 5221
37 Ga0070683_100054847 3300005329 Bacteria 3696
38 Ga0070683_100055457 3300005329 Bacteria 3678
39 Ga0070683_100141654 3300005329 Bacteria 2278
40 Ga0070683_100186778 3300005329 Bacteria 1968
41 Ga0070690_100052450 3300005330 Bacteria 2607
42 Ga0070690_100160678 3300005330 Bacteria 1539
43 Ga0070690_100360111 3300005330 Bacteria 1058
44 Ga0070670_100000833 3300005331 Bacteria 24086
45 Ga0070670_100003742 3300005331 Bacteria 12666
46 Ga0070677_10217628 3300005333 Unclassified 931
47 Ga0070666_10001876 3300005335 Bacteria 12791
48 Ga0070666_10002056 3300005335 Bacteria 12212
49 Ga0070666_10121884 3300005335 Bacteria 1808
50 Ga0070680_100026148 3300005336 Bacteria 4668
51 Ga0068868_100031366 3300005338 Bacteria 4081
52 Ga0068868_100422261 3300005338 Bacteria 1155
53 Ga0070660_100023190 3300005339 Bacteria 4596
54 Ga0070660_100135834 3300005339 Bacteria 1970
55 Ga0070660_100358417 3300005339 Bacteria 1202
56 Ga0070689_100014852 3300005340 Bacteria 5666
57 Ga0070689_100100534 3300005340 Bacteria 2288
58 Ga0070689_100273588 3300005340 Bacteria 1399
59 Ga0070687_100000382 3300005343 Bacteria 15047
60 Ga0070687_100484144 3300005343 Unclassified 830
61 Ga0070661_100062340 3300005344 Bacteria 2737
62 Ga0070661_100292077 3300005344 Unclassified 1267
63 Ga0070668_100000403 3300005347 Bacteria 28684
64 Ga0070668_100050196 3300005347 Bacteria 3211
65 Ga0070668_100050229 3300005347 Bacteria 3210
66 Ga0070668_100056962 3300005347 Bacteria 3019
67 Ga0070668_100258296 3300005347 Bacteria 1448
68 Ga0070668_100486374 3300005347 Unclassified 1066
69 Ga0070669_100002011 3300005353 Bacteria 14710
70 Ga0070669_100006097 3300005353 Bacteria 8698
71 Ga0070669_100033015 3300005353 Bacteria 3741
72 Ga0070669_100125169 3300005353 Bacteria 1966
73 Ga0070669_100287406 3300005353 Bacteria 1319
74 Ga0070675_100004678 3300005354 Bacteria 10447
75 Ga0070675_100048534 3300005354 Bacteria 3482
76 Ga0070675_100083047 3300005354 Bacteria 2673
77 Ga0070675_100129528 3300005354 Unclassified 2149
78 Ga0070675_100133137 3300005354 Bacteria 2120
79 Ga0070675_100158863 3300005354 Bacteria 1943
80 Ga0070675_100218659 3300005354 Bacteria 1658
81 Ga0070675_100272915 3300005354 Bacteria 1484
82 Ga0070675_100295769 3300005354 Bacteria 1425
83 Ga0070671_100000283 3300005355 Bacteria 34469
84 Ga0070671_100011134 3300005355 Bacteria 7224
85 Ga0070671_100042031 3300005355 Bacteria 3799
86 Ga0070671_100054306 3300005355 Bacteria 3331
87 Ga0070671_100321402 3300005355 Bacteria 1319
88 Ga0070671_100372527 3300005355 Bacteria 1219
89 Ga0070674_100013872 3300005356 Bacteria 4993
90 Ga0070674_100222619 3300005356 Bacteria 1468
91 Ga0070673_100008141 3300005364 Bacteria 6955
92 Ga0070673_100014325 3300005364 Bacteria 5516
93 Ga0070673_100075213 3300005364 Bacteria 2724
94 Ga0070673_100476403 3300005364 Bacteria 1126
95 Ga0070673_100714871 3300005364 Bacteria 921
96 Ga0070688_100000733 3300005365 Bacteria 16191
97 Ga0070688_100001414 3300005365 Bacteria 11953
98 Ga0070688_100016452 3300005365 Bacteria 4229
99 Ga0070688_100054122 3300005365 Bacteria 2512
100 Ga0070688_100102629 3300005365 Bacteria 1888
101 Ga0070688_101044988 3300005365 Bacteria 651
102 Ga0070659_100001154 3300005366 Bacteria 19280
103 Ga0070659_100002483 3300005366 Bacteria 13098
104 Ga0070667_100004665 3300005367 Bacteria 11504
105 Ga0070667_100010004 3300005367 Bacteria 7858
106 Ga0070667_100431930 3300005367 Bacteria 1202
107 Ga0070709_10120646 3300005434 Bacteria 1776
108 Ga0070709_10397957 3300005434 Unclassified 1028
109 Ga0070714_100111441 3300005435 Bacteria 2423
110 Ga0070714_100235996 3300005435 Bacteria 1686
111 Ga0070714_100365563 3300005435 Unclassified 1357
112 Ga0070713_100019600 3300005436 Bacteria 5170
113 Ga0070713_100040250 3300005436 Bacteria 3798
114 Ga0070713_100147200 3300005436 Unclassified 2092
115 Ga0070713_100214091 3300005436 Bacteria 1746
116 Ga0070710_10048829 3300005437 Bacteria 2365
117 Ga0070711_100647330 3300005439 Unclassified 886
118 Ga0070705_100075673 3300005440 Bacteria 2050
119 Ga0070705_100541260 3300005440 Bacteria 891
120 Ga0070705_100865373 3300005440 Bacteria 724
121 Ga0070700_100003660 3300005441 Bacteria 7944
122 Ga0070708_100003581 3300005445 Bacteria 12183
123 Ga0070708_100036156 3300005445 Bacteria 4307
124 Ga0070708_100053105 3300005445 Bacteria 3595
125 Ga0070708_100054749 3300005445 Bacteria 3545
126 Ga0070708_100093171 3300005445 Bacteria 2746
127 Ga0070708_100136047 3300005445 Bacteria 2276
128 Ga0070708_100615489 3300005445 Bacteria 1024
129 Ga0070708_100836634 3300005445 Bacteria 865
130 Ga0070678_100001511 3300005456 Bacteria 12415
131 Ga0070678_100043541 3300005456 Bacteria 3198
132 Ga0070678_100094691 3300005456 Bacteria 2299
133 Ga0070678_101198599 3300005456 Bacteria 704
134 Ga0070662_100004281 3300005457 Bacteria 9009
135 Ga0070662_100197437 3300005457 Bacteria 1594
136 Ga0070662_100765557 3300005457 Bacteria 819
137 Ga0070681_10052300 3300005458 Bacteria 4073
138 Ga0070681_10143076 3300005458 Bacteria 2321
139 Ga0068867_100044767 3300005459 Bacteria 3243
140 Ga0068867_101619312 3300005459 Bacteria 605
141 Ga0070685_10106425 3300005466 Bacteria 1721
142 Ga0070685_10140714 3300005466 Bacteria 1519
143 Ga0070706_100000210 3300005467 Bacteria 71893
144 Ga0070706_100006577 3300005467 Bacteria 10965
145 Ga0070706_100020444 3300005467 Bacteria 6102
146 Ga0070706_100020521 3300005467 Bacteria 6089
147 Ga0070706_100025982 3300005467 Bacteria 5388
148 Ga0070706_100057582 3300005467 Bacteria 3586
149 Ga0070706_100071274 3300005467 Bacteria 3213
150 Ga0070706_100137442 3300005467 Bacteria 2280
151 Ga0070706_100146613 3300005467 Bacteria 2204
152 Ga0070706_100382154 3300005467 Bacteria 1311
153 Ga0070706_100655293 3300005467 Bacteria 975
154 Ga0070706_100751826 3300005467 Bacteria 903
155 Ga0070707_100003721 3300005468 Bacteria 14386
156 Ga0070707_100016188 3300005468 Bacteria 6997
157 Ga0070707_100027361 3300005468 Bacteria 5425
158 Ga0070707_100030502 3300005468 Bacteria 5134
159 Ga0070707_100032046 3300005468 Bacteria 5006
160 Ga0070707_100039193 3300005468 Bacteria 4529
161 Ga0070707_100063474 3300005468 Bacteria 3545
162 Ga0070707_100072311 3300005468 Bacteria 3323
163 Ga0070707_100254090 3300005468 Bacteria 1710
164 Ga0070707_100320540 3300005468 Bacteria 1506
165 Ga0070707_100342021 3300005468 Bacteria 1453
166 Ga0070707_100423982 3300005468 Unclassified 1291
167 Ga0070707_101422798 3300005468 Unclassified 660
168 Ga0070698_100001836 3300005471 Bacteria 23657
169 Ga0070698_100032196 3300005471 Bacteria 5431
170 Ga0070698_100354407 3300005471 Unclassified 1399
171 Ga0070699_100422069 3300005518 Unclassified 1207
172 Ga0070699_100871109 3300005518 Unclassified 825
173 Ga0070699_100949089 3300005518 Bacteria 788
174 Ga0070699_100994759 3300005518 Bacteria 769
175 Ga0070679_100025856 3300005530 Bacteria 5760
176 Ga0070679_100054949 3300005530 Bacteria 3965
177 Ga0070684_100001312 3300005535 Bacteria 17819
178 Ga0070684_100029216 3300005535 Bacteria 4670
179 Ga0070684_100529835 3300005535 Bacteria 1092
180 Ga0070697_100000826 3300005536 Bacteria 23247
181 Ga0070697_100002201 3300005536 Bacteria 14963
182 Ga0070697_100002768 3300005536 Bacteria 13496
183 Ga0070697_100003773 3300005536 Bacteria 11628
184 Ga0070697_100045125 3300005536 Bacteria 3571
185 Ga0070697_100121642 3300005536 Bacteria 2184
186 Ga0070697_100160286 3300005536 Bacteria 1900
187 Ga0070672_100000353 3300005543 Bacteria 26400
188 Ga0070672_100004247 3300005543 Bacteria 9368
189 Ga0070686_100000947 3300005544 Bacteria 16724
190 Ga0070686_100126507 3300005544 Bacteria 1761
191 Ga0070686_101163226 3300005544 Unclassified 639
192 Ga0070665_100008787 3300005548 Bacteria 10223
193 Ga0070665_100013901 3300005548 Bacteria 8098
194 Ga0070665_100234438 3300005548 Bacteria 1836
195 Ga0070665_100688544 3300005548 Bacteria 1035
196 Ga0070665_101191386 3300005548 Unclassified 772
197 Ga0070704_100029184 3300005549 Bacteria 3680
198 Ga0068855_100308936 3300005563 Bacteria 1750
199 Ga0070664_100125926 3300005564 Bacteria 2247
200 Ga0070664_100182011 3300005564 Bacteria 1868
201 Ga0070664_100248105 3300005564 Bacteria 1600
202 Ga0068856_100456081 3300005614 Bacteria 1299
203 Ga0070702_100292255 3300005615 Bacteria 1123
204 Ga0068852_100235823 3300005616 Bacteria 1746
205 Ga0068859_100077354 3300005617 Bacteria 3368
206 Ga0068864_100111886 3300005618 Bacteria 2433
207 Ga0068864_100285604 3300005618 Bacteria 1541
208 Ga0068864_100287593 3300005618 Bacteria 1536
209 Ga0068864_100388810 3300005618 Bacteria 1324
210 Ga0068866_10297125 3300005718 Bacteria 1007
211 Ga0068861_100107874 3300005719 Bacteria 2227
212 Ga0068861_100158124 3300005719 Bacteria 1866
213 Ga0068851_10417948 3300005834 Bacteria 791
214 Ga0068870_10128838 3300005840 Bacteria 1467
215 Ga0068863_100007967 3300005841 Bacteria 10355
216 Ga0068858_100052055 3300005842 Bacteria 3788
217 Ga0068858_100134565 3300005842 Bacteria 2319
218 Ga0068858_100142777 3300005842 Bacteria 2248
219 Ga0068858_100224419 3300005842 Unclassified 1780
220 Ga0068860_100010603 3300005843 Bacteria 9101
221 Ga0068860_100066467 3300005843 Bacteria 3425
222 Ga0068860_100548031 3300005843 Bacteria 1158
223 Ga0068862_100041432 3300005844 Bacteria 3918
224 Ga0068862_100569804 3300005844 Bacteria 1083
225 Ga0081455_10001399 3300005937 Bacteria 29813
226 Ga0081455_10021886 3300005937 Bacteria 5988
227 Ga0081455_10031292 3300005937 Bacteria 4817
228 Ga0081455_10031464 3300005937 Bacteria 4801
229 Ga0081455_10069224 3300005937 Bacteria 2935
230 Ga0081455_10144458 3300005937 Bacteria 1843
231 Ga0081455_10336539 3300005937 Unclassified 1070
232 Ga0081455_10443827 3300005937 Bacteria 888
233 Ga0081538_10015344 3300005981 Bacteria 5937
234 Ga0081540_1000036 3300005983 Bacteria 140805
235 Ga0081540_1025675 3300005983 Bacteria 3384
236 Ga0081540_1065432 3300005983 Bacteria 1709
237 Ga0081539_10000014 3300005985 Bacteria 411270
238 Ga0070717_10016944 3300006028 Bacteria 5659
239 Ga0070717_10028090 3300006028 Bacteria 4500
240 Ga0070717_10037326 3300006028 Bacteria 3945
241 Ga0070717_10037361 3300006028 Bacteria 3943
242 Ga0070717_10077682 3300006028 Bacteria 2780
243 Ga0070717_10361833 3300006028 Unclassified 1299
244 Ga0070717_10598047 3300006028 Bacteria 1000
245 Ga0070715_10059680 3300006163 Bacteria 1670
246 Ga0070716_100011207 3300006173 Bacteria 4513
247 Ga0070716_100612155 3300006173 Unclassified 821
248 Ga0070712_100046609 3300006175 Bacteria 2997
249 Ga0070712_100049660 3300006175 Unclassified 2914
250 Ga0070712_100083926 3300006175 Bacteria 2314
251 Ga0070712_100239926 3300006175 Bacteria 1443
252 Ga0097621_100018403 3300006237 Bacteria 5335
253 Ga0097621_100024099 3300006237 Bacteria 4748
254 Ga0097621_100682376 3300006237 Bacteria 944
255 Ga0068871_100084135 3300006358 Bacteria 2640
256 Ga0068871_100097542 3300006358 Bacteria 2457
257 Ga0075428_100095839 3300006844 Bacteria 3235
258 Ga0075428_100284891 3300006844 Unclassified 1778
259 Ga0075428_100416748 3300006844 Bacteria 1439
260 Ga0075434_100200364 3300006871 Bacteria 2016
261 Ga0075434_100729427 3300006871 Bacteria 1008
262 Ga0068865_100105971 3300006881 Bacteria 2066
263 Ga0068865_100149571 3300006881 Bacteria 1770
264 Ga0068865_100580131 3300006881 Unclassified 945
265 Ga0097620_100077352 3300006931 Bacteria 3368
266 Ga0099795_10057265 3300007788 Bacteria 1436
267 Ga0099795_10121224 3300007788 Unclassified 1046
268 Ga0111539_10840106 3300009094 Bacteria 1068
269 Ga0111539_11088195 3300009094 Bacteria 929
270 Ga0105245_10006614 3300009098 Bacteria 10180
271 Ga0105245_10214619 3300009098 Bacteria 1854
272 Ga0105245_11957992 3300009098 Bacteria 639
273 Ga0105247_10235857 3300009101 Bacteria 1244
274 Ga0114129_10241662 3300009147 Bacteria 2427
275 Ga0114129_10662601 3300009147 Bacteria 1346
276 Ga0114129_10787074 3300009147 Bacteria 1214
277 Ga0105243_10033332 3300009148 Bacteria 3982
278 Ga0105243_10331810 3300009148 Bacteria 1390
279 Ga0105248_10321465 3300009177 Bacteria 1743
280 Ga0105249_10011097 3300009553 Bacteria 7914
281 Ga0099796_10011175 3300010159 Bacteria 2496
282 Ga0099796_10044277 3300010159 Bacteria 1520
283 Ga0099796_10130751 3300010159 Unclassified 973
284 Ga0105239_10070002 3300010375 Bacteria 3853
285 Ga0105239_10100267 3300010375 Bacteria 3203
286 Ga0105239_10408038 3300010375 Bacteria 1538
287 Ga0105239_11229805 3300010375 Unclassified 863
288 Ga0105239_11553985 3300010375 Bacteria 765
289 Ga0105246_10182706 3300011119 Bacteria 1616
290 Ga0105246_10438582 3300011119 Bacteria 1095
291 Ga0157371_10148130 3300013102 Bacteria 1673
292 Ga0157369_10182471 3300013105 Bacteria 2208
293 Ga0157369_11002830 3300013105 Bacteria 855
294 Ga0157374_10001473 3300013296 Bacteria 19879
295 Ga0157374_10005577 3300013296 Bacteria 10597
296 Ga0157374_10033688 3300013296 Bacteria 4675
297 Ga0157374_10127435 3300013296 Bacteria 2461
298 Ga0157374_10146746 3300013296 Unclassified 2291
299 Ga0157374_10431232 3300013296 Bacteria 1318
300 Ga0157374_10824904 3300013296 Bacteria 944
301 Ga0157374_11015180 3300013296 Unclassified 849
302 Ga0157378_10043528 3300013297 Bacteria 3987
303 Ga0157378_10048884 3300013297 Bacteria 3762
304 Ga0157378_10454673 3300013297 Bacteria 1271
305 Ga0157378_10459352 3300013297 Bacteria 1265
306 Ga0157378_10529437 3300013297 Bacteria 1181
307 Ga0157378_10554701 3300013297 Bacteria 1155
308 Ga0157378_10693380 3300013297 Unclassified 1037
309 Ga0157378_10884840 3300013297 Bacteria 923
310 Ga0163162_10003249 3300013306 Bacteria 15541
311 Ga0163162_10014121 3300013306 Bacteria 7805
312 Ga0163162_10034354 3300013306 Bacteria 5046
313 Ga0163162_10052794 3300013306 Bacteria 4083
314 Ga0163162_10086566 3300013306 Bacteria 3211
315 Ga0163162_10203836 3300013306 Bacteria 2107
316 Ga0163162_10224090 3300013306 Bacteria 2010
317 Ga0163162_10360602 3300013306 Bacteria 1586
318 Ga0163162_11279590 3300013306 Bacteria 833
319 Ga0163162_11461116 3300013306 Unclassified 778
320 Ga0157372_10037163 3300013307 Bacteria 5368
321 Ga0157372_10040369 3300013307 Bacteria 5155
322 Ga0157372_10285094 3300013307 Bacteria 1921
323 Ga0157375_10000287 3300013308 Bacteria 45998
324 Ga0157375_10001868 3300013308 Bacteria 18135
325 Ga0157375_10007782 3300013308 Bacteria 9374
326 Ga0157375_10047258 3300013308 Bacteria 4202
327 Ga0157375_10082239 3300013308 Bacteria 3261
328 Ga0157375_10505558 3300013308 Bacteria 1372
329 Ga0163163_10229332 3300014325 Unclassified 1906
330 Ga0163163_10294276 3300014325 Bacteria 1676
331 Ga0163163_10522863 3300014325 Unclassified 1249
332 Ga0163163_10935678 3300014325 Bacteria 930
333 Ga0163163_11709928 3300014325 Unclassified 690
334 Ga0182008_10063220 3300014497 Bacteria 1823
335 Ga0157377_10013826 3300014745 Bacteria 4092
336 Ga0157377_10616454 3300014745 Bacteria 776
337 Ga0157379_10005647 3300014968 Bacteria 10748
338 Ga0157379_10421858 3300014968 Bacteria 1229
339 Ga0157376_10031061 3300014969 Bacteria 4273
340 Ga0157376_10349606 3300014969 Bacteria 1414
341 Ga0157376_10404419 3300014969 Bacteria 1321
342 Ga0157376_10681829 3300014969 Bacteria 1031
343 Ga0157376_11504534 3300014969 Bacteria 706
344 Ga0163161_10331771 3300017792 Bacteria 1205
345 Ga0207666_1000898 3300025271 Bacteria 3558
346 Ga0207673_1005621 3300025290 Bacteria 1534
347 Ga0207673_1008168 3300025290 Bacteria 1322
348 Ga0207697_10000010 3300025315 Bacteria 65144
349 Ga0207697_10000495 3300025315 Bacteria 22147
350 Ga0207697_10002230 3300025315 Bacteria 10127
351 Ga0207697_10002322 3300025315 Bacteria 9909
352 Ga0207697_10013157 3300025315 Bacteria 3455
353 Ga0207697_10014592 3300025315 Bacteria 3257
354 Ga0207697_10158590 3300025315 Bacteria 986
355 Ga0207653_10037317 3300025885 Bacteria 1585
356 Ga0207682_10197335 3300025893 Unclassified 924
357 Ga0207642_10079022 3300025899 Bacteria 1592
358 Ga0207642_10140377 3300025899 Bacteria 1273
359 Ga0207710_10089084 3300025900 Bacteria 1442
360 Ga0207688_10001208 3300025901 Bacteria 13377
361 Ga0207680_10003944 3300025903 Bacteria 7004
362 Ga0207680_10025390 3300025903 Bacteria 3268
363 Ga0207680_10032106 3300025903 Bacteria 2981
364 Ga0207647_10102679 3300025904 Bacteria 1695
365 Ga0207685_10003968 3300025905 Bacteria 3683
366 Ga0207685_10023055 3300025905 Bacteria 2113
367 Ga0207699_10008911 3300025906 Bacteria 4974
368 Ga0207699_10721478 3300025906 Bacteria 730
369 Ga0207645_10001786 3300025907 Bacteria 17391
370 Ga0207645_10002762 3300025907 Bacteria 13659
371 Ga0207645_10004432 3300025907 Bacteria 10394
372 Ga0207645_10070956 3300025907 Bacteria 2229
373 Ga0207645_10125827 3300025907 Bacteria 1666
374 Ga0207643_10067066 3300025908 Bacteria 2059
375 Ga0207705_10736426 3300025909 Bacteria 766
376 Ga0207684_10000028 3300025910 Bacteria 306450
377 Ga0207684_10003766 3300025910 Bacteria 14658
378 Ga0207684_10011143 3300025910 Bacteria 7871
379 Ga0207684_10030870 3300025910 Bacteria 4561
380 Ga0207684_10048446 3300025910 Bacteria 3604
381 Ga0207684_10074641 3300025910 Bacteria 2881
382 Ga0207684_10108278 3300025910 Bacteria 2378
383 Ga0207684_10248195 3300025910 Bacteria 1536
384 Ga0207684_10358534 3300025910 Bacteria 1255
385 Ga0207684_10800866 3300025910 Bacteria 796
386 Ga0207707_10035549 3300025912 Bacteria 4356
387 Ga0207707_10122048 3300025912 Bacteria 2278
388 Ga0207693_10006942 3300025915 Bacteria 9356
389 Ga0207693_10035010 3300025915 Bacteria 3961
390 Ga0207693_10157817 3300025915 Bacteria 1785
391 Ga0207693_10339365 3300025915 Bacteria 1176
392 Ga0207693_10536047 3300025915 Bacteria 913
393 Ga0207663_10227635 3300025916 Bacteria 1360
394 Ga0207663_10528591 3300025916 Unclassified 919
395 Ga0207663_10733154 3300025916 Unclassified 784
396 Ga0207663_10774021 3300025916 Unclassified 763
397 Ga0207660_10087575 3300025917 Bacteria 2301
398 Ga0207662_10000699 3300025918 Bacteria 15308
399 Ga0207662_10327050 3300025918 Bacteria 1024
400 Ga0207657_10130260 3300025919 Bacteria 2062
401 Ga0207649_10150356 3300025920 Bacteria 1603
402 Ga0207649_10201065 3300025920 Bacteria 1408
403 Ga0207649_11138517 3300025920 Unclassified 616
404 Ga0207652_10002941 3300025921 Bacteria 14248
405 Ga0207646_10000191 3300025922 Bacteria 83638
406 Ga0207646_10005640 3300025922 Bacteria 13143
407 Ga0207646_10009621 3300025922 Bacteria 9535
408 Ga0207646_10028198 3300025922 Bacteria 5113
409 Ga0207646_10065346 3300025922 Bacteria 3248
410 Ga0207646_10068226 3300025922 Bacteria 3176
411 Ga0207646_10073074 3300025922 Bacteria 3063
412 Ga0207646_10085584 3300025922 Bacteria 2820
413 Ga0207646_10220871 3300025922 Bacteria 1712
414 Ga0207681_10004055 3300025923 Bacteria 9086
415 Ga0207681_10014902 3300025923 Bacteria 4842
416 Ga0207681_10069483 3300025923 Bacteria 2450
417 Ga0207681_10243409 3300025923 Bacteria 1401
418 Ga0207681_10327174 3300025923 Bacteria 1221
419 Ga0207681_10341640 3300025923 Unclassified 1196
420 Ga0207650_10007428 3300025925 Bacteria 7468
421 Ga0207650_10018287 3300025925 Bacteria 4917
422 Ga0207650_10140098 3300025925 Bacteria 1901
423 Ga0207650_10152097 3300025925 Bacteria 1827
424 Ga0207650_10694879 3300025925 Unclassified 859
425 Ga0207659_10003512 3300025926 Bacteria 9421
426 Ga0207659_10045484 3300025926 Bacteria 3095
427 Ga0207659_10049761 3300025926 Bacteria 2974
428 Ga0207659_10127832 3300025926 Unclassified 1957
429 Ga0207659_10197646 3300025926 Bacteria 1604
430 Ga0207659_10950306 3300025926 Unclassified 739
431 Ga0207687_10317409 3300025927 Unclassified 1260
432 Ga0207687_10328849 3300025927 Bacteria 1239
433 Ga0207700_10022621 3300025928 Bacteria 4317
434 Ga0207700_10190450 3300025928 Unclassified 1723
435 Ga0207700_10711797 3300025928 Bacteria 897
436 Ga0207664_10120019 3300025929 Bacteria 2199
437 Ga0207644_10029826 3300025931 Bacteria 3787
438 Ga0207644_10035251 3300025931 Bacteria 3504
439 Ga0207644_10092545 3300025931 Bacteria 2256
440 Ga0207644_10101578 3300025931 Bacteria 2161
441 Ga0207644_10112816 3300025931 Bacteria 2058
442 Ga0207644_10187708 3300025931 Bacteria 1624
443 Ga0207644_10315666 3300025931 Unclassified 1263
444 Ga0207690_10001098 3300025932 Bacteria 17229
445 Ga0207706_10008197 3300025933 Bacteria 9637
446 Ga0207706_10068933 3300025933 Bacteria 3111
447 Ga0207706_10122355 3300025933 Bacteria 2288
448 Ga0207706_10127775 3300025933 Bacteria 2235
449 Ga0207706_10407331 3300025933 Unclassified 1179
450 Ga0207686_10329699 3300025934 Bacteria 1143
451 Ga0207670_10003261 3300025936 Bacteria 8602
452 Ga0207670_10009200 3300025936 Bacteria 5622
453 Ga0207670_10197408 3300025936 Unclassified 1526
454 Ga0207669_10002532 3300025937 Bacteria 7802
455 Ga0207669_10011026 3300025937 Bacteria 4378
456 Ga0207704_10122214 3300025938 Bacteria 1785
457 Ga0207704_10133056 3300025938 Bacteria 1726
458 Ga0207704_10183501 3300025938 Bacteria 1514
459 Ga0207704_10480862 3300025938 Bacteria 997
460 Ga0207665_10026961 3300025939 Bacteria 3795
461 Ga0207665_10089858 3300025939 Bacteria 2128
462 Ga0207665_10215560 3300025939 Bacteria 1405
463 Ga0207665_10863126 3300025939 Bacteria 717
464 Ga0207691_10000142 3300025940 Bacteria 66224
465 Ga0207691_10016028 3300025940 Bacteria 7119
466 Ga0207661_10031201 3300025944 Bacteria 4113
467 Ga0207661_10077884 3300025944 Bacteria 2728
468 Ga0207661_10124065 3300025944 Bacteria 2203
469 Ga0207651_10007253 3300025960 Bacteria 5894
470 Ga0207651_10027669 3300025960 Bacteria 3565
471 Ga0207651_10197170 3300025960 Bacteria 1610
472 Ga0207651_10523905 3300025960 Bacteria 1027
473 Ga0207651_11466521 3300025960 Bacteria 614
474 Ga0207712_10010310 3300025961 Bacteria 5932
475 Ga0207712_10328930 3300025961 Bacteria 1263
476 Ga0207668_10009836 3300025972 Bacteria 5747
477 Ga0207668_10026495 3300025972 Bacteria 3764
478 Ga0207668_10042584 3300025972 Bacteria 3076
479 Ga0207668_10052709 3300025972 Bacteria 2816
480 Ga0207668_10057405 3300025972 Bacteria 2715
481 Ga0207658_10010242 3300025986 Bacteria 6370
482 Ga0207658_10014736 3300025986 Bacteria 5357
483 Ga0207658_10046961 3300025986 Bacteria 3157
484 Ga0207658_10531464 3300025986 Unclassified 1050
485 Ga0207677_10008042 3300026023 Bacteria 5871
486 Ga0207677_10020703 3300026023 Bacteria 4000
487 Ga0207677_10111866 3300026023 Bacteria 2035
488 Ga0207677_10353684 3300026023 Unclassified 1232
489 Ga0207677_10550604 3300026023 Bacteria 1005
490 Ga0207703_10003624 3300026035 Bacteria 12889
491 Ga0207703_10142997 3300026035 Bacteria 2078
492 Ga0207678_10020455 3300026067 Bacteria 5804
493 Ga0207708_10137900 3300026075 Bacteria 1911
494 Ga0207702_10495612 3300026078 Bacteria 1190
495 Ga0207641_10022387 3300026088 Bacteria 5202
496 Ga0207641_10147740 3300026088 Bacteria 2127
497 Ga0207641_10976760 3300026088 Bacteria 843
498 Ga0207648_10096569 3300026089 Bacteria 2586
499 Ga0207648_10567325 3300026089 Bacteria 1044
500 Ga0207648_11364095 3300026089 Bacteria 666
501 Ga0207676_10474000 3300026095 Bacteria 1184
502 Ga0207675_100165775 3300026118 Bacteria 2110
503 Ga0207675_100247761 3300026118 Bacteria 1723
504 Ga0207683_10009866 3300026121 Bacteria 8145
505 Ga0207683_10015583 3300026121 Bacteria 6470
506 Ga0209974_10023640 3300027876 Bacteria 2034
507 Ga0209974_10165923 3300027876 Bacteria 803
508 Ga0268266_10004179 3300028379 Bacteria 13926
509 Ga0268266_10026994 3300028379 Bacteria 4885
510 Ga0268266_10076422 3300028379 Bacteria 2910
511 Ga0268266_10317605 3300028379 Bacteria 1457
512 Ga0268266_10777928 3300028379 Unclassified 924
513 Ga0268265_10044999 3300028380 Bacteria 3290
514 Ga0268264_10149965 3300028381 Bacteria 2089
515 Ga0268264_11358084 3300028381 Bacteria 721
516 Ga0316579_10204478 3300031691 Bacteria 955
517 Ga0316576_10006114 3300031727 Bacteria 7454
518 Ga0316576_10426975 3300031727 Bacteria 980
519 Ga0316576_10564928 3300031727 Bacteria 833
520 Ga0316578_10039603 3300031728 Bacteria 2722
521 Ga0316578_10255570 3300031728 Bacteria 1051
522 Ga0307405_10031553 3300031731 Bacteria 3121
523 Ga0316577_10124221 3300031733 Unclassified 1451
524 Ga0307413_10044877 3300031824 Bacteria 2615
525 Ga0307406_10222244 3300031901 Bacteria 1404
526 Ga0307412_10109719 3300031911 Bacteria 1968
527 Ga0307416_100110301 3300032002 Bacteria 2422
528 Ga0307414_10239387 3300032004 Bacteria 1501
529 Ga0307415_100047308 3300032126 Bacteria 2895
530 Ga0316593_10000330 3300032168 Bacteria 8167
531 Ga0316592_1035195 3300033524 Unclassified 1098
532 Ga0316592_1038517 3300033524 Bacteria 1054
533 Ga0316592_1048811 3300033524 Bacteria 944
534 Ga0373926_0077902 3300035083 Bacteria 1223
535 Ga0373934_0070168 3300035086 Bacteria 1401
536 Ga0373923_0090520 3300035111 Bacteria 1338
537 Ga0373945_0005962 3300035116 Bacteria 3914
538 Ga0373954_0021155 3300035118 Bacteria 2944
539 Ga0373956_0140869 3300035119 Bacteria 1132
540 Ga0373957_0174002 3300035120 Bacteria 890
541 Ga0373943_0080926 3300035170 Bacteria 1665
542 Ga0373943_0094871 3300035170 Bacteria 1551
543 Ga0373943_0439017 3300035170 Bacteria 757
544 Ga0373955_0081803 3300035172 Bacteria 1826
545 Ga0373955_0207250 3300035172 Bacteria 1168
546 Ga0373942_0113873 3300035207 Bacteria 839
547 Ga0373961_0242836 3300035241 Bacteria 649
548 Ga0316574_0012891 3300035398 Bacteria 4793
549 Ga0373931_0108890 3300035691 Bacteria 1569
550 Ga0373931_0140827 3300035691 Bacteria 1397
551 Ga0373935_0031757 3300035692 Bacteria 3279
552 Ga0373935_0172545 3300035692 Bacteria 1480
553 Ga0373935_0314802 3300035692 Bacteria 1109
554 Ga0373927_0200198 3300035695 Bacteria 1311
555 Ga0373933_0286725 3300035724 Bacteria 1064
556 Ga0373947_0307534 3300035725 Bacteria 1058
557 Ga0373947_0394809 3300035725 Bacteria 932
558 Ga0373937_0114836 3300036401 Bacteria 2506
559 Ga0316582_0001483 3300036647 Bacteria 10344
560 Ga0316582_0010838 3300036647 Bacteria 5013
561 Ga0316582_0177857 3300036647 Bacteria 1446
562 Ga0316584_0003646 3300036712 Bacteria 10079
563 Ga0316584_0137273 3300036712 Bacteria 1825
564 Ga0316584_0240135 3300036712 Bacteria 1326
565 Ga0316584_0296054 3300036712 Bacteria 1173
566 Ga0316584_0328763 3300036712 Bacteria 1101
567 Ga0373925_0006124 3300037068 Bacteria 8887
568 Ga0373925_0040917 3300037068 Bacteria 3433
569 Ga0373925_0417832 3300037068 Bacteria 1095
570 Ga0373925_1416552 3300037068 Bacteria 569
571 Ga0395899_0081216 3300037312 Bacteria 2359
572 Ga0395900_0008031 3300037418 Bacteria 10861
573 Ga0395900_0232346 3300037418 Bacteria 1854
574 Ga0395900_0295735 3300037418 Bacteria 1607
575 Ga0395900_0763401 3300037418 Unclassified 897
576 Ga0395900_1133811 3300037418 Unclassified 699
577 Ga0395898_0002044 3300037466 Bacteria 25218
578 Ga0395898_0295593 3300037466 Bacteria 1545
579 Ga0395905_0023999 3300037471 Bacteria 5758
580 Ga0395901_0002964 3300038443 Bacteria 17124
581 Ga0395901_0145221 3300038443 Bacteria 2494
582 Ga0395901_0280015 3300038443 Bacteria 1733
583 Ga0395901_0420237 3300038443 Bacteria 1371
584 Ga0436360_0163442 3300039438 Bacteria 11133
585 Ga0436360_0355471 3300039438 Bacteria 1604
586 Ga0436360_1158035 3300039438 Bacteria 2603
587 Ga0436361_0454935 3300039447 Bacteria 1601
588 Ga0436361_0953841 3300039447 Bacteria 5979
589 Ga0436362_1027100 3300039453 Bacteria 3065
590 Ga0451798_0913297 3300041458 Unclassified 1206
591 Ga0451802_0462827 3300041460 Bacteria 736
592 Ga0439451_017252 3300042009 Bacteria 1455
593 Ga0439458_0022657 3300042157 Unclassified 1460
594 Ga0439464_0019868 3300042439 Bacteria 1836
595 Ga0439460_0109353 3300042461 Bacteria 895
596 Ga0439440_0084970 3300042993 Bacteria 842
597 Ga0466964_0028831 3300044706 Unclassified 2189
598 Ga0451576_0230708 3300045051 Bacteria 1933
599 Ga0466967_0032556 3300045976 Bacteria 4403
600 Ga0495592_0013560 3300046454 Bacteria 6201
601 Ga0495603_0055534 3300046455 Bacteria 2346
602 Ga0495629_0008333 3300046459 Bacteria 7622
603 Ga0495629_0229258 3300046459 Bacteria 1280
604 Ga0495651_0219859 3300046462 Bacteria 1315
605 Ga0495653_0108033 3300046463 Bacteria 2004
606 Ga0495580_0107757 3300046472 Bacteria 1935
607 Ga0495580_0165118 3300046472 Bacteria 1532
608 Ga0495580_0319707 3300046472 Bacteria 1055
609 Ga0495580_0331652 3300046472 Bacteria 1033
610 Ga0495582_0336771 3300046473 Bacteria 868
611 Ga0495639_0340575 3300046475 Bacteria 752
612 Ga0495662_0069387 3300046476 Bacteria 1707
613 Ga0495664_0202283 3300046477 Bacteria 1203
614 Ga0495608_0207889 3300046511 Bacteria 1231
615 Ga0495618_0158160 3300046514 Bacteria 1445
616 Ga0495628_0208490 3300046516 Bacteria 1470
617 Ga0495630_0041206 3300046517 Bacteria 3448
618 Ga0495652_0045601 3300046529 Bacteria 3767
619 Ga0495665_0043688 3300046531 Bacteria 2383
620 Ga0495587_0009500 3300046536 Bacteria 6231
621 Ga0495598_0048134 3300046537 Bacteria 1274
622 Ga0495645_0001076 3300046543 Bacteria 18525
623 Ga0495657_0394064 3300046675 Bacteria 816
624 Ga0495599_0000317 3300046678 Bacteria 28802
625 Ga0495623_0000811 3300046679 Bacteria 21045
626 Ga0495646_0002940 3300046680 Bacteria 10561
627 Ga0495647_0028223 3300046681 Bacteria 2068
628 Ga0495647_0067886 3300046681 Bacteria 1421
629 Ga0495658_0011003 3300046683 Bacteria 4538
630 Ga0495658_0129662 3300046683 Bacteria 1534
631 Ga0495669_0142072 3300046684 Bacteria 1133
632 Ga0495624_0370370 3300046690 Bacteria 861
633 Ga0495670_0316224 3300046691 Bacteria 838
634 Ga0495600_0692218 3300046809 Bacteria 614
635 Ga0495581_0106207 3300047315 Bacteria 1632
636 Ga0495604_0053697 3300047317 Bacteria 3112
637 Ga0495604_0515141 3300047317 Bacteria 774
638 Ga0495674_0047362 3300047319 Bacteria 3813
639 Ga0495674_0078592 3300047319 Bacteria 2834
640 Ga0495680_0293762 3300047322 Bacteria 1142
641 Ga0495675_0010133 3300047444 Bacteria 5878
642 Ga0495677_0071890 3300047445 Bacteria 1290
643 Ga0495684_0063571 3300047471 Bacteria 2805
644 Ga0495593_0125575 3300047673 Bacteria 1304
645 Ga0496100_0312269 3300048903 Bacteria 1179
646 Ga0496101_0108830 3300048904 Bacteria 2084
647 Ga0496102_0028763 3300048905 Bacteria 4968
648 Ga0496103_0098168 3300048906 Bacteria 1852
649 Ga0496103_0191846 3300048906 Bacteria 1314
650 Ga0496104_0012446 3300048907 Bacteria 7651
651 Ga0496104_0077845 3300048907 Bacteria 3160
652 Ga0496104_0159226 3300048907 Bacteria 2166
653 Ga0496105_0091564 3300048908 Bacteria 2511
654 Ga0496105_0209619 3300048908 Bacteria 1589
655 Ga0496105_0231407 3300048908 Bacteria 1502
656 Ga0496106_0083615 3300048909 Bacteria 2455
657 Ga0496106_0289400 3300048909 Bacteria 1313
658 Ga0496107_0586689 3300048910 Unclassified 824
659 Ga0496108_0032258 3300048911 Bacteria 4350
660 Ga0496108_0150540 3300048911 Bacteria 2008
661 Ga0496108_0366212 3300048911 Unclassified 1258
662 Ga0496109_0080035 3300048912 Bacteria 3010
663 Ga0496109_0271092 3300048912 Bacteria 1599
664 Ga0496109_0486714 3300048912 Bacteria 1165
665 Ga0496109_1157237 3300048912 Bacteria 710
666 Ga0496110_0059932 3300048913 Bacteria 3356
667 Ga0496110_0097184 3300048913 Bacteria 2639
668 Ga0496110_0495443 3300048913 Bacteria 1113
669 Ga0496110_0588013 3300048913 Bacteria 1010
670 Ga0496111_0204705 3300048914 Bacteria 1466
671 Ga0496111_0561742 3300048914 Unclassified 837
672 Ga0496112_0087521 3300048915 Bacteria 3082
673 Ga0496112_0106562 3300048915 Bacteria 2773
674 Ga0496112_0141497 3300048915 Bacteria 2375
675 Ga0496112_0231179 3300048915 Bacteria 1804
676 Ga0496113_0293322 3300048916 Unclassified 1301
677 Ga0496113_0390608 3300048916 Bacteria 1117
678 Ga0496114_0012996 3300048917 Bacteria 6672
679 Ga0496115_0002575 3300048918 Bacteria 13018
680 Ga0496115_0091504 3300048918 Bacteria 2486
681 Ga0496115_0163516 3300048918 Bacteria 1840
682 Ga0501070_0032156 3300049586 Bacteria 4392
683 nmdc:mga05p37_140290_c1 3300050507 Bacteria 2961
684 nmdc:mga05p37_756752_c1 3300050507 Bacteria 1070
685 nmdc:mga08y16_754113_c1 3300050511 Bacteria 969
686 nmdc:mga0n895_575194_c1 3300050512 Bacteria 1131
687 nmdc:mga0rr50_1124063_c1 3300050513 Bacteria 668
688 nmdc:mga0a205_246320_c1 3300050515 Bacteria 1667
689 nmdc:mga0a205_960814_c1 3300050515 Bacteria 701
690 Ga0495601_0001921 3300053077 Bacteria 11624
691 Ga0495612_0018714 3300053078 Bacteria 2774
692 Ga0500556_0000420 3300053104 Bacteria 30531
693 Ga0500645_138535 3300053730 Bacteria 674
694 Ga0213872_10039082
695 JGI24750J21931_1020039
696 JGI24744J21845_10009043
697 JGI24035J26624_1000379
698 JGI25406J46586_10000007
699 JGI25404J52841_10007266
700 JGI25405J52794_10003510
701 Ga0065714_10088479
702 Ga0065714_10099910
703 Ga0065704_10021737
704 Ga0065704_10048519
705 Ga0065704_10114841
706 Ga0065704_10388336
707 Ga0065712_10001268
708 Ga0065712_10006848
709 Ga0065712_10040837
710 Ga0065712_10070849
711 Ga0065712_10130323
712 Ga0065712_10160189
713 Ga0065715_10005423
714 Ga0065715_10090524
715 Ga0065715_10136006
716 Ga0065715_10159921
717 Ga0065715_10242281
718 Ga0065715_10303848
719 Ga0065715_10513565
720 Ga0065707_10044235
721 Ga0065707_10102203
722 Ga0065707_10211038
723 Ga0065707_10275017
724 Ga0065707_10338897
725 Ga0065707_10375548
726 Ga0070658_10439210
727 Ga0070658_10478336
728 Ga0070676_10108518
729 Ga0070683_100026491
730 Ga0070683_100054847
731 Ga0070683_100055457
732 Ga0070683_100141654
733 Ga0070683_100186778
734 Ga0070690_100052450
735 Ga0070690_100160678
736 Ga0070690_100360111
737 Ga0070670_100000833
738 Ga0070670_100003742
739 Ga0070677_10217628
740 Ga0070666_10001876
741 Ga0070666_10002056
742 Ga0070666_10121884
743 Ga0070680_100026148
744 Ga0068868_100031366
745 Ga0068868_100422261
746 Ga0070660_100023190
747 Ga0070660_100135834
748 Ga0070660_100358417
749 Ga0070689_100014852
750 Ga0070689_100100534
751 Ga0070689_100273588
752 Ga0070687_100000382
753 Ga0070687_100484144
754 Ga0070661_100062340
755 Ga0070661_100292077
756 Ga0070668_100000403
757 Ga0070668_100050196
758 Ga0070668_100050229
759 Ga0070668_100056962
760 Ga0070668_100258296
761 Ga0070668_100486374
762 Ga0070669_100002011
763 Ga0070669_100006097
764 Ga0070669_100033015
765 Ga0070669_100125169
766 Ga0070669_100287406
767 Ga0070675_100004678
768 Ga0070675_100048534
769 Ga0070675_100083047
770 Ga0070675_100129528
771 Ga0070675_100133137
772 Ga0070675_100158863
773 Ga0070675_100218659
774 Ga0070675_100272915
775 Ga0070675_100295769
776 Ga0070671_100000283
777 Ga0070671_100011134
778 Ga0070671_100042031
779 Ga0070671_100054306
780 Ga0070671_100321402
781 Ga0070671_100372527
782 Ga0070674_100013872
783 Ga0070674_100222619
784 Ga0070673_100008141
785 Ga0070673_100014325
786 Ga0070673_100075213
787 Ga0070673_100476403
788 Ga0070673_100714871
789 Ga0070688_100000733
790 Ga0070688_100001414
791 Ga0070688_100016452
792 Ga0070688_100054122
793 Ga0070688_100102629
794 Ga0070688_101044988
795 Ga0070659_100001154
796 Ga0070659_100002483
797 Ga0070667_100004665
798 Ga0070667_100010004
799 Ga0070667_100431930
800 Ga0070709_10120646
801 Ga0070709_10397957
802 Ga0070714_100111441
803 Ga0070714_100235996
804 Ga0070714_100365563
805 Ga0070713_100019600
806 Ga0070713_100040250
807 Ga0070713_100147200
808 Ga0070713_100214091
809 Ga0070710_10048829
810 Ga0070711_100647330
811 Ga0070705_100075673
812 Ga0070705_100541260
813 Ga0070705_100865373
814 Ga0070700_100003660
815 Ga0070708_100003581
816 Ga0070708_100036156
817 Ga0070708_100053105
818 Ga0070708_100054749
819 Ga0070708_100093171
820 Ga0070708_100136047
821 Ga0070708_100615489
822 Ga0070708_100836634
823 Ga0070678_100001511
824 Ga0070678_100043541
825 Ga0070678_100094691
826 Ga0070678_101198599
827 Ga0070662_100004281
828 Ga0070662_100197437
829 Ga0070662_100765557
830 Ga0070681_10052300
831 Ga0070681_10143076
832 Ga0068867_100044767
833 Ga0068867_101619312
834 Ga0070685_10106425
835 Ga0070685_10140714
836 Ga0070706_100000210
837 Ga0070706_100006577
838 Ga0070706_100020444
839 Ga0070706_100020521
840 Ga0070706_100025982
841 Ga0070706_100057582
842 Ga0070706_100071274
843 Ga0070706_100137442
844 Ga0070706_100146613
845 Ga0070706_100382154
846 Ga0070706_100655293
847 Ga0070706_100751826
848 Ga0070707_100003721
849 Ga0070707_100016188
850 Ga0070707_100027361
851 Ga0070707_100030502
852 Ga0070707_100032046
853 Ga0070707_100039193
854 Ga0070707_100063474
855 Ga0070707_100072311
856 Ga0070707_100254090
857 Ga0070707_100320540
858 Ga0070707_100342021
859 Ga0070707_100423982
860 Ga0070707_101422798
861 Ga0070698_100001836
862 Ga0070698_100032196
863 Ga0070698_100354407
864 Ga0070699_100422069
865 Ga0070699_100871109
866 Ga0070699_100949089
867 Ga0070699_100994759
868 Ga0070679_100025856
869 Ga0070679_100054949
870 Ga0070684_100001312
871 Ga0070684_100029216
872 Ga0070684_100529835
873 Ga0070697_100000826
874 Ga0070697_100002201
875 Ga0070697_100002768
876 Ga0070697_100003773
877 Ga0070697_100045125
878 Ga0070697_100121642
879 Ga0070697_100160286
880 Ga0070672_100000353
881 Ga0070672_100004247
882 Ga0070686_100000947
883 Ga0070686_100126507
884 Ga0070686_101163226
885 Ga0070665_100008787
886 Ga0070665_100013901
887 Ga0070665_100234438
888 Ga0070665_100688544
889 Ga0070665_101191386
890 Ga0070704_100029184
891 Ga0068855_100308936
892 Ga0070664_100125926
893 Ga0070664_100182011
894 Ga0070664_100248105
895 Ga0068856_100456081
896 Ga0070702_100292255
897 Ga0068852_100235823
898 Ga0068859_100077354
899 Ga0068864_100111886
900 Ga0068864_100285604
901 Ga0068864_100287593
902 Ga0068864_100388810
903 Ga0068866_10297125
904 Ga0068861_100107874
905 Ga0068861_100158124
906 Ga0068851_10417948
907 Ga0068870_10128838
908 Ga0068863_100007967
909 Ga0068858_100052055
910 Ga0068858_100134565
911 Ga0068858_100142777
912 Ga0068858_100224419
913 Ga0068860_100010603
914 Ga0068860_100066467
915 Ga0068860_100548031
916 Ga0068862_100041432
917 Ga0068862_100569804
918 Ga0081455_10001399
919 Ga0081455_10021886
920 Ga0081455_10031292
921 Ga0081455_10031464
922 Ga0081455_10069224
923 Ga0081455_10144458
924 Ga0081455_10336539
925 Ga0081455_10443827
926 Ga0081538_10015344
927 Ga0081540_1000036
928 Ga0081540_1025675
929 Ga0081540_1065432
930 Ga0081539_10000014
931 Ga0070717_10016944
932 Ga0070717_10028090
933 Ga0070717_10037326
934 Ga0070717_10037361
935 Ga0070717_10077682
936 Ga0070717_10361833
937 Ga0070717_10598047
938 Ga0070715_10059680
939 Ga0070716_100011207
940 Ga0070716_100612155
941 Ga0070712_100046609
942 Ga0070712_100049660
943 Ga0070712_100083926
944 Ga0070712_100239926
945 Ga0097621_100018403
946 Ga0097621_100024099
947 Ga0097621_100682376
948 Ga0068871_100084135
949 Ga0068871_100097542
950 Ga0075428_100095839
951 Ga0075428_100284891
952 Ga0075428_100416748
953 Ga0075434_100200364
954 Ga0075434_100729427
955 Ga0068865_100105971
956 Ga0068865_100149571
957 Ga0068865_100580131
958 Ga0097620_100077352
959 Ga0099795_10057265
960 Ga0099795_10121224
961 Ga0111539_10840106
962 Ga0111539_11088195
963 Ga0105245_10006614
964 Ga0105245_10214619
965 Ga0105245_11957992
966 Ga0105247_10235857
967 Ga0114129_10241662
968 Ga0114129_10662601
969 Ga0114129_10787074
970 Ga0105243_10033332
971 Ga0105243_10331810
972 Ga0105248_10321465
973 Ga0105249_10011097
974 Ga0099796_10011175
975 Ga0099796_10044277
976 Ga0099796_10130751
977 Ga0105239_10070002
978 Ga0105239_10100267
979 Ga0105239_10408038
980 Ga0105239_11229805
981 Ga0105239_11553985
982 Ga0105246_10182706
983 Ga0105246_10438582
984 Ga0157371_10148130
985 Ga0157369_10182471
986 Ga0157369_11002830
987 Ga0157374_10001473
988 Ga0157374_10005577
989 Ga0157374_10033688
990 Ga0157374_10127435
991 Ga0157374_10146746
992 Ga0157374_10431232
993 Ga0157374_10824904
994 Ga0157374_11015180
995 Ga0157378_10043528
996 Ga0157378_10048884
997 Ga0157378_10454673
998 Ga0157378_10459352
999 Ga0157378_10529437
1000 Ga0157378_10554701
1001 Ga0157378_10693380
1002 Ga0157378_10884840
1003 Ga0163162_10003249
1004 Ga0163162_10014121
1005 Ga0163162_10034354
1006 Ga0163162_10052794
1007 Ga0163162_10086566
1008 Ga0163162_10203836
1009 Ga0163162_10224090
1010 Ga0163162_10360602
1011 Ga0163162_11279590
1012 Ga0163162_11461116
1013 Ga0157372_10037163
1014 Ga0157372_10040369
1015 Ga0157372_10285094
1016 Ga0157375_10000287
1017 Ga0157375_10001868
1018 Ga0157375_10007782
1019 Ga0157375_10047258
1020 Ga0157375_10082239
1021 Ga0157375_10505558
1022 Ga0163163_10229332
1023 Ga0163163_10294276
1024 Ga0163163_10522863
1025 Ga0163163_10935678
1026 Ga0163163_11709928
1027 Ga0182008_10063220
1028 Ga0157377_10013826
1029 Ga0157377_10616454
1030 Ga0157379_10005647
1031 Ga0157379_10421858
1032 Ga0157376_10031061
1033 Ga0157376_10349606
1034 Ga0157376_10404419
1035 Ga0157376_10681829
1036 Ga0157376_11504534
1037 Ga0163161_10331771
1038 Ga0207666_1000898
1039 Ga0207673_1005621
1040 Ga0207673_1008168
1041 Ga0207697_10000010
1042 Ga0207697_10000495
1043 Ga0207697_10002230
1044 Ga0207697_10002322
1045 Ga0207697_10013157
1046 Ga0207697_10014592
1047 Ga0207697_10158590
1048 Ga0207653_10037317
1049 Ga0207682_10197335
1050 Ga0207642_10079022
1051 Ga0207642_10140377
1052 Ga0207710_10089084
1053 Ga0207688_10001208
1054 Ga0207680_10003944
1055 Ga0207680_10025390
1056 Ga0207680_10032106
1057 Ga0207647_10102679
1058 Ga0207685_10003968
1059 Ga0207685_10023055
1060 Ga0207699_10008911
1061 Ga0207699_10721478
1062 Ga0207645_10001786
1063 Ga0207645_10002762
1064 Ga0207645_10004432
1065 Ga0207645_10070956
1066 Ga0207645_10125827
1067 Ga0207643_10067066
1068 Ga0207705_10736426
1069 Ga0207684_10000028
1070 Ga0207684_10003766
1071 Ga0207684_10011143
1072 Ga0207684_10030870
1073 Ga0207684_10048446
1074 Ga0207684_10074641
1075 Ga0207684_10108278
1076 Ga0207684_10248195
1077 Ga0207684_10358534
1078 Ga0207684_10800866
1079 Ga0207707_10035549
1080 Ga0207707_10122048
1081 Ga0207693_10006942
1082 Ga0207693_10035010
1083 Ga0207693_10157817
1084 Ga0207693_10339365
1085 Ga0207693_10536047
1086 Ga0207663_10227635
1087 Ga0207663_10528591
1088 Ga0207663_10733154
1089 Ga0207663_10774021
1090 Ga0207660_10087575
1091 Ga0207662_10000699
1092 Ga0207662_10327050
1093 Ga0207657_10130260
1094 Ga0207649_10150356
1095 Ga0207649_10201065
1096 Ga0207649_11138517
1097 Ga0207652_10002941
1098 Ga0207646_10000191
1099 Ga0207646_10005640
1100 Ga0207646_10009621
1101 Ga0207646_10028198
1102 Ga0207646_10065346
1103 Ga0207646_10068226
1104 Ga0207646_10073074
1105 Ga0207646_10085584
1106 Ga0207646_10220871
1107 Ga0207681_10004055
1108 Ga0207681_10014902
1109 Ga0207681_10069483
1110 Ga0207681_10243409
1111 Ga0207681_10327174
1112 Ga0207681_10341640
1113 Ga0207650_10007428
1114 Ga0207650_10018287
1115 Ga0207650_10140098
1116 Ga0207650_10152097
1117 Ga0207650_10694879
1118 Ga0207659_10003512
1119 Ga0207659_10045484
1120 Ga0207659_10049761
1121 Ga0207659_10127832
1122 Ga0207659_10197646
1123 Ga0207659_10950306
1124 Ga0207687_10317409
1125 Ga0207687_10328849
1126 Ga0207700_10022621
1127 Ga0207700_10190450
1128 Ga0207700_10711797
1129 Ga0207664_10120019
1130 Ga0207644_10029826
1131 Ga0207644_10035251
1132 Ga0207644_10092545
1133 Ga0207644_10101578
1134 Ga0207644_10112816
1135 Ga0207644_10187708
1136 Ga0207644_10315666
1137 Ga0207690_10001098
1138 Ga0207706_10008197
1139 Ga0207706_10068933
1140 Ga0207706_10122355
1141 Ga0207706_10127775
1142 Ga0207706_10407331
1143 Ga0207686_10329699
1144 Ga0207670_10003261
1145 Ga0207670_10009200
1146 Ga0207670_10197408
1147 Ga0207669_10002532
1148 Ga0207669_10011026
1149 Ga0207704_10122214
1150 Ga0207704_10133056
1151 Ga0207704_10183501
1152 Ga0207704_10480862
1153 Ga0207665_10026961
1154 Ga0207665_10089858
1155 Ga0207665_10215560
1156 Ga0207665_10863126
1157 Ga0207691_10000142
1158 Ga0207691_10016028
1159 Ga0207661_10031201
1160 Ga0207661_10077884
1161 Ga0207661_10124065
1162 Ga0207651_10007253
1163 Ga0207651_10027669
1164 Ga0207651_10197170
1165 Ga0207651_10523905
1166 Ga0207651_11466521
1167 Ga0207712_10010310
1168 Ga0207712_10328930
1169 Ga0207668_10009836
1170 Ga0207668_10026495
1171 Ga0207668_10042584
1172 Ga0207668_10052709
1173 Ga0207668_10057405
1174 Ga0207658_10010242
1175 Ga0207658_10014736
1176 Ga0207658_10046961
1177 Ga0207658_10531464
1178 Ga0207677_10008042
1179 Ga0207677_10020703
1180 Ga0207677_10111866
1181 Ga0207677_10353684
1182 Ga0207677_10550604
1183 Ga0207703_10003624
1184 Ga0207703_10142997
1185 Ga0207678_10020455
1186 Ga0207708_10137900
1187 Ga0207702_10495612
1188 Ga0207641_10022387
1189 Ga0207641_10147740
1190 Ga0207641_10976760
1191 Ga0207648_10096569
1192 Ga0207648_10567325
1193 Ga0207648_11364095
1194 Ga0207676_10474000
1195 Ga0207675_100165775
1196 Ga0207675_100247761
1197 Ga0207683_10009866
1198 Ga0207683_10015583
1199 Ga0209974_10023640
1200 Ga0209974_10165923
1201 Ga0268266_10004179
1202 Ga0268266_10026994
1203 Ga0268266_10076422
1204 Ga0268266_10317605
1205 Ga0268266_10777928
1206 Ga0268265_10044999
1207 Ga0268264_10149965
1208 Ga0268264_11358084
1209 Ga0316579_10204478
1210 Ga0316576_10006114
1211 Ga0316576_10426975
1212 Ga0316576_10564928
1213 Ga0316578_10039603
1214 Ga0316578_10255570
1215 Ga0307405_10031553
1216 Ga0316577_10124221
1217 Ga0307413_10044877
1218 Ga0307406_10222244
1219 Ga0307412_10109719
1220 Ga0307416_100110301
1221 Ga0307414_10239387
1222 Ga0307415_100047308
1223 Ga0316593_10000330
1224 Ga0316592_1035195
1225 Ga0316592_1038517
1226 Ga0316592_1048811
1227 Ga0373926_0077902
1228 Ga0373934_0070168
1229 Ga0373923_0090520
1230 Ga0373945_0005962
1231 Ga0373954_0021155
1232 Ga0373956_0140869
1233 Ga0373957_0174002
1234 Ga0373943_0080926
1235 Ga0373943_0094871
1236 Ga0373943_0439017
1237 Ga0373955_0081803
1238 Ga0373955_0207250
1239 Ga0373942_0113873
1240 Ga0373961_0242836
1241 Ga0316574_0012891
1242 Ga0373931_0108890
1243 Ga0373931_0140827
1244 Ga0373935_0031757
1245 Ga0373935_0172545
1246 Ga0373935_0314802
1247 Ga0373927_0200198
1248 Ga0373933_0286725
1249 Ga0373947_0307534
1250 Ga0373947_0394809
1251 Ga0373937_0114836
1252 Ga0316582_0001483
1253 Ga0316582_0010838
1254 Ga0316582_0177857
1255 Ga0316584_0003646
1256 Ga0316584_0137273
1257 Ga0316584_0240135
1258 Ga0316584_0296054
1259 Ga0316584_0328763
1260 Ga0373925_0006124
1261 Ga0373925_0040917
1262 Ga0373925_0417832
1263 Ga0373925_1416552
1264 Ga0395899_0081216
1265 Ga0395900_0008031
1266 Ga0395900_0232346
1267 Ga0395900_0295735
1268 Ga0395900_0763401
1269 Ga0395900_1133811
1270 Ga0395898_0002044
1271 Ga0395898_0295593
1272 Ga0395905_0023999
1273 Ga0395901_0002964
1274 Ga0395901_0145221
1275 Ga0395901_0280015
1276 Ga0395901_0420237
1277 Ga0436360_0163442
1278 Ga0436360_0355471
1279 Ga0436360_1158035
1280 Ga0436361_0454935
1281 Ga0436361_0953841
1282 Ga0436362_1027100
1283 Ga0451798_0913297
1284 Ga0451802_0462827
1285 Ga0439451_017252
1286 Ga0439458_0022657
1287 Ga0439464_0019868
1288 Ga0439460_0109353
1289 Ga0439440_0084970
1290 Ga0466964_0028831
1291 Ga0451576_0230708
1292 Ga0466967_0032556
1293 Ga0495592_0013560
1294 Ga0495603_0055534
1295 Ga0495629_0008333
1296 Ga0495629_0229258
1297 Ga0495651_0219859
1298 Ga0495653_0108033
1299 Ga0495580_0107757
1300 Ga0495580_0165118
1301 Ga0495580_0319707
1302 Ga0495580_0331652
1303 Ga0495582_0336771
1304 Ga0495639_0340575
1305 Ga0495662_0069387
1306 Ga0495664_0202283
1307 Ga0495608_0207889
1308 Ga0495618_0158160
1309 Ga0495628_0208490
1310 Ga0495630_0041206
1311 Ga0495652_0045601
1312 Ga0495665_0043688
1313 Ga0495587_0009500
1314 Ga0495598_0048134
1315 Ga0495645_0001076
1316 Ga0495657_0394064
1317 Ga0495599_0000317
1318 Ga0495623_0000811
1319 Ga0495646_0002940
1320 Ga0495647_0028223
1321 Ga0495647_0067886
1322 Ga0495658_0011003
1323 Ga0495658_0129662
1324 Ga0495669_0142072
1325 Ga0495624_0370370
1326 Ga0495670_0316224
1327 Ga0495600_0692218
1328 Ga0495581_0106207
1329 Ga0495604_0053697
1330 Ga0495604_0515141
1331 Ga0495674_0047362
1332 Ga0495674_0078592
1333 Ga0495680_0293762
1334 Ga0495675_0010133
1335 Ga0495677_0071890
1336 Ga0495684_0063571
1337 Ga0495593_0125575
1338 Ga0496100_0312269
1339 Ga0496101_0108830
1340 Ga0496102_0028763
1341 Ga0496103_0098168
1342 Ga0496103_0191846
1343 Ga0496104_0012446
1344 Ga0496104_0077845
1345 Ga0496104_0159226
1346 Ga0496105_0091564
1347 Ga0496105_0209619
1348 Ga0496105_0231407
1349 Ga0496106_0083615
1350 Ga0496106_0289400
1351 Ga0496107_0586689
1352 Ga0496108_0032258
1353 Ga0496108_0150540
1354 Ga0496108_0366212
1355 Ga0496109_0080035
1356 Ga0496109_0271092
1357 Ga0496109_0486714
1358 Ga0496109_1157237
1359 Ga0496110_0059932
1360 Ga0496110_0097184
1361 Ga0496110_0495443
1362 Ga0496110_0588013
1363 Ga0496111_0204705
1364 Ga0496111_0561742
1365 Ga0496112_0087521
1366 Ga0496112_0106562
1367 Ga0496112_0141497
1368 Ga0496112_0231179
1369 Ga0496113_0293322
1370 Ga0496113_0390608
1371 Ga0496114_0012996
1372 Ga0496115_0002575
1373 Ga0496115_0091504
1374 Ga0496115_0163516
1375 Ga0501070_0032156
1376 nmdc:mga05p37_140290_c1
1377 nmdc:mga05p37_756752_c1
1378 nmdc:mga08y16_754113_c1
1379 nmdc:mga0n895_575194_c1
1380 nmdc:mga0rr50_1124063_c1
1381 nmdc:mga0a205_246320_c1
1382 nmdc:mga0a205_960814_c1
1383 Ga0495601_0001921
1384 Ga0495612_0018714
1385 Ga0500556_0000420
1386 Ga0500645_138535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00347

Ribosomal_L6

Ribosomal protein L6

11

82

0.97

PF00347

Ribosomal_L6

Ribosomal protein L6

90

165

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fn2-assembly1.cif.gz_H the structure of a 50s ribosomal subunit in the lyme disease pathogen borreliella burgdorferi 0.9326 1 176
5x8t-assembly1.cif.gz_G structure of the 50s large subunit of chloroplast ribosome from spinach 0.9254 3 175
5li0-assembly1.cif.gz_H 70s ribosome from staphylococcus aureus 0.9237 9 172
5mmi-assembly1.cif.gz_G structure of the large subunit of the chloroplast ribosome 0.9231 2 176
6yef-assembly1.cif.gz_H 70s initiation complex with assigned rrna modifications from staphylococcus aureus 0.9213 9 170
ID Description Score Start End Superfamily
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.949 1 83 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9389 2 83 3.90.930.12
af_Q2FW21_1_82_3.90.930.12 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.938 1 83 3.90.930.12
5x8tG01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.9335 3 83 3.90.930.12
4qcxH01 Alpha Beta;Alpha-Beta Complex;Outer Surface Protein A; domain 3;Ribosomal protein L6 0.928 2 83 3.90.930.12
ID Description Score Start End GO Terms
AF-A0A6L8JMJ7-F1-model_v4 deleted 0.9794 1 81
AF-A0A1Q7FMA3-F1-model_v4 50S ribosomal protein L6 0.9786 1 136 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A381XPD8-F1-model_v4 Large ribosomal subunit protein uL6 alpha-beta domain-containing protein 0.9759 1 99 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A1F7MU57-F1-model_v4 50S ribosomal protein L6 0.9746 1 84 GO:0002181
GO:0003735
GO:0019843
GO:0022625
AF-A0A2E3ZMF9-F1-model_v4 50S ribosomal protein L6 0.971 1 144 GO:0002181
GO:0003735
GO:0005840
GO:0019843
GO:1990904

Map