F475598

General Info

Members Datasets Scaffolds Average Seq Length
692 285 1384 134

Family's Representative Sequence

Representative Sequence 3300044673|Ga0453683_0408982|Ga0453683_0408982_109_591
Length 160
Sequence MAARLRRDPSAFSSVTAPDGNESRRNDMKRTTPAENKALVLEAFDTLFNKRDYIVAERYWSPNYIQHSAHIEPGREGLFTLIKSIPPTLKYEPGLIVAEGEFVIVHGRFSGHGPPKNWIAADIVRIVDGMLAEHWDVIEDEASRTESKSGRPMFGADFSE

Samples

Sample ID Description Type Environment
1 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
265 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
266 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
267 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
268 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
269 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
280 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
281 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
284 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
285 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.14
Isolates 0.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0.14
Rhizoplane 3.9
Rhizosphere 88.44
Stem 0
Stem Tuber 0
Unclassified 7.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453683_0408982 3300044673 Bacteria 875
2 CNBas_1000065 3300000531 Bacteria 2895
3 JGI24737J22298_10047665 3300001990 Bacteria 1306
4 Ga0065712_10004223 3300005290 Archaea 3701
5 Ga0065712_10132666 3300005290 Bacteria 1531
6 Ga0065712_10132756 3300005290 Bacteria 1530
7 Ga0065712_10243949 3300005290 Bacteria 977
8 Ga0065715_10033703 3300005293 Bacteria 1285
9 Ga0065715_10108923 3300005293 Bacteria 2694
10 Ga0065715_10188362 3300005293 Bacteria 1431
11 Ga0065715_10270259 3300005293 Unclassified 1113
12 Ga0065707_10011731 3300005295 Bacteria 2486
13 Ga0065707_10032665 3300005295 Bacteria 842
14 Ga0065707_10035348 3300005295 Bacteria 791
15 Ga0065707_10044750 3300005295 Bacteria 779
16 Ga0065707_10110546 3300005295 Unclassified 2426
17 Ga0065707_10551620 3300005295 Unclassified 719
18 Ga0070676_10010210 3300005328 Bacteria 5091
19 Ga0070676_10021469 3300005328 Bacteria 3615
20 Ga0070690_100046718 3300005330 Bacteria 2753
21 Ga0070690_100857667 3300005330 Bacteria 708
22 Ga0070677_10154698 3300005333 Bacteria 1070
23 Ga0068869_100004822 3300005334 Bacteria 8424
24 Ga0068869_100212523 3300005334 Bacteria 1530
25 Ga0068869_100311740 3300005334 Bacteria 1274
26 Ga0070666_10008382 3300005335 Bacteria 6415
27 Ga0070666_10711347 3300005335 Bacteria 737
28 Ga0070680_100117760 3300005336 Archaea 2215
29 Ga0070682_101718695 3300005337 Bacteria 545
30 Ga0068868_100017698 3300005338 Bacteria 5314
31 Ga0070687_100913770 3300005343 Archaea 630
32 Ga0070668_100114320 3300005347 Bacteria 2151
33 Ga0070668_100467946 3300005347 Bacteria 1087
34 Ga0070669_100108483 3300005353 Bacteria 2104
35 Ga0070669_100131948 3300005353 Bacteria 1917
36 Ga0070675_100051494 3300005354 Bacteria 3383
37 Ga0070675_100074986 3300005354 Bacteria 2811
38 Ga0070671_100033866 3300005355 Bacteria 4227
39 Ga0070671_100069498 3300005355 Bacteria 2938
40 Ga0070671_100123408 3300005355 Bacteria 2180
41 Ga0070674_100015136 3300005356 Bacteria 4809
42 Ga0070673_100041120 3300005364 Bacteria 3551
43 Ga0070673_100103319 3300005364 Bacteria 2351
44 Ga0070673_100822016 3300005364 Bacteria 859
45 Ga0070667_100005947 3300005367 Bacteria 10151
46 Ga0070667_100020755 3300005367 Bacteria 5456
47 Ga0070667_100157309 3300005367 Bacteria 2000
48 Ga0070667_100198683 3300005367 Bacteria 1779
49 Ga0070703_10265783 3300005406 Bacteria 702
50 Ga0070709_10646116 3300005434 Bacteria 818
51 Ga0070709_10861166 3300005434 Bacteria 714
52 Ga0070714_100593327 3300005435 Bacteria 1063
53 Ga0070714_100785489 3300005435 Unclassified 922
54 Ga0070714_100926518 3300005435 Unclassified 846
55 Ga0070714_101426979 3300005435 Bacteria 676
56 Ga0070713_100296567 3300005436 Bacteria 1487
57 Ga0070713_100439664 3300005436 Unclassified 1223
58 Ga0070713_101451742 3300005436 Bacteria 665
59 Ga0070710_10089905 3300005437 Bacteria 1809
60 Ga0070710_10300552 3300005437 Bacteria 1047
61 Ga0070710_10413709 3300005437 Bacteria 906
62 Ga0070711_100039205 3300005439 Bacteria 3189
63 Ga0070711_100098295 3300005439 Bacteria 2125
64 Ga0070711_100175561 3300005439 Bacteria 1636
65 Ga0070711_100235095 3300005439 Bacteria 1430
66 Ga0070711_100267932 3300005439 Bacteria 1347
67 Ga0070711_101229133 3300005439 Bacteria 649
68 Ga0070705_100436590 3300005440 Bacteria 979
69 Ga0070705_100541208 3300005440 Bacteria 891
70 Ga0070705_100728736 3300005440 Bacteria 782
71 Ga0070705_100882830 3300005440 Archaea 718
72 Ga0070700_100343038 3300005441 Bacteria 1105
73 Ga0070694_100069984 3300005444 Bacteria 2415
74 Ga0070694_100182623 3300005444 Bacteria 1552
75 Ga0070694_100533553 3300005444 Bacteria 938
76 Ga0070708_100040197 3300005445 Bacteria 4095
77 Ga0070708_100099100 3300005445 Bacteria 2665
78 Ga0070708_100136778 3300005445 Bacteria 2270
79 Ga0070708_100153643 3300005445 Unclassified 2141
80 Ga0070708_100250049 3300005445 Bacteria 1665
81 Ga0070708_100374517 3300005445 Bacteria 1342
82 Ga0070708_100408363 3300005445 Bacteria 1281
83 Ga0070708_100482383 3300005445 Bacteria 1170
84 Ga0070708_100657282 3300005445 Bacteria 987
85 Ga0070708_100904643 3300005445 Bacteria 828
86 Ga0070708_101070297 3300005445 Bacteria 755
87 Ga0070708_101313128 3300005445 Bacteria 676
88 Ga0070708_101627435 3300005445 Bacteria 601
89 Ga0070678_100001335 3300005456 Bacteria 13117
90 Ga0070662_100004462 3300005457 Bacteria 8857
91 Ga0070662_100033403 3300005457 Bacteria 3622
92 Ga0070681_10034009 3300005458 Archaea 5119
93 Ga0070706_100063198 3300005467 Bacteria 3421
94 Ga0070706_100084778 3300005467 Bacteria 2935
95 Ga0070706_100130955 3300005467 Bacteria 2341
96 Ga0070706_100152057 3300005467 Bacteria 2160
97 Ga0070706_100189777 3300005467 Bacteria 1920
98 Ga0070706_100248752 3300005467 Bacteria 1660
99 Ga0070706_100332547 3300005467 Bacteria 1417
100 Ga0070706_100590436 3300005467 Bacteria 1032
101 Ga0070707_100054010 3300005468 Bacteria 3851
102 Ga0070707_100058443 3300005468 Bacteria 3698
103 Ga0070707_100069375 3300005468 Bacteria 3394
104 Ga0070707_100090569 3300005468 Bacteria 2960
105 Ga0070707_100096502 3300005468 Bacteria 2863
106 Ga0070707_100208627 3300005468 Unclassified 1904
107 Ga0070707_100227002 3300005468 Bacteria 1818
108 Ga0070707_100254831 3300005468 Bacteria 1708
109 Ga0070707_100622777 3300005468 Bacteria 1042
110 Ga0070707_100681331 3300005468 Bacteria 991
111 Ga0070707_101103176 3300005468 Bacteria 759
112 Ga0070707_101231396 3300005468 Bacteria 715
113 Ga0070707_101459189 3300005468 Bacteria 651
114 Ga0070698_100033017 3300005471 Bacteria 5361
115 Ga0070698_100098798 3300005471 Bacteria 2892
116 Ga0070698_100297309 3300005471 Bacteria 1545
117 Ga0070698_100444667 3300005471 Bacteria 1232
118 Ga0070698_100593618 3300005471 Bacteria 1048
119 Ga0070698_101861640 3300005471 Unclassified 554
120 Ga0070698_101905037 3300005471 Unclassified 547
121 Ga0070699_100038630 3300005518 Bacteria 4133
122 Ga0070699_100069245 3300005518 Bacteria 3066
123 Ga0070699_100091659 3300005518 Bacteria 2657
124 Ga0070699_100098286 3300005518 Bacteria 2564
125 Ga0070699_100379247 3300005518 Bacteria 1276
126 Ga0070699_100437755 3300005518 Bacteria 1185
127 Ga0070699_100736253 3300005518 Bacteria 901
128 Ga0070699_100964182 3300005518 Bacteria 782
129 Ga0070699_101712278 3300005518 Unclassified 576
130 Ga0070699_101960037 3300005518 Bacteria 535
131 Ga0070697_100018466 3300005536 Bacteria 5499
132 Ga0070697_100074035 3300005536 Bacteria 2797
133 Ga0070697_100076752 3300005536 Bacteria 2747
134 Ga0070697_100137952 3300005536 Bacteria 2049
135 Ga0070697_100158628 3300005536 Bacteria 1911
136 Ga0070697_100316470 3300005536 Unclassified 1343
137 Ga0070697_100437889 3300005536 Bacteria 1137
138 Ga0070697_100485266 3300005536 Bacteria 1079
139 Ga0070697_100534213 3300005536 Bacteria 1027
140 Ga0070697_100555908 3300005536 Bacteria 1006
141 Ga0070697_100913959 3300005536 Bacteria 779
142 Ga0070697_101047649 3300005536 Bacteria 725
143 Ga0070697_101139612 3300005536 Bacteria 694
144 Ga0070697_101361338 3300005536 Bacteria 633
145 Ga0068853_100150614 3300005539 Bacteria 2094
146 Ga0070672_100180276 3300005543 Bacteria 1760
147 Ga0070672_100543349 3300005543 Bacteria 1008
148 Ga0070686_100640906 3300005544 Bacteria 841
149 Ga0070695_100168115 3300005545 Bacteria 1545
150 Ga0070695_100332005 3300005545 Bacteria 1134
151 Ga0070695_101773083 3300005545 Bacteria 518
152 Ga0070696_100107006 3300005546 Archaea 2011
153 Ga0070696_100186235 3300005546 Unclassified 1543
154 Ga0070696_100235310 3300005546 Bacteria 1379
155 Ga0070696_100263921 3300005546 Bacteria 1307
156 Ga0070696_100760564 3300005546 Bacteria 794
157 Ga0070696_100934830 3300005546 Bacteria 721
158 Ga0070693_100345384 3300005547 Archaea 1017
159 Ga0070665_100027364 3300005548 Bacteria 5744
160 Ga0070665_100073809 3300005548 Bacteria 3417
161 Ga0070665_100506091 3300005548 Bacteria 1219
162 Ga0070704_100443083 3300005549 Bacteria 1117
163 Ga0068855_100204684 3300005563 Bacteria 2221
164 Ga0068855_101037604 3300005563 Bacteria 860
165 Ga0070664_101043033 3300005564 Bacteria 769
166 Ga0068857_100012898 3300005577 Bacteria 7282
167 Ga0068854_100138730 3300005578 Bacteria 1863
168 Ga0068856_100131872 3300005614 Bacteria 2504
169 Ga0070702_100010724 3300005615 Archaea 4527
170 Ga0068852_100092138 3300005616 Bacteria 2713
171 Ga0068852_101113777 3300005616 Bacteria 810
172 Ga0068859_100047636 3300005617 Bacteria 4307
173 Ga0068859_100602447 3300005617 Bacteria 1192
174 Ga0068864_101353302 3300005618 Bacteria 713
175 Ga0068861_101844369 3300005719 Bacteria 601
176 Ga0068863_100000799 3300005841 Bacteria 31630
177 Ga0068863_100385426 3300005841 Bacteria 1369
178 Ga0068858_100105021 3300005842 Bacteria 2636
179 Ga0068858_101325328 3300005842 Bacteria 709
180 Ga0068860_100006111 3300005843 Bacteria 12111
181 Ga0068860_100690402 3300005843 Bacteria 1030
182 Ga0068860_100755522 3300005843 Bacteria 984
183 Ga0068860_101106731 3300005843 Bacteria 811
184 Ga0068862_100527791 3300005844 Bacteria 1124
185 Ga0068862_100571591 3300005844 Bacteria 1082
186 Ga0081455_10002865 3300005937 Bacteria 20315
187 Ga0070717_10025951 3300006028 Bacteria 4670
188 Ga0070717_10157368 3300006028 Bacteria 1969
189 Ga0070717_10174600 3300006028 Bacteria 1870
190 Ga0075368_10122441 3300006042 Bacteria 1078
191 Ga0075363_100199664 3300006048 Bacteria 1142
192 Ga0075364_10067119 3300006051 Bacteria 2357
193 Ga0070716_100144121 3300006173 Bacteria 1523
194 Ga0070716_100232390 3300006173 Bacteria 1246
195 Ga0070716_100246074 3300006173 Unclassified 1215
196 Ga0070716_100474208 3300006173 Unclassified 917
197 Ga0070716_100496179 3300006173 Bacteria 899
198 Ga0070712_100007180 3300006175 Bacteria 6945
199 Ga0070712_100142604 3300006175 Bacteria 1830
200 Ga0070712_100161707 3300006175 Bacteria 1729
201 Ga0070712_100300692 3300006175 Bacteria 1299
202 Ga0070712_100368081 3300006175 Bacteria 1180
203 Ga0070712_100703736 3300006175 Bacteria 861
204 Ga0075362_10010589 3300006177 Bacteria 3606
205 Ga0075367_10039972 3300006178 Bacteria 2737
206 Ga0075369_10226284 3300006186 Unclassified 866
207 Ga0075369_10330419 3300006186 Unclassified 714
208 Ga0075366_10078887 3300006195 Bacteria 1965
209 Ga0075366_10378363 3300006195 Bacteria 870
210 Ga0097621_100219409 3300006237 Bacteria 1656
211 Ga0075428_100515858 3300006844 Bacteria 1278
212 Ga0075430_100374254 3300006846 Bacteria 1176
213 Ga0075431_100136045 3300006847 Bacteria 2533
214 Ga0075433_10006173 3300006852 Bacteria 9450
215 Ga0075433_10277038 3300006852 Bacteria 1486
216 Ga0075433_10392539 3300006852 Bacteria 1225
217 Ga0075433_10470337 3300006852 Bacteria 1107
218 Ga0075433_11576129 3300006852 Unclassified 567
219 Ga0075434_100019816 3300006871 Bacteria 6513
220 Ga0075434_100068985 3300006871 Bacteria 3524
221 Ga0075434_100182829 3300006871 Bacteria 2117
222 Ga0075434_100247161 3300006871 Bacteria 1803
223 Ga0075434_100426854 3300006871 Bacteria 1347
224 Ga0075434_100973696 3300006871 Bacteria 862
225 Ga0075434_100988691 3300006871 Bacteria 855
226 Ga0075434_101071162 3300006871 Bacteria 820
227 Ga0075429_100212299 3300006880 Bacteria 1696
228 Ga0075429_100439117 3300006880 Bacteria 1144
229 Ga0068865_100112178 3300006881 Bacteria 2013
230 Ga0068865_100316878 3300006881 Bacteria 1253
231 Ga0075436_100022968 3300006914 Bacteria 4285
232 Ga0075436_100055180 3300006914 Bacteria 2743
233 Ga0075436_100079533 3300006914 Bacteria 2271
234 Ga0075436_100083332 3300006914 Bacteria 2219
235 Ga0075436_100415969 3300006914 Bacteria 976
236 Ga0075436_100728281 3300006914 Unclassified 736
237 Ga0075436_100992118 3300006914 Unclassified 630
238 Ga0097620_100047636 3300006931 Bacteria 4307
239 Ga0097620_100602393 3300006931 Bacteria 1192
240 Ga0075435_100005258 3300007076 Bacteria 9011
241 Ga0075435_100111761 3300007076 Bacteria 2273
242 Ga0075435_100189990 3300007076 Bacteria 1738
243 Ga0075435_100239829 3300007076 Bacteria 1542
244 Ga0075435_100656728 3300007076 Bacteria 910
245 Ga0075435_100720974 3300007076 Bacteria 867
246 Ga0099794_10001943 3300007265 Bacteria 7443
247 Ga0099794_10006059 3300007265 Bacteria 4884
248 Ga0099794_10034723 3300007265 Bacteria 2377
249 Ga0099794_10096648 3300007265 Bacteria 1471
250 Ga0099794_10270671 3300007265 Bacteria 877
251 Ga0099794_10310551 3300007265 Bacteria 817
252 Ga0099794_10372343 3300007265 Bacteria 744
253 Ga0099794_10384692 3300007265 Bacteria 732
254 Ga0099795_10000131 3300007788 Bacteria 12603
255 Ga0099795_10059506 3300007788 Bacteria 1414
256 Ga0099795_10137665 3300007788 Bacteria 990
257 Ga0105240_10020314 3300009093 Bacteria 8863
258 Ga0111539_10493434 3300009094 Bacteria 1426
259 Ga0111539_10728926 3300009094 Bacteria 1154
260 Ga0111539_11655308 3300009094 Bacteria 742
261 Ga0111539_12342179 3300009094 Unclassified 620
262 Ga0105245_10199633 3300009098 Bacteria 1920
263 Ga0105245_10891051 3300009098 Unclassified 931
264 Ga0105245_11638581 3300009098 Unclassified 695
265 Ga0114129_10030709 3300009147 Bacteria 7599
266 Ga0114129_10142169 3300009147 Bacteria 3288
267 Ga0114129_10338650 3300009147 Unclassified 1996
268 Ga0114129_10662991 3300009147 Bacteria 1345
269 Ga0114129_10819248 3300009147 Bacteria 1186
270 Ga0114129_11303680 3300009147 Bacteria 900
271 Ga0114129_11371002 3300009147 Unclassified 874
272 Ga0105243_10474170 3300009148 Bacteria 1180
273 Ga0105242_10176758 3300009176 Bacteria 1880
274 Ga0105242_10218205 3300009176 Bacteria 1703
275 Ga0105248_10011422 3300009177 Bacteria 9786
276 Ga0105248_10179804 3300009177 Bacteria 2384
277 Ga0105248_12235527 3300009177 Bacteria 622
278 Ga0105248_12518594 3300009177 Bacteria 586
279 Ga0105237_10020735 3300009545 Bacteria 6770
280 Ga0105237_10043429 3300009545 Bacteria 4527
281 Ga0105238_10005544 3300009551 Bacteria 12464
282 Ga0105249_10179232 3300009553 Bacteria 2060
283 Ga0105249_10352688 3300009553 Bacteria 1491
284 Ga0105249_10675753 3300009553 Bacteria 1091
285 Ga0105249_11145641 3300009553 Unclassified 848
286 Ga0105249_12624301 3300009553 Bacteria 576
287 Ga0099796_10016941 3300010159 Bacteria 2161
288 Ga0099796_10018733 3300010159 Bacteria 2085
289 Ga0099796_10022399 3300010159 Bacteria 1959
290 Ga0099796_10077758 3300010159 Bacteria 1211
291 Ga0099796_10154713 3300010159 Unclassified 905
292 Ga0099796_10401782 3300010159 Bacteria 601
293 Ga0105239_10060087 3300010375 Bacteria 4171
294 Ga0105239_10776248 3300010375 Bacteria 1097
295 Ga0105239_11036627 3300010375 Bacteria 944
296 Ga0105246_10181716 3300011119 Bacteria 1620
297 Ga0105246_11082427 3300011119 Bacteria 731
298 Ga0157373_10064624 3300013100 Bacteria 2590
299 Ga0157371_10087113 3300013102 Bacteria 2212
300 Ga0157374_10029466 3300013296 Bacteria 4971
301 Ga0157374_10041870 3300013296 Bacteria 4223
302 Ga0157374_10088277 3300013296 Bacteria 2953
303 Ga0157374_10252688 3300013296 Bacteria 1735
304 Ga0157378_10043363 3300013297 Bacteria 3994
305 Ga0157378_10122891 3300013297 Bacteria 2395
306 Ga0157378_10229901 3300013297 Bacteria 1767
307 Ga0157378_10363240 3300013297 Bacteria 1417
308 Ga0163162_10059063 3300013306 Bacteria 3866
309 Ga0163162_10152242 3300013306 Bacteria 2431
310 Ga0163162_10746574 3300013306 Bacteria 1098
311 Ga0157372_10210406 3300013307 Bacteria 2254
312 Ga0157372_12590456 3300013307 Bacteria 582
313 Ga0157375_10197248 3300013308 Bacteria 2168
314 Ga0157375_10374459 3300013308 Unclassified 1590
315 Ga0157375_10762236 3300013308 Bacteria 1118
316 Ga0157375_11164608 3300013308 Bacteria 904
317 Ga0157375_11424307 3300013308 Bacteria 817
318 Ga0163163_10523876 3300014325 Bacteria 1248
319 Ga0163163_11344733 3300014325 Bacteria 776
320 Ga0157380_10232344 3300014326 Bacteria 1657
321 Ga0157380_11919175 3300014326 Unclassified 653
322 Ga0157377_10554053 3300014745 Bacteria 813
323 Ga0157379_10258723 3300014968 Unclassified 1581
324 Ga0157376_12010467 3300014969 Bacteria 616
325 Ga0213872_10066360 3300021361 Bacteria 1629
326 Ga0209130_1044050 3300025284 Bacteria 846
327 Ga0207673_1008451 3300025290 Bacteria 1304
328 Ga0207697_10057253 3300025315 Bacteria 1618
329 Ga0207653_10030363 3300025885 Bacteria 1744
330 Ga0207692_10065883 3300025898 Bacteria 1892
331 Ga0207692_10081863 3300025898 Bacteria 1728
332 Ga0207692_10148392 3300025898 Bacteria 1340
333 Ga0207692_10273602 3300025898 Bacteria 1019
334 Ga0207688_10030638 3300025901 Bacteria 2967
335 Ga0207680_10006755 3300025903 Bacteria 5568
336 Ga0207680_11071867 3300025903 Bacteria 576
337 Ga0207685_10326870 3300025905 Bacteria 766
338 Ga0207699_10089691 3300025906 Bacteria 1928
339 Ga0207645_10014336 3300025907 Bacteria 5307
340 Ga0207645_10041894 3300025907 Bacteria 2930
341 Ga0207684_10022970 3300025910 Bacteria 5327
342 Ga0207684_10093547 3300025910 Bacteria 2563
343 Ga0207684_10128764 3300025910 Bacteria 2173
344 Ga0207684_10133322 3300025910 Bacteria 2132
345 Ga0207684_10140037 3300025910 Bacteria 2079
346 Ga0207684_10149630 3300025910 Bacteria 2008
347 Ga0207684_10178565 3300025910 Bacteria 1831
348 Ga0207684_10319554 3300025910 Bacteria 1338
349 Ga0207684_10404358 3300025910 Bacteria 1174
350 Ga0207684_10784303 3300025910 Unclassified 806
351 Ga0207684_10910085 3300025910 Bacteria 739
352 Ga0207707_10033353 3300025912 Archaea 4506
353 Ga0207671_10012010 3300025914 Bacteria 6998
354 Ga0207671_10046227 3300025914 Bacteria 3220
355 Ga0207693_10001390 3300025915 Bacteria 21455
356 Ga0207693_10072841 3300025915 Bacteria 2689
357 Ga0207693_10123123 3300025915 Bacteria 2037
358 Ga0207693_10329259 3300025915 Bacteria 1196
359 Ga0207693_10490367 3300025915 Bacteria 959
360 Ga0207693_10539268 3300025915 Bacteria 910
361 Ga0207693_10651241 3300025915 Bacteria 818
362 Ga0207663_10001325 3300025916 Bacteria 11448
363 Ga0207663_10089003 3300025916 Bacteria 2043
364 Ga0207663_10176994 3300025916 Bacteria 1520
365 Ga0207663_10338217 3300025916 Bacteria 1136
366 Ga0207663_10430266 3300025916 Bacteria 1014
367 Ga0207663_10544885 3300025916 Bacteria 906
368 Ga0207663_10793581 3300025916 Bacteria 754
369 Ga0207662_10185493 3300025918 Archaea 1340
370 Ga0207657_10339263 3300025919 Bacteria 1186
371 Ga0207646_10010524 3300025922 Bacteria 9027
372 Ga0207646_10020368 3300025922 Bacteria 6148
373 Ga0207646_10053747 3300025922 Bacteria 3602
374 Ga0207646_10063569 3300025922 Bacteria 3295
375 Ga0207646_10064388 3300025922 Bacteria 3272
376 Ga0207646_10078868 3300025922 Bacteria 2944
377 Ga0207646_10083352 3300025922 Bacteria 2860
378 Ga0207646_10219376 3300025922 Bacteria 1718
379 Ga0207646_10486622 3300025922 Bacteria 1112
380 Ga0207646_10881530 3300025922 Bacteria 794
381 Ga0207646_11243055 3300025922 Bacteria 652
382 Ga0207681_10019679 3300025923 Bacteria 4269
383 Ga0207681_10047999 3300025923 Bacteria 2880
384 Ga0207694_10026233 3300025924 Bacteria 4431
385 Ga0207659_10213414 3300025926 Bacteria 1548
386 Ga0207659_10882820 3300025926 Bacteria 769
387 Ga0207687_10529875 3300025927 Unclassified 986
388 Ga0207700_10211303 3300025928 Bacteria 1640
389 Ga0207700_10384136 3300025928 Bacteria 1228
390 Ga0207700_10608386 3300025928 Bacteria 973
391 Ga0207700_11199276 3300025928 Bacteria 678
392 Ga0207664_10729540 3300025929 Bacteria 891
393 Ga0207664_11377447 3300025929 Bacteria 626
394 Ga0207644_10159550 3300025931 Bacteria 1752
395 Ga0207644_10205636 3300025931 Bacteria 1554
396 Ga0207644_10211956 3300025931 Bacteria 1532
397 Ga0207644_10541638 3300025931 Bacteria 963
398 Ga0207706_10003019 3300025933 Bacteria 16227
399 Ga0207706_10011988 3300025933 Bacteria 7897
400 Ga0207686_10280562 3300025934 Bacteria 1230
401 Ga0207669_10829019 3300025937 Bacteria 769
402 Ga0207704_10163168 3300025938 Bacteria 1588
403 Ga0207704_10195807 3300025938 Bacteria 1474
404 Ga0207704_10368789 3300025938 Bacteria 1123
405 Ga0207665_10027256 3300025939 Bacteria 3775
406 Ga0207665_10027610 3300025939 Bacteria 3749
407 Ga0207665_10083604 3300025939 Bacteria 2202
408 Ga0207665_10134135 3300025939 Bacteria 1760
409 Ga0207665_10204824 3300025939 Bacteria 1439
410 Ga0207665_10237387 3300025939 Bacteria 1342
411 Ga0207665_10310005 3300025939 Bacteria 1182
412 Ga0207665_10319057 3300025939 Bacteria 1165
413 Ga0207665_10335766 3300025939 Bacteria 1137
414 Ga0207665_10556717 3300025939 Bacteria 892
415 Ga0207665_10990737 3300025939 Bacteria 668
416 Ga0207691_10082814 3300025940 Bacteria 2881
417 Ga0207691_10712290 3300025940 Bacteria 846
418 Ga0207711_10014607 3300025941 Bacteria 6526
419 Ga0207689_10023161 3300025942 Bacteria 5214
420 Ga0207689_10274944 3300025942 Bacteria 1395
421 Ga0207679_10428650 3300025945 Bacteria 1169
422 Ga0207667_11066404 3300025949 Bacteria 793
423 Ga0207667_11257909 3300025949 Bacteria 718
424 Ga0207667_11631245 3300025949 Unclassified 613
425 Ga0207651_10872591 3300025960 Bacteria 800
426 Ga0207651_11654798 3300025960 Bacteria 576
427 Ga0207712_10450502 3300025961 Bacteria 1091
428 Ga0207712_10642563 3300025961 Bacteria 921
429 Ga0207712_11016936 3300025961 Unclassified 736
430 Ga0207668_10071172 3300025972 Bacteria 2483
431 Ga0207668_10117665 3300025972 Bacteria 2006
432 Ga0207668_10230748 3300025972 Bacteria 1492
433 Ga0207640_10222238 3300025981 Bacteria 1447
434 Ga0207658_10059255 3300025986 Bacteria 2852
435 Ga0207658_10069965 3300025986 Bacteria 2653
436 Ga0207658_10212643 3300025986 Bacteria 1622
437 Ga0207658_10386269 3300025986 Bacteria 1227
438 Ga0207658_11057279 3300025986 Unclassified 741
439 Ga0207677_10155792 3300026023 Bacteria 1769
440 Ga0207703_10199901 3300026035 Bacteria 1776
441 Ga0207678_10331021 3300026067 Bacteria 1311
442 Ga0207678_11612416 3300026067 Bacteria 571
443 Ga0207708_10893892 3300026075 Bacteria 768
444 Ga0207702_10262742 3300026078 Bacteria 1626
445 Ga0207641_10000087 3300026088 Bacteria 132202
446 Ga0207641_10335626 3300026088 Bacteria 1437
447 Ga0207641_10350110 3300026088 Bacteria 1408
448 Ga0207641_10690085 3300026088 Unclassified 1005
449 Ga0207648_10104581 3300026089 Bacteria 2483
450 Ga0207676_10357958 3300026095 Bacteria 1352
451 Ga0207674_10011729 3300026116 Bacteria 9834
452 Ga0207675_101123171 3300026118 Bacteria 806
453 Ga0207675_101282526 3300026118 Bacteria 753
454 Ga0207683_10021320 3300026121 Bacteria 5545
455 Ga0207683_11115134 3300026121 Bacteria 732
456 Ga0207683_11177415 3300026121 Bacteria 710
457 Ga0207698_10028723 3300026142 Bacteria 3971
458 Ga0207698_11448394 3300026142 Bacteria 702
459 Ga0209588_1002053 3300027671 Bacteria 5434
460 Ga0209588_1005281 3300027671 Bacteria 3692
461 Ga0209588_1089262 3300027671 Unclassified 993
462 Ga0209813_10229514 3300027866 Bacteria 698
463 Ga0268266_10016005 3300028379 Bacteria 6414
464 Ga0268266_10286271 3300028379 Bacteria 1533
465 Ga0268265_10199889 3300028380 Bacteria 1733
466 Ga0268265_10611918 3300028380 Bacteria 1042
467 Ga0268265_10794713 3300028380 Unclassified 922
468 Ga0268264_10057869 3300028381 Bacteria 3244
469 Ga0268264_10065267 3300028381 Bacteria 3067
470 Ga0268264_10705209 3300028381 Bacteria 1002
471 Ga0307517_10003316 3300028786 Bacteria 25116
472 Ga0307517_10163133 3300028786 Bacteria 1489
473 Ga0307517_10201241 3300028786 Bacteria 1244
474 Ga0307517_10281083 3300028786 Bacteria 949
475 Ga0307515_10009334 3300028794 Bacteria 18983
476 Ga0307515_10927711 3300028794 Bacteria 504
477 Ga0265762_1000461 3300030760 Bacteria 7048
478 Ga0307513_10008907 3300031456 Bacteria 12759
479 Ga0307513_10070397 3300031456 Bacteria 3656
480 Ga0307513_10172427 3300031456 Unclassified 2039
481 Ga0307513_10263835 3300031456 Bacteria 1510
482 Ga0307513_10676886 3300031456 Bacteria 738
483 Ga0307509_10090710 3300031507 Bacteria 3130
484 Ga0307509_10338876 3300031507 Bacteria 1232
485 Ga0307508_10006204 3300031616 Bacteria 11274
486 Ga0307508_10042787 3300031616 Bacteria 4060
487 Ga0307516_10163926 3300031730 Bacteria 1970
488 Ga0307516_10374507 3300031730 Bacteria 1086
489 Ga0307516_10961094 3300031730 Bacteria 524
490 Ga0307507_10131144 3300033179 Bacteria 1960
491 Ga0373960_0380818 3300035121 Bacteria 541
492 Ga0373943_0102481 3300035170 Bacteria 1499
493 Ga0373946_0119182 3300035171 Bacteria 1203
494 Ga0373935_0166047 3300035692 Bacteria 1507
495 Ga0373935_0182649 3300035692 Bacteria 1441
496 Ga0373927_0098192 3300035695 Bacteria 1904
497 Ga0373947_0074720 3300035725 Bacteria 2086
498 Ga0373947_0153280 3300035725 Bacteria 1485
499 Ga0373925_0016924 3300037068 Bacteria 5278
500 Ga0373925_0379233 3300037068 Bacteria 1151
501 Ga0436361_0439731 3300039447 Bacteria 1779
502 Ga0451577_0008534 3300042876 Bacteria 9967
503 Ga0453684_0462597 3300044712 Bacteria 1410
504 Ga0495617_261491 3300046452 Bacteria 532
505 Ga0495592_0735802 3300046454 Bacteria 591
506 Ga0495603_0194474 3300046455 Bacteria 1172
507 Ga0495603_0479391 3300046455 Bacteria 712
508 Ga0495590_0031350 3300046457 Bacteria 1861
509 Ga0495629_0000138 3300046459 Bacteria 63867
510 Ga0495638_0044389 3300046460 Bacteria 2800
511 Ga0495638_0068645 3300046460 Bacteria 2173
512 Ga0495638_0241793 3300046460 Unclassified 999
513 Ga0495641_0376469 3300046461 Bacteria 643
514 Ga0495651_0580998 3300046462 Bacteria 709
515 Ga0495651_0932772 3300046462 Bacteria 529
516 Ga0495653_0000446 3300046463 Bacteria 32368
517 Ga0495650_0024248 3300046471 Bacteria 2867
518 Ga0495580_0007719 3300046472 Bacteria 8625
519 Ga0495580_0010117 3300046472 Bacteria 7367
520 Ga0495580_0022193 3300046472 Bacteria 4674
521 Ga0495580_1069471 3300046472 Bacteria 511
522 Ga0495582_0225744 3300046473 Bacteria 1072
523 Ga0495605_0001593 3300046474 Bacteria 14698
524 Ga0495605_0236358 3300046474 Bacteria 785
525 Ga0495664_0032235 3300046477 Bacteria 3074
526 Ga0495584_0204283 3300046491 Bacteria 1004
527 Ga0495584_0423398 3300046491 Bacteria 677
528 Ga0495594_0072817 3300046499 Bacteria 1912
529 Ga0495583_0002524 3300046506 Bacteria 15494
530 Ga0495583_0097946 3300046506 Bacteria 1254
531 Ga0495583_0267854 3300046506 Bacteria 682
532 Ga0495616_0207219 3300046513 Bacteria 859
533 Ga0495616_0259208 3300046513 Bacteria 745
534 Ga0495620_0008617 3300046515 Bacteria 5469
535 Ga0495628_0028727 3300046516 Bacteria 4516
536 Ga0495628_0095834 3300046516 Bacteria 2292
537 Ga0495630_0010093 3300046517 Bacteria 6805
538 Ga0495648_0001420 3300046524 Bacteria 23415
539 Ga0495648_0080512 3300046524 Bacteria 1855
540 Ga0495642_0008101 3300046528 Bacteria 4022
541 Ga0495642_0401065 3300046528 Bacteria 605
542 Ga0495654_0208622 3300046530 Bacteria 832
543 Ga0495665_0205848 3300046531 Bacteria 1019
544 Ga0495665_0397258 3300046531 Bacteria 699
545 Ga0495586_0040615 3300046535 Bacteria 2504
546 Ga0495586_0414157 3300046535 Bacteria 776
547 Ga0495609_0121576 3300046538 Bacteria 1122
548 Ga0495597_0062653 3300046542 Bacteria 1617
549 Ga0495597_0115480 3300046542 Bacteria 1122
550 Ga0495645_0098698 3300046543 Bacteria 2078
551 Ga0495622_0044302 3300046557 Bacteria 2068
552 Ga0495668_0015712 3300046616 Bacteria 4412
553 Ga0495668_0114935 3300046616 Bacteria 1472
554 Ga0495611_0065138 3300046648 Bacteria 1660
555 Ga0495611_0317862 3300046648 Bacteria 717
556 Ga0495625_0057236 3300046660 Bacteria 2773
557 Ga0495625_0108428 3300046660 Bacteria 1900
558 Ga0495625_0108441 3300046660 Unclassified 1900
559 Ga0495661_0028850 3300046665 Bacteria 3547
560 Ga0495588_0102845 3300046674 Bacteria 1502
561 Ga0495657_0204825 3300046675 Bacteria 1201
562 Ga0495646_0075158 3300046680 Bacteria 1981
563 Ga0495658_0018460 3300046683 Bacteria 3627
564 Ga0495669_0142314 3300046684 Bacteria 1132
565 Ga0495669_0353023 3300046684 Bacteria 711
566 Ga0495613_0137644 3300046689 Bacteria 1746
567 Ga0495624_0000612 3300046690 Bacteria 27861
568 Ga0495671_0008544 3300046692 Bacteria 5754
569 Ga0495649_0049767 3300046694 Bacteria 2275
570 Ga0495649_0395449 3300046694 Bacteria 694
571 Ga0495649_0615225 3300046694 Bacteria 535
572 Ga0495649_0621246 3300046694 Bacteria 532
573 Ga0495589_0027018 3300046794 Bacteria 2905
574 Ga0495589_0148472 3300046794 Bacteria 1120
575 Ga0495636_0163380 3300047318 Bacteria 1004
576 Ga0495674_0008117 3300047319 Bacteria 10019
577 Ga0495674_0025494 3300047319 Bacteria 5420
578 Ga0495674_0056504 3300047319 Bacteria 3436
579 Ga0495674_0597192 3300047319 Bacteria 875
580 Ga0495672_0000819 3300047320 Bacteria 33438
581 Ga0495672_0081097 3300047320 Bacteria 1808
582 Ga0495672_0550982 3300047320 Bacteria 505
583 Ga0495683_0012815 3300047323 Bacteria 4398
584 Ga0495687_000618 3300047443 Bacteria 41265
585 Ga0495687_010678 3300047443 Bacteria 5015
586 Ga0495687_029814 3300047443 Bacteria 2519
587 Ga0495679_000036 3300047446 Bacteria 161473
588 Ga0495673_0000817 3300047469 Bacteria 29236
589 Ga0495673_0041107 3300047469 Bacteria 2084
590 Ga0495673_0043948 3300047469 Bacteria 1995
591 Ga0495681_0137256 3300047470 Bacteria 1036
592 Ga0495686_0000946 3300047472 Bacteria 36027
593 Ga0495686_0081140 3300047472 Bacteria 1981
594 Ga0495593_0030838 3300047673 Bacteria 2931
595 Ga0495602_0176578 3300048088 Bacteria 1652
596 Ga0495614_0062212 3300048089 Bacteria 1604
597 Ga0495626_0026480 3300048091 Bacteria 2826
598 Ga0496100_0218293 3300048903 Bacteria 1398
599 Ga0496100_0363094 3300048903 Bacteria 1096
600 Ga0496100_0562631 3300048903 Bacteria 883
601 Ga0496101_0021297 3300048904 Bacteria 4453
602 Ga0496101_0312397 3300048904 Bacteria 1232
603 Ga0496102_0171020 3300048905 Unclassified 2045
604 Ga0496102_0700012 3300048905 Bacteria 936
605 Ga0496103_0024796 3300048906 Bacteria 3620
606 Ga0496103_0307315 3300048906 Bacteria 1020
607 Ga0496103_0453551 3300048906 Bacteria 822
608 Ga0496105_0126477 3300048908 Bacteria 2107
609 Ga0496105_0486342 3300048908 Bacteria 970
610 Ga0496106_0037518 3300048909 Bacteria 3625
611 Ga0496107_0236527 3300048910 Bacteria 1359
612 Ga0496107_1053991 3300048910 Bacteria 589
613 Ga0496108_0224709 3300048911 Bacteria 1632
614 Ga0496109_0000191 3300048912 Bacteria 61025
615 Ga0496109_0082805 3300048912 Bacteria 2958
616 Ga0496109_0144749 3300048912 Bacteria 2223
617 Ga0496112_0000564 3300048915 Bacteria 25454
618 Ga0496112_0122648 3300048915 Bacteria 2569
619 Ga0496112_0134887 3300048915 Bacteria 2439
620 Ga0496112_0223185 3300048915 Bacteria 1840
621 Ga0496113_0026816 3300048916 Bacteria 4124
622 Ga0496113_0316454 3300048916 Bacteria 1251
623 Ga0496115_0015875 3300048918 Bacteria 5721
624 Ga0496115_1219783 3300048918 Bacteria 564
625 Ga0496118_0020013 3300048921 Bacteria 5955
626 Ga0496118_0104831 3300048921 Bacteria 1897
627 Ga0496119_0007718 3300048922 Bacteria 9617
628 Ga0496121_0018406 3300048924 Bacteria 7043
629 Ga0496121_0586869 3300048924 Bacteria 690
630 Ga0496122_0104714 3300048925 Bacteria 1879
631 Ga0496126_0006621 3300048929 Bacteria 12896
632 Ga0495678_011197 3300049459 Bacteria 4309
633 Ga0501072_1571274 3300049588 Unclassified 507
634 nmdc:mga03683_66706_c1 3300050489 Bacteria 1531
635 nmdc:mga03n38_282943_c1 3300050490 Bacteria 886
636 nmdc:mga00v17_182297_c1 3300050491 Bacteria 1355
637 nmdc:mga0k408_17131_c1 3300050493 Bacteria 4032
638 nmdc:mga0k408_178811_c1 3300050493 Bacteria 1265
639 nmdc:mga0k408_353000_c1 3300050493 Bacteria 877
640 nmdc:mga0k408_36604_c1 3300050493 Bacteria 2817
641 nmdc:mga06z11_564231_c1 3300050494 Bacteria 692
642 nmdc:mga04h51_158708_c1 3300050495 Bacteria 869
643 nmdc:mga07m45_74595_c1 3300050496 Bacteria 1933
644 nmdc:mga05p37_1697240_c1 3300050507 Bacteria 616
645 nmdc:mga05p37_205511_c1 3300050507 Unclassified 2382
646 nmdc:mga05p37_32378_c1 3300050507 Bacteria 6393
647 nmdc:mga05p37_459000_c1 3300050507 Bacteria 1473
648 nmdc:mga05p37_673626_c1 3300050507 Bacteria 1154
649 nmdc:mga09592_50700_c1 3300050508 Archaea 3501
650 nmdc:mga09592_554912_c1 3300050508 Bacteria 986
651 nmdc:mga09592_565536_c1 3300050508 Bacteria 976
652 nmdc:mga06r32_706259_c1 3300050510 Unclassified 974
653 nmdc:mga08y16_256190_c1 3300050511 Bacteria 1807
654 nmdc:mga0n895_1026901_c1 3300050512 Unclassified 805
655 nmdc:mga0n895_170282_c1 3300050512 Bacteria 2210
656 nmdc:mga0n895_277468_c1 3300050512 Unclassified 1700
657 nmdc:mga0n895_344593_c1 3300050512 Bacteria 1509
658 nmdc:mga0n895_448640_c1 3300050512 Bacteria 1302
659 nmdc:mga0n895_475291_c1 3300050512 Bacteria 1261
660 nmdc:mga0n895_52065_c1 3300050512 Bacteria 4018
661 nmdc:mga0n895_69985_c1 3300050512 Bacteria 3477
662 nmdc:mga0n895_918715_c1 3300050512 Bacteria 860
663 nmdc:mga0rr50_365287_c1 3300050513 Bacteria 1215
664 nmdc:mga0rr50_36663_c1 3300050513 Bacteria 3533
665 nmdc:mga0rr50_404418_c1 3300050513 Bacteria 1153
666 nmdc:mga0rr50_40913_c1 3300050513 Bacteria 3372
667 nmdc:mga0rr50_69023_c1 3300050513 Bacteria 2689
668 nmdc:mga08x19_151854_c1 3300050514 Bacteria 1569
669 nmdc:mga08x19_184659_c1 3300050514 Bacteria 1425
670 nmdc:mga08x19_26712_c1 3300050514 Bacteria 3603
671 nmdc:mga08x19_321802_c1 3300050514 Bacteria 1076
672 nmdc:mga08x19_32568_c1 3300050514 Bacteria 3286
673 nmdc:mga08x19_432229_c1 3300050514 Unclassified 925
674 nmdc:mga08x19_931033_c1 3300050514 Bacteria 617
675 nmdc:mga0a205_106667_c1 3300050515 Unclassified 2699
676 nmdc:mga0a205_38801_c1 3300050515 Bacteria 4583
677 nmdc:mga0a205_490202_c1 3300050515 Bacteria 1086
678 nmdc:mga0a205_490956_c1 3300050515 Unclassified 1085
679 nmdc:mga0a205_572077_c1 3300050515 Bacteria 984
680 nmdc:mga0a205_752_c2 3300050515 Bacteria 12327
681 nmdc:mga0a205_756826_c1 3300050515 Bacteria 820
682 nmdc:mga0a205_77225_c1 3300050515 Bacteria 3218
683 nmdc:mga0a205_873488_c1 3300050515 Unclassified 746
684 nmdc:mga0a205_937028_c1 3300050515 Unclassified 713
685 nmdc:mga0sz30_237569_c1 3300050516 Unclassified 811
686 nmdc:mga0sz30_368170_c1 3300050516 Bacteria 643
687 Ga0500583_0020352 3300053092 Plasmid 2738
688 Ga0500650_0361794 3300053098 Bacteria 633
689 Ga0500604_0359468 3300053151 Bacteria 506
690 2563064794 2562617112 Bacteria 10918404
691 2713482218 2711768613 Bacteria 11048459
692 2921646450 2921643360 Bacteria 11448031
693 Ga0453683_0408982
694 CNBas_1000065
695 JGI24737J22298_10047665
696 Ga0065712_10004223
697 Ga0065712_10132666
698 Ga0065712_10132756
699 Ga0065712_10243949
700 Ga0065715_10033703
701 Ga0065715_10108923
702 Ga0065715_10188362
703 Ga0065715_10270259
704 Ga0065707_10011731
705 Ga0065707_10032665
706 Ga0065707_10035348
707 Ga0065707_10044750
708 Ga0065707_10110546
709 Ga0065707_10551620
710 Ga0070676_10010210
711 Ga0070676_10021469
712 Ga0070690_100046718
713 Ga0070690_100857667
714 Ga0070677_10154698
715 Ga0068869_100004822
716 Ga0068869_100212523
717 Ga0068869_100311740
718 Ga0070666_10008382
719 Ga0070666_10711347
720 Ga0070680_100117760
721 Ga0070682_101718695
722 Ga0068868_100017698
723 Ga0070687_100913770
724 Ga0070668_100114320
725 Ga0070668_100467946
726 Ga0070669_100108483
727 Ga0070669_100131948
728 Ga0070675_100051494
729 Ga0070675_100074986
730 Ga0070671_100033866
731 Ga0070671_100069498
732 Ga0070671_100123408
733 Ga0070674_100015136
734 Ga0070673_100041120
735 Ga0070673_100103319
736 Ga0070673_100822016
737 Ga0070667_100005947
738 Ga0070667_100020755
739 Ga0070667_100157309
740 Ga0070667_100198683
741 Ga0070703_10265783
742 Ga0070709_10646116
743 Ga0070709_10861166
744 Ga0070714_100593327
745 Ga0070714_100785489
746 Ga0070714_100926518
747 Ga0070714_101426979
748 Ga0070713_100296567
749 Ga0070713_100439664
750 Ga0070713_101451742
751 Ga0070710_10089905
752 Ga0070710_10300552
753 Ga0070710_10413709
754 Ga0070711_100039205
755 Ga0070711_100098295
756 Ga0070711_100175561
757 Ga0070711_100235095
758 Ga0070711_100267932
759 Ga0070711_101229133
760 Ga0070705_100436590
761 Ga0070705_100541208
762 Ga0070705_100728736
763 Ga0070705_100882830
764 Ga0070700_100343038
765 Ga0070694_100069984
766 Ga0070694_100182623
767 Ga0070694_100533553
768 Ga0070708_100040197
769 Ga0070708_100099100
770 Ga0070708_100136778
771 Ga0070708_100153643
772 Ga0070708_100250049
773 Ga0070708_100374517
774 Ga0070708_100408363
775 Ga0070708_100482383
776 Ga0070708_100657282
777 Ga0070708_100904643
778 Ga0070708_101070297
779 Ga0070708_101313128
780 Ga0070708_101627435
781 Ga0070678_100001335
782 Ga0070662_100004462
783 Ga0070662_100033403
784 Ga0070681_10034009
785 Ga0070706_100063198
786 Ga0070706_100084778
787 Ga0070706_100130955
788 Ga0070706_100152057
789 Ga0070706_100189777
790 Ga0070706_100248752
791 Ga0070706_100332547
792 Ga0070706_100590436
793 Ga0070707_100054010
794 Ga0070707_100058443
795 Ga0070707_100069375
796 Ga0070707_100090569
797 Ga0070707_100096502
798 Ga0070707_100208627
799 Ga0070707_100227002
800 Ga0070707_100254831
801 Ga0070707_100622777
802 Ga0070707_100681331
803 Ga0070707_101103176
804 Ga0070707_101231396
805 Ga0070707_101459189
806 Ga0070698_100033017
807 Ga0070698_100098798
808 Ga0070698_100297309
809 Ga0070698_100444667
810 Ga0070698_100593618
811 Ga0070698_101861640
812 Ga0070698_101905037
813 Ga0070699_100038630
814 Ga0070699_100069245
815 Ga0070699_100091659
816 Ga0070699_100098286
817 Ga0070699_100379247
818 Ga0070699_100437755
819 Ga0070699_100736253
820 Ga0070699_100964182
821 Ga0070699_101712278
822 Ga0070699_101960037
823 Ga0070697_100018466
824 Ga0070697_100074035
825 Ga0070697_100076752
826 Ga0070697_100137952
827 Ga0070697_100158628
828 Ga0070697_100316470
829 Ga0070697_100437889
830 Ga0070697_100485266
831 Ga0070697_100534213
832 Ga0070697_100555908
833 Ga0070697_100913959
834 Ga0070697_101047649
835 Ga0070697_101139612
836 Ga0070697_101361338
837 Ga0068853_100150614
838 Ga0070672_100180276
839 Ga0070672_100543349
840 Ga0070686_100640906
841 Ga0070695_100168115
842 Ga0070695_100332005
843 Ga0070695_101773083
844 Ga0070696_100107006
845 Ga0070696_100186235
846 Ga0070696_100235310
847 Ga0070696_100263921
848 Ga0070696_100760564
849 Ga0070696_100934830
850 Ga0070693_100345384
851 Ga0070665_100027364
852 Ga0070665_100073809
853 Ga0070665_100506091
854 Ga0070704_100443083
855 Ga0068855_100204684
856 Ga0068855_101037604
857 Ga0070664_101043033
858 Ga0068857_100012898
859 Ga0068854_100138730
860 Ga0068856_100131872
861 Ga0070702_100010724
862 Ga0068852_100092138
863 Ga0068852_101113777
864 Ga0068859_100047636
865 Ga0068859_100602447
866 Ga0068864_101353302
867 Ga0068861_101844369
868 Ga0068863_100000799
869 Ga0068863_100385426
870 Ga0068858_100105021
871 Ga0068858_101325328
872 Ga0068860_100006111
873 Ga0068860_100690402
874 Ga0068860_100755522
875 Ga0068860_101106731
876 Ga0068862_100527791
877 Ga0068862_100571591
878 Ga0081455_10002865
879 Ga0070717_10025951
880 Ga0070717_10157368
881 Ga0070717_10174600
882 Ga0075368_10122441
883 Ga0075363_100199664
884 Ga0075364_10067119
885 Ga0070716_100144121
886 Ga0070716_100232390
887 Ga0070716_100246074
888 Ga0070716_100474208
889 Ga0070716_100496179
890 Ga0070712_100007180
891 Ga0070712_100142604
892 Ga0070712_100161707
893 Ga0070712_100300692
894 Ga0070712_100368081
895 Ga0070712_100703736
896 Ga0075362_10010589
897 Ga0075367_10039972
898 Ga0075369_10226284
899 Ga0075369_10330419
900 Ga0075366_10078887
901 Ga0075366_10378363
902 Ga0097621_100219409
903 Ga0075428_100515858
904 Ga0075430_100374254
905 Ga0075431_100136045
906 Ga0075433_10006173
907 Ga0075433_10277038
908 Ga0075433_10392539
909 Ga0075433_10470337
910 Ga0075433_11576129
911 Ga0075434_100019816
912 Ga0075434_100068985
913 Ga0075434_100182829
914 Ga0075434_100247161
915 Ga0075434_100426854
916 Ga0075434_100973696
917 Ga0075434_100988691
918 Ga0075434_101071162
919 Ga0075429_100212299
920 Ga0075429_100439117
921 Ga0068865_100112178
922 Ga0068865_100316878
923 Ga0075436_100022968
924 Ga0075436_100055180
925 Ga0075436_100079533
926 Ga0075436_100083332
927 Ga0075436_100415969
928 Ga0075436_100728281
929 Ga0075436_100992118
930 Ga0097620_100047636
931 Ga0097620_100602393
932 Ga0075435_100005258
933 Ga0075435_100111761
934 Ga0075435_100189990
935 Ga0075435_100239829
936 Ga0075435_100656728
937 Ga0075435_100720974
938 Ga0099794_10001943
939 Ga0099794_10006059
940 Ga0099794_10034723
941 Ga0099794_10096648
942 Ga0099794_10270671
943 Ga0099794_10310551
944 Ga0099794_10372343
945 Ga0099794_10384692
946 Ga0099795_10000131
947 Ga0099795_10059506
948 Ga0099795_10137665
949 Ga0105240_10020314
950 Ga0111539_10493434
951 Ga0111539_10728926
952 Ga0111539_11655308
953 Ga0111539_12342179
954 Ga0105245_10199633
955 Ga0105245_10891051
956 Ga0105245_11638581
957 Ga0114129_10030709
958 Ga0114129_10142169
959 Ga0114129_10338650
960 Ga0114129_10662991
961 Ga0114129_10819248
962 Ga0114129_11303680
963 Ga0114129_11371002
964 Ga0105243_10474170
965 Ga0105242_10176758
966 Ga0105242_10218205
967 Ga0105248_10011422
968 Ga0105248_10179804
969 Ga0105248_12235527
970 Ga0105248_12518594
971 Ga0105237_10020735
972 Ga0105237_10043429
973 Ga0105238_10005544
974 Ga0105249_10179232
975 Ga0105249_10352688
976 Ga0105249_10675753
977 Ga0105249_11145641
978 Ga0105249_12624301
979 Ga0099796_10016941
980 Ga0099796_10018733
981 Ga0099796_10022399
982 Ga0099796_10077758
983 Ga0099796_10154713
984 Ga0099796_10401782
985 Ga0105239_10060087
986 Ga0105239_10776248
987 Ga0105239_11036627
988 Ga0105246_10181716
989 Ga0105246_11082427
990 Ga0157373_10064624
991 Ga0157371_10087113
992 Ga0157374_10029466
993 Ga0157374_10041870
994 Ga0157374_10088277
995 Ga0157374_10252688
996 Ga0157378_10043363
997 Ga0157378_10122891
998 Ga0157378_10229901
999 Ga0157378_10363240
1000 Ga0163162_10059063
1001 Ga0163162_10152242
1002 Ga0163162_10746574
1003 Ga0157372_10210406
1004 Ga0157372_12590456
1005 Ga0157375_10197248
1006 Ga0157375_10374459
1007 Ga0157375_10762236
1008 Ga0157375_11164608
1009 Ga0157375_11424307
1010 Ga0163163_10523876
1011 Ga0163163_11344733
1012 Ga0157380_10232344
1013 Ga0157380_11919175
1014 Ga0157377_10554053
1015 Ga0157379_10258723
1016 Ga0157376_12010467
1017 Ga0213872_10066360
1018 Ga0209130_1044050
1019 Ga0207673_1008451
1020 Ga0207697_10057253
1021 Ga0207653_10030363
1022 Ga0207692_10065883
1023 Ga0207692_10081863
1024 Ga0207692_10148392
1025 Ga0207692_10273602
1026 Ga0207688_10030638
1027 Ga0207680_10006755
1028 Ga0207680_11071867
1029 Ga0207685_10326870
1030 Ga0207699_10089691
1031 Ga0207645_10014336
1032 Ga0207645_10041894
1033 Ga0207684_10022970
1034 Ga0207684_10093547
1035 Ga0207684_10128764
1036 Ga0207684_10133322
1037 Ga0207684_10140037
1038 Ga0207684_10149630
1039 Ga0207684_10178565
1040 Ga0207684_10319554
1041 Ga0207684_10404358
1042 Ga0207684_10784303
1043 Ga0207684_10910085
1044 Ga0207707_10033353
1045 Ga0207671_10012010
1046 Ga0207671_10046227
1047 Ga0207693_10001390
1048 Ga0207693_10072841
1049 Ga0207693_10123123
1050 Ga0207693_10329259
1051 Ga0207693_10490367
1052 Ga0207693_10539268
1053 Ga0207693_10651241
1054 Ga0207663_10001325
1055 Ga0207663_10089003
1056 Ga0207663_10176994
1057 Ga0207663_10338217
1058 Ga0207663_10430266
1059 Ga0207663_10544885
1060 Ga0207663_10793581
1061 Ga0207662_10185493
1062 Ga0207657_10339263
1063 Ga0207646_10010524
1064 Ga0207646_10020368
1065 Ga0207646_10053747
1066 Ga0207646_10063569
1067 Ga0207646_10064388
1068 Ga0207646_10078868
1069 Ga0207646_10083352
1070 Ga0207646_10219376
1071 Ga0207646_10486622
1072 Ga0207646_10881530
1073 Ga0207646_11243055
1074 Ga0207681_10019679
1075 Ga0207681_10047999
1076 Ga0207694_10026233
1077 Ga0207659_10213414
1078 Ga0207659_10882820
1079 Ga0207687_10529875
1080 Ga0207700_10211303
1081 Ga0207700_10384136
1082 Ga0207700_10608386
1083 Ga0207700_11199276
1084 Ga0207664_10729540
1085 Ga0207664_11377447
1086 Ga0207644_10159550
1087 Ga0207644_10205636
1088 Ga0207644_10211956
1089 Ga0207644_10541638
1090 Ga0207706_10003019
1091 Ga0207706_10011988
1092 Ga0207686_10280562
1093 Ga0207669_10829019
1094 Ga0207704_10163168
1095 Ga0207704_10195807
1096 Ga0207704_10368789
1097 Ga0207665_10027256
1098 Ga0207665_10027610
1099 Ga0207665_10083604
1100 Ga0207665_10134135
1101 Ga0207665_10204824
1102 Ga0207665_10237387
1103 Ga0207665_10310005
1104 Ga0207665_10319057
1105 Ga0207665_10335766
1106 Ga0207665_10556717
1107 Ga0207665_10990737
1108 Ga0207691_10082814
1109 Ga0207691_10712290
1110 Ga0207711_10014607
1111 Ga0207689_10023161
1112 Ga0207689_10274944
1113 Ga0207679_10428650
1114 Ga0207667_11066404
1115 Ga0207667_11257909
1116 Ga0207667_11631245
1117 Ga0207651_10872591
1118 Ga0207651_11654798
1119 Ga0207712_10450502
1120 Ga0207712_10642563
1121 Ga0207712_11016936
1122 Ga0207668_10071172
1123 Ga0207668_10117665
1124 Ga0207668_10230748
1125 Ga0207640_10222238
1126 Ga0207658_10059255
1127 Ga0207658_10069965
1128 Ga0207658_10212643
1129 Ga0207658_10386269
1130 Ga0207658_11057279
1131 Ga0207677_10155792
1132 Ga0207703_10199901
1133 Ga0207678_10331021
1134 Ga0207678_11612416
1135 Ga0207708_10893892
1136 Ga0207702_10262742
1137 Ga0207641_10000087
1138 Ga0207641_10335626
1139 Ga0207641_10350110
1140 Ga0207641_10690085
1141 Ga0207648_10104581
1142 Ga0207676_10357958
1143 Ga0207674_10011729
1144 Ga0207675_101123171
1145 Ga0207675_101282526
1146 Ga0207683_10021320
1147 Ga0207683_11115134
1148 Ga0207683_11177415
1149 Ga0207698_10028723
1150 Ga0207698_11448394
1151 Ga0209588_1002053
1152 Ga0209588_1005281
1153 Ga0209588_1089262
1154 Ga0209813_10229514
1155 Ga0268266_10016005
1156 Ga0268266_10286271
1157 Ga0268265_10199889
1158 Ga0268265_10611918
1159 Ga0268265_10794713
1160 Ga0268264_10057869
1161 Ga0268264_10065267
1162 Ga0268264_10705209
1163 Ga0307517_10003316
1164 Ga0307517_10163133
1165 Ga0307517_10201241
1166 Ga0307517_10281083
1167 Ga0307515_10009334
1168 Ga0307515_10927711
1169 Ga0265762_1000461
1170 Ga0307513_10008907
1171 Ga0307513_10070397
1172 Ga0307513_10172427
1173 Ga0307513_10263835
1174 Ga0307513_10676886
1175 Ga0307509_10090710
1176 Ga0307509_10338876
1177 Ga0307508_10006204
1178 Ga0307508_10042787
1179 Ga0307516_10163926
1180 Ga0307516_10374507
1181 Ga0307516_10961094
1182 Ga0307507_10131144
1183 Ga0373960_0380818
1184 Ga0373943_0102481
1185 Ga0373946_0119182
1186 Ga0373935_0166047
1187 Ga0373935_0182649
1188 Ga0373927_0098192
1189 Ga0373947_0074720
1190 Ga0373947_0153280
1191 Ga0373925_0016924
1192 Ga0373925_0379233
1193 Ga0436361_0439731
1194 Ga0451577_0008534
1195 Ga0453684_0462597
1196 Ga0495617_261491
1197 Ga0495592_0735802
1198 Ga0495603_0194474
1199 Ga0495603_0479391
1200 Ga0495590_0031350
1201 Ga0495629_0000138
1202 Ga0495638_0044389
1203 Ga0495638_0068645
1204 Ga0495638_0241793
1205 Ga0495641_0376469
1206 Ga0495651_0580998
1207 Ga0495651_0932772
1208 Ga0495653_0000446
1209 Ga0495650_0024248
1210 Ga0495580_0007719
1211 Ga0495580_0010117
1212 Ga0495580_0022193
1213 Ga0495580_1069471
1214 Ga0495582_0225744
1215 Ga0495605_0001593
1216 Ga0495605_0236358
1217 Ga0495664_0032235
1218 Ga0495584_0204283
1219 Ga0495584_0423398
1220 Ga0495594_0072817
1221 Ga0495583_0002524
1222 Ga0495583_0097946
1223 Ga0495583_0267854
1224 Ga0495616_0207219
1225 Ga0495616_0259208
1226 Ga0495620_0008617
1227 Ga0495628_0028727
1228 Ga0495628_0095834
1229 Ga0495630_0010093
1230 Ga0495648_0001420
1231 Ga0495648_0080512
1232 Ga0495642_0008101
1233 Ga0495642_0401065
1234 Ga0495654_0208622
1235 Ga0495665_0205848
1236 Ga0495665_0397258
1237 Ga0495586_0040615
1238 Ga0495586_0414157
1239 Ga0495609_0121576
1240 Ga0495597_0062653
1241 Ga0495597_0115480
1242 Ga0495645_0098698
1243 Ga0495622_0044302
1244 Ga0495668_0015712
1245 Ga0495668_0114935
1246 Ga0495611_0065138
1247 Ga0495611_0317862
1248 Ga0495625_0057236
1249 Ga0495625_0108428
1250 Ga0495625_0108441
1251 Ga0495661_0028850
1252 Ga0495588_0102845
1253 Ga0495657_0204825
1254 Ga0495646_0075158
1255 Ga0495658_0018460
1256 Ga0495669_0142314
1257 Ga0495669_0353023
1258 Ga0495613_0137644
1259 Ga0495624_0000612
1260 Ga0495671_0008544
1261 Ga0495649_0049767
1262 Ga0495649_0395449
1263 Ga0495649_0615225
1264 Ga0495649_0621246
1265 Ga0495589_0027018
1266 Ga0495589_0148472
1267 Ga0495636_0163380
1268 Ga0495674_0008117
1269 Ga0495674_0025494
1270 Ga0495674_0056504
1271 Ga0495674_0597192
1272 Ga0495672_0000819
1273 Ga0495672_0081097
1274 Ga0495672_0550982
1275 Ga0495683_0012815
1276 Ga0495687_000618
1277 Ga0495687_010678
1278 Ga0495687_029814
1279 Ga0495679_000036
1280 Ga0495673_0000817
1281 Ga0495673_0041107
1282 Ga0495673_0043948
1283 Ga0495681_0137256
1284 Ga0495686_0000946
1285 Ga0495686_0081140
1286 Ga0495593_0030838
1287 Ga0495602_0176578
1288 Ga0495614_0062212
1289 Ga0495626_0026480
1290 Ga0496100_0218293
1291 Ga0496100_0363094
1292 Ga0496100_0562631
1293 Ga0496101_0021297
1294 Ga0496101_0312397
1295 Ga0496102_0171020
1296 Ga0496102_0700012
1297 Ga0496103_0024796
1298 Ga0496103_0307315
1299 Ga0496103_0453551
1300 Ga0496105_0126477
1301 Ga0496105_0486342
1302 Ga0496106_0037518
1303 Ga0496107_0236527
1304 Ga0496107_1053991
1305 Ga0496108_0224709
1306 Ga0496109_0000191
1307 Ga0496109_0082805
1308 Ga0496109_0144749
1309 Ga0496112_0000564
1310 Ga0496112_0122648
1311 Ga0496112_0134887
1312 Ga0496112_0223185
1313 Ga0496113_0026816
1314 Ga0496113_0316454
1315 Ga0496115_0015875
1316 Ga0496115_1219783
1317 Ga0496118_0020013
1318 Ga0496118_0104831
1319 Ga0496119_0007718
1320 Ga0496121_0018406
1321 Ga0496121_0586869
1322 Ga0496122_0104714
1323 Ga0496126_0006621
1324 Ga0495678_011197
1325 Ga0501072_1571274
1326 nmdc:mga03683_66706_c1
1327 nmdc:mga03n38_282943_c1
1328 nmdc:mga00v17_182297_c1
1329 nmdc:mga0k408_17131_c1
1330 nmdc:mga0k408_178811_c1
1331 nmdc:mga0k408_353000_c1
1332 nmdc:mga0k408_36604_c1
1333 nmdc:mga06z11_564231_c1
1334 nmdc:mga04h51_158708_c1
1335 nmdc:mga07m45_74595_c1
1336 nmdc:mga05p37_1697240_c1
1337 nmdc:mga05p37_205511_c1
1338 nmdc:mga05p37_32378_c1
1339 nmdc:mga05p37_459000_c1
1340 nmdc:mga05p37_673626_c1
1341 nmdc:mga09592_50700_c1
1342 nmdc:mga09592_554912_c1
1343 nmdc:mga09592_565536_c1
1344 nmdc:mga06r32_706259_c1
1345 nmdc:mga08y16_256190_c1
1346 nmdc:mga0n895_1026901_c1
1347 nmdc:mga0n895_170282_c1
1348 nmdc:mga0n895_277468_c1
1349 nmdc:mga0n895_344593_c1
1350 nmdc:mga0n895_448640_c1
1351 nmdc:mga0n895_475291_c1
1352 nmdc:mga0n895_52065_c1
1353 nmdc:mga0n895_69985_c1
1354 nmdc:mga0n895_918715_c1
1355 nmdc:mga0rr50_365287_c1
1356 nmdc:mga0rr50_36663_c1
1357 nmdc:mga0rr50_404418_c1
1358 nmdc:mga0rr50_40913_c1
1359 nmdc:mga0rr50_69023_c1
1360 nmdc:mga08x19_151854_c1
1361 nmdc:mga08x19_184659_c1
1362 nmdc:mga08x19_26712_c1
1363 nmdc:mga08x19_321802_c1
1364 nmdc:mga08x19_32568_c1
1365 nmdc:mga08x19_432229_c1
1366 nmdc:mga08x19_931033_c1
1367 nmdc:mga0a205_106667_c1
1368 nmdc:mga0a205_38801_c1
1369 nmdc:mga0a205_490202_c1
1370 nmdc:mga0a205_490956_c1
1371 nmdc:mga0a205_572077_c1
1372 nmdc:mga0a205_752_c2
1373 nmdc:mga0a205_756826_c1
1374 nmdc:mga0a205_77225_c1
1375 nmdc:mga0a205_873488_c1
1376 nmdc:mga0a205_937028_c1
1377 nmdc:mga0sz30_237569_c1
1378 nmdc:mga0sz30_368170_c1
1379 Ga0500583_0020352
1380 Ga0500650_0361794
1381 Ga0500604_0359468
1382 2563064794
1383 2713482218
1384 2921646450

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

40

134

0.93

PF07366

SnoaL

SnoaL-like polyketide cyclase

38

146

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.8596 8 111
3g0k-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function with a cystatin-like fold (saro_2880) from novosphingobium aromaticivorans dsm at 1.30 a resolution 0.8496 1 126
3g0k-assembly1.cif.gz_A-2 crystal structure of a protein of unknown function with a cystatin-like fold (saro_2880) from novosphingobium aromaticivorans dsm at 1.30 a resolution 0.8253 1 126
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.8245 12 109
3g16-assembly1.cif.gz_B crystal structure of protein of unknown function with cystatin-like fold (yp_001022489.1) from methylobium petroleophilum pm1 at 1.45 a resolution 0.822 1 115
ID Description Score Start End Superfamily
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8812 8 111 3.10.450.50
af_Q10083_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8621 6 112 3.10.450.50
af_P96818_5_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8257 7 111 3.10.450.50
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8174 10 109 3.10.450.50
3g16B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8162 8 115 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2V6LI90-F1-model_v4 SnoaL-like domain-containing protein 1.001 1 87
AF-A0A423NF93-F1-model_v4 SnoaL-like domain-containing protein 0.9989 2 96
AF-A0A0K1PXB6-F1-model_v4 SnoaL-like domain-containing protein 0.9977 5 132 GO:0030638
AF-A0A402D4G5-F1-model_v4 Uncharacterized protein 0.9946 2 132
AF-A0A423NF93-F1-model_v4 SnoaL-like domain-containing protein 0.9885 2 96

Map