F475596

General Info

Members Datasets Scaffolds Average Seq Length
692 372 661 342

Family's Representative Sequence

Representative Sequence 3300042005|Ga0439448_0048187|Ga0439448_0048187_111_1232
Length 373
Sequence LQRLPPSGHRRVTVRAAGFSALRSVTPKELFMRIPSLLPFLLALVAGTALAQKTPLLVYTALETDQLKAYQEGFNKVHPDIELKWVRDSTGVITAKLLAEKANPQADVVMGVAASSLALLGRNGMLEGYKPLNYDAIMKSYVDKNSPPLWWGMDVWGATICFNTVEAQKKNIPKPETWKDLLKPVYKNQIVMPNPASSGTGFFDVTAWLNLWGDDNGKGGGWKFMDGLHENIAQYTHSGSKPCNMAAAGEYVMGISFEYRANANKAKGAPIDLVFPKEGLGWDLEAFAIHKGTKHLDAAKKLADWASSKDAMLLYGKNFAITAQPGVAAPLPNVPKDYESRLVKMDFAWAADNRERILAEWTKRYNAKSEPKK

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221621 Achromobacter sp. Root83 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2738543012 Acidovorax sp. CF301 Isolate Unclassified
10 2738543013 Variovorax sp. BT01 Isolate Unclassified
11 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
12 2816332133 Acidovorax radicis 2721A Isolate Unclassified
13 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
14 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
15 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
16 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
17 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
18 2842747753 Variovorax sp. R-72060 Isolate Unclassified
19 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
20 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
21 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
22 2858950400 Achromobacter sp. K91 Isolate Unclassified
23 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
24 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
25 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
26 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
27 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
28 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
29 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
30 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
31 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
32 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
33 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
34 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
40 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
41 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
42 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
43 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
44 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
45 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
46 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
49 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
50 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
51 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
52 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
53 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
54 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
55 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
56 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
66 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
67 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
80 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
81 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
82 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
83 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
84 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
85 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
89 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
90 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
91 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
92 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
95 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
96 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
97 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
98 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
109 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
110 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
122 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
123 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
124 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
125 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
127 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
128 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
129 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
130 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
131 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
132 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
137 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
138 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
142 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
143 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
162 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
165 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
166 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
167 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
176 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
177 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
180 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
185 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
188 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
248 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
249 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
250 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
251 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
252 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
253 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
254 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
255 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
258 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
259 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
260 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
261 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
262 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
263 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
264 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
265 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
271 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
280 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
281 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
282 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
283 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
284 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
285 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
286 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
287 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
288 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
289 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
290 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
291 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
292 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
296 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
301 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
302 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
306 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
315 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
319 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
320 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
326 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
327 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
338 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
339 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
343 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
354 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
355 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
356 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
361 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
362 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
363 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
364 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
365 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
366 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
367 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
368 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
369 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
370 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
371 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
372 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.52
Metatranscriptomes 0
Isolates 4.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.33
Nodule 1.01
Rhizoplane 0.87
Rhizosphere 71.82
Stem 0
Stem Tuber 0
Unclassified 9.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000121 3300002704 Bacteria 38491
2 JGI25156J39149_1000100 3300002705 Bacteria 63565
3 JGI25154J39366_1000121 3300002738 Bacteria 62887
4 JGI25157J39369_1000130 3300002741 Bacteria 63360
5 JGI25150J39212_1001519 3300002774 Bacteria 6391
6 JGI25150J39212_1008535 3300002774 Bacteria 2000
7 JGI25159J45721_1000190 3300002987 Bacteria 28606
8 JGI25159J45721_1002986 3300002987 Bacteria 6144
9 JGI25151J46595_10018837 3300003187 Bacteria 2951
10 JGI25151J46595_10019083 3300003187 Bacteria 2923
11 JGI25153J46596_10002339 3300003215 Bacteria 10998
12 rootH1_10071182 3300003316 Bacteria 1986
13 rootL2_10086437 3300003322 Bacteria 1653
14 rootL2_10156818 3300003322 Bacteria 1335
15 JGI25160J50197_1000345 3300003354 Bacteria 30950
16 JGI25161J50226_1000007 3300003374 Bacteria 256181
17 Ga0055538_1000002 3300003751 Bacteria 999437
18 Ga0055539_1000002 3300003752 Bacteria 999437
19 Ga0055533_1000004 3300003756 Bacteria 999437
20 Ga0055525_1000002 3300003759 Bacteria 999437
21 Ga0055526_1000020 3300003771 Bacteria 188230
22 Ga0055526_1008255 3300003771 Bacteria 5230
23 Ga0055526_1012497 3300003771 Bacteria 3695
24 Ga0055526_1020106 3300003771 Bacteria 2395
25 Ga0055537_1000183 3300003773 Bacteria 46516
26 Ga0055537_1000254 3300003773 Bacteria 38945
27 Ga0055537_1006677 3300003773 Bacteria 2888
28 Ga0055524_1000101 3300003775 Bacteria 106527
29 Ga0055524_1000471 3300003775 Bacteria 32322
30 Ga0055536_1017457 3300003781 Bacteria 2348
31 Ga0055534_1001095 3300003784 Bacteria 11537
32 Ga0055534_1001577 3300003784 Bacteria 8856
33 Ga0055528_1001026 3300003790 Bacteria 18496
34 Ga0055530_10001334 3300003791 Bacteria 18475
35 Ga0055540_1000099 3300003792 Bacteria 96187
36 Ga0055531_10013122 3300003794 Bacteria 3844
37 Ga0055541_1000002 3300003841 Bacteria 896405
38 Ga0055543_1001205 3300004625 Bacteria 10864
39 Ga0065715_10049973 3300005293 Bacteria 1219
40 Ga0065707_10021263 3300005295 Bacteria 1443
41 Ga0065707_10025584 3300005295 Bacteria 1763
42 Ga0065707_10093320 3300005295 Bacteria 3643
43 Ga0070658_10221720 3300005327 Bacteria 1599
44 Ga0070676_10005475 3300005328 Bacteria 6762
45 Ga0070676_10054864 3300005328 Bacteria 2350
46 Ga0070676_10059423 3300005328 Bacteria 2267
47 Ga0070683_100043020 3300005329 Bacteria 4161
48 Ga0070690_100002075 3300005330 Bacteria 10702
49 Ga0070690_100043091 3300005330 Bacteria 2860
50 Ga0070670_100008340 3300005331 Bacteria 8832
51 Ga0070670_100146042 3300005331 Bacteria 2046
52 Ga0070670_100174832 3300005331 Bacteria 1863
53 Ga0070670_100286220 3300005331 Bacteria 1439
54 Ga0070666_10004654 3300005335 Bacteria 8378
55 Ga0068868_100003547 3300005338 Bacteria 10876
56 Ga0068868_100118838 3300005338 Bacteria 2155
57 Ga0068868_100176798 3300005338 Bacteria 1769
58 Ga0068868_100338209 3300005338 Bacteria 1286
59 Ga0070660_100057090 3300005339 Bacteria 3023
60 Ga0070689_100046642 3300005340 Bacteria 3339
61 Ga0070691_10102727 3300005341 Bacteria 1421
62 Ga0070661_100044865 3300005344 Bacteria 3230
63 Ga0070692_10200717 3300005345 Bacteria 1168
64 Ga0070668_100008228 3300005347 Bacteria 7744
65 Ga0070668_100069906 3300005347 Bacteria 2732
66 Ga0070669_100012786 3300005353 Bacteria 5959
67 Ga0070669_100036817 3300005353 Bacteria 3547
68 Ga0070669_100150414 3300005353 Bacteria 1802
69 Ga0070675_100019717 3300005354 Bacteria 5377
70 Ga0070675_100101870 3300005354 Bacteria 2419
71 Ga0070675_100111346 3300005354 Bacteria 2316
72 Ga0070675_100122376 3300005354 Bacteria 2211
73 Ga0070675_100191275 3300005354 Bacteria 1773
74 Ga0070675_100201967 3300005354 Bacteria 1725
75 Ga0070671_100005362 3300005355 Bacteria 10225
76 Ga0070671_100012210 3300005355 Bacteria 6909
77 Ga0070671_100033723 3300005355 Bacteria 4236
78 Ga0070671_100042851 3300005355 Bacteria 3763
79 Ga0070671_100073624 3300005355 Bacteria 2853
80 Ga0070671_100076416 3300005355 Bacteria 2798
81 Ga0070674_100004474 3300005356 Bacteria 7976
82 Ga0070674_100074001 3300005356 Bacteria 2416
83 Ga0070674_100109658 3300005356 Bacteria 2024
84 Ga0070674_100130689 3300005356 Bacteria 1871
85 Ga0070673_100000694 3300005364 Bacteria 18557
86 Ga0070673_100069049 3300005364 Bacteria 2831
87 Ga0070673_100078150 3300005364 Bacteria 2676
88 Ga0070673_100112208 3300005364 Bacteria 2263
89 Ga0070673_100260087 3300005364 Bacteria 1516
90 Ga0070688_100009318 3300005365 Bacteria 5365
91 Ga0070688_100038186 3300005365 Bacteria 2931
92 Ga0070659_100028990 3300005366 Bacteria 4277
93 Ga0070667_100010648 3300005367 Bacteria 7595
94 Ga0070667_100016789 3300005367 Bacteria 6057
95 Ga0070667_100051232 3300005367 Bacteria 3480
96 Ga0070667_100262524 3300005367 Bacteria 1547
97 Ga0070701_10030791 3300005438 Bacteria 2657
98 Ga0070701_10068255 3300005438 Bacteria 1894
99 Ga0070701_10093623 3300005438 Bacteria 1651
100 Ga0070705_100040144 3300005440 Bacteria 2660
101 Ga0070694_100004656 3300005444 Bacteria 8251
102 Ga0070694_100005264 3300005444 Bacteria 7820
103 Ga0070708_100000315 3300005445 Bacteria 36417
104 Ga0070708_100465395 3300005445 Bacteria 1193
105 Ga0070663_100071966 3300005455 Bacteria 2517
106 Ga0070678_100022799 3300005456 Bacteria 4158
107 Ga0070678_100128903 3300005456 Bacteria 2007
108 Ga0070678_100169129 3300005456 Bacteria 1778
109 Ga0070678_100242948 3300005456 Bacteria 1506
110 Ga0070662_100061938 3300005457 Bacteria 2732
111 Ga0070681_10199563 3300005458 Bacteria 1919
112 Ga0068867_100023179 3300005459 Bacteria 4443
113 Ga0068867_100047316 3300005459 Bacteria 3162
114 Ga0068867_100337972 3300005459 Bacteria 1253
115 Ga0070685_10211923 3300005466 Bacteria 1265
116 Ga0070706_100002711 3300005467 Bacteria 17718
117 Ga0070707_100175814 3300005468 Bacteria 2087
118 Ga0070707_100256972 3300005468 Bacteria 1700
119 Ga0070698_100131622 3300005471 Bacteria 2457
120 Ga0070698_100154513 3300005471 Bacteria 2240
121 Ga0070684_100203051 3300005535 Bacteria 1806
122 Ga0070684_100503726 3300005535 Bacteria 1121
123 Ga0068853_100061096 3300005539 Bacteria 3259
124 Ga0070672_100035426 3300005543 Bacteria 3794
125 Ga0070672_100100188 3300005543 Bacteria 2349
126 Ga0070672_100277629 3300005543 Bacteria 1416
127 Ga0070672_100280430 3300005543 Bacteria 1409
128 Ga0070686_100177796 3300005544 Bacteria 1510
129 Ga0070695_100041780 3300005545 Bacteria 2908
130 Ga0070696_100027522 3300005546 Bacteria 3874
131 Ga0070693_100001479 3300005547 Bacteria 10573
132 Ga0070693_100016391 3300005547 Bacteria 3835
133 Ga0070665_100053512 3300005548 Bacteria 4048
134 Ga0070665_100119200 3300005548 Bacteria 2641
135 Ga0070665_100216738 3300005548 Bacteria 1915
136 Ga0070704_100018982 3300005549 Bacteria 4411
137 Ga0070704_100028056 3300005549 Bacteria 3740
138 Ga0070704_100034749 3300005549 Bacteria 3421
139 Ga0070704_100124000 3300005549 Bacteria 1990
140 Ga0068855_100000046 3300005563 Bacteria 147225
141 Ga0068855_100034097 3300005563 Bacteria 6073
142 Ga0070664_100031391 3300005564 Bacteria 4438
143 Ga0070664_100047904 3300005564 Bacteria 3612
144 Ga0070664_100121069 3300005564 Bacteria 2291
145 Ga0068857_100052496 3300005577 Bacteria 3617
146 Ga0068857_100066359 3300005577 Bacteria 3211
147 Ga0068857_100078704 3300005577 Bacteria 2942
148 Ga0068854_100038067 3300005578 Bacteria 3380
149 Ga0068854_100091832 3300005578 Bacteria 2260
150 Ga0068856_100027043 3300005614 Bacteria 5596
151 Ga0068856_100107861 3300005614 Bacteria 2781
152 Ga0070702_100131219 3300005615 Bacteria 1583
153 Ga0068852_100070416 3300005616 Bacteria 3068
154 Ga0068852_100282928 3300005616 Bacteria 1599
155 Ga0068852_100406297 3300005616 Bacteria 1340
156 Ga0068859_100023632 3300005617 Bacteria 6169
157 Ga0068859_100044579 3300005617 Bacteria 4457
158 Ga0068864_100000351 3300005618 Bacteria 40447
159 Ga0068864_100027130 3300005618 Bacteria 4833
160 Ga0068864_100116200 3300005618 Bacteria 2387
161 Ga0068866_10063236 3300005718 Bacteria 1929
162 Ga0068866_10183807 3300005718 Bacteria 1237
163 Ga0068861_100002726 3300005719 Bacteria 11573
164 Ga0068851_10020708 3300005834 Bacteria 3187
165 Ga0068851_10030875 3300005834 Bacteria 2659
166 Ga0068851_10064987 3300005834 Bacteria 1876
167 Ga0068851_10101875 3300005834 Bacteria 1525
168 Ga0068851_10119175 3300005834 Bacteria 1417
169 Ga0068863_100002991 3300005841 Bacteria 16705
170 Ga0068863_100093690 3300005841 Bacteria 2850
171 Ga0068858_100000729 3300005842 Bacteria 34410
172 Ga0068858_100003527 3300005842 Bacteria 15491
173 Ga0068858_100007317 3300005842 Bacteria 10689
174 Ga0068858_100030103 3300005842 Bacteria 5041
175 Ga0068858_100159500 3300005842 Bacteria 2124
176 Ga0068858_100201199 3300005842 Bacteria 1884
177 Ga0068860_100002318 3300005843 Bacteria 20001
178 Ga0068860_100020683 3300005843 Bacteria 6375
179 Ga0068860_100020950 3300005843 Bacteria 6335
180 Ga0068860_100060223 3300005843 Bacteria 3608
181 Ga0068860_100103009 3300005843 Bacteria 2724
182 Ga0068860_100145922 3300005843 Bacteria 2277
183 Ga0081455_10055091 3300005937 Bacteria 3384
184 Ga0081455_10099808 3300005937 Bacteria 2334
185 Ga0081539_10071773 3300005985 Bacteria 1853
186 Ga0075365_10063964 3300006038 Bacteria 2463
187 Ga0075363_100152511 3300006048 Bacteria 1305
188 Ga0075364_10039346 3300006051 Bacteria 3065
189 Ga0075364_10095096 3300006051 Bacteria 1980
190 Ga0075432_10005083 3300006058 Bacteria 4481
191 Ga0075362_10043772 3300006177 Bacteria 1983
192 Ga0075367_10133118 3300006178 Bacteria 1538
193 Ga0075366_10022146 3300006195 Bacteria 3695
194 Ga0075366_10058455 3300006195 Bacteria 2290
195 Ga0075366_10059689 3300006195 Bacteria 2265
196 Ga0075366_10117996 3300006195 Bacteria 1598
197 Ga0097621_100005396 3300006237 Bacteria 9010
198 Ga0097621_100009828 3300006237 Bacteria 6964
199 Ga0097621_100065188 3300006237 Bacteria 2997
200 Ga0097621_100065508 3300006237 Bacteria 2990
201 Ga0097621_100155137 3300006237 Bacteria 1965
202 Ga0097621_100158974 3300006237 Bacteria 1941
203 Ga0075370_10001530 3300006353 Bacteria 10118
204 Ga0075370_10001898 3300006353 Bacteria 9394
205 Ga0075370_10003975 3300006353 Bacteria 7105
206 Ga0068871_100012921 3300006358 Bacteria 6183
207 Ga0068871_100056592 3300006358 Bacteria 3188
208 Ga0068871_100072962 3300006358 Bacteria 2828
209 Ga0068871_100346266 3300006358 Bacteria 1313
210 Ga0075428_100061865 3300006844 Bacteria 4099
211 Ga0075428_100145137 3300006844 Bacteria 2579
212 Ga0075428_100348057 3300006844 Bacteria 1591
213 Ga0075430_100071766 3300006846 Bacteria 2904
214 Ga0075430_100250233 3300006846 Bacteria 1468
215 Ga0075431_100189735 3300006847 Bacteria 2106
216 Ga0075433_10192723 3300006852 Bacteria 1813
217 Ga0075429_100189647 3300006880 Bacteria 1801
218 Ga0068865_100025960 3300006881 Bacteria 3859
219 Ga0075436_100112267 3300006914 Bacteria 1903
220 Ga0097620_100023632 3300006931 Bacteria 6169
221 Ga0097620_100044579 3300006931 Bacteria 4457
222 Ga0099826_10181283 3300006948 Bacteria 1171
223 Ga0105240_10112430 3300009093 Bacteria 3292
224 Ga0105240_10331093 3300009093 Bacteria 1733
225 Ga0111539_10002368 3300009094 Bacteria 25057
226 Ga0111539_10122371 3300009094 Bacteria 3049
227 Ga0111539_10144487 3300009094 Bacteria 2785
228 Ga0105245_10059808 3300009098 Bacteria 3431
229 Ga0105245_10150428 3300009098 Bacteria 2200
230 Ga0105243_10098763 3300009148 Bacteria 2419
231 Ga0105243_10130233 3300009148 Bacteria 2133
232 Ga0105241_10138049 3300009174 Bacteria 1982
233 Ga0105241_10290324 3300009174 Bacteria 1400
234 Ga0105242_10013179 3300009176 Bacteria 6381
235 Ga0105242_10022167 3300009176 Bacteria 4991
236 Ga0105242_10067299 3300009176 Bacteria 2961
237 Ga0105242_10205197 3300009176 Bacteria 1753
238 Ga0105248_10061085 3300009177 Bacteria 4230
239 Ga0105248_10091165 3300009177 Bacteria 3433
240 Ga0105248_10123781 3300009177 Bacteria 2917
241 Ga0105248_10207135 3300009177 Bacteria 2210
242 Ga0105237_10020547 3300009545 Bacteria 6805
243 Ga0105238_10000917 3300009551 Bacteria 30127
244 Ga0105238_10025045 3300009551 Bacteria 6082
245 Ga0105238_10244185 3300009551 Bacteria 1773
246 Ga0105249_10016622 3300009553 Bacteria 6531
247 Ga0105249_10038399 3300009553 Bacteria 4345
248 Ga0105249_10260785 3300009553 Bacteria 1722
249 Ga0105239_10054317 3300010375 Bacteria 4393
250 Ga0157373_10037647 3300013100 Bacteria 3467
251 Ga0157371_10160387 3300013102 Bacteria 1606
252 Ga0157369_10100400 3300013105 Bacteria 3085
253 Ga0157374_10016933 3300013296 Bacteria 6416
254 Ga0157378_10090108 3300013297 Bacteria 2787
255 Ga0163162_10002191 3300013306 Bacteria 18337
256 Ga0163162_10026458 3300013306 Bacteria 5732
257 Ga0163162_10033724 3300013306 Bacteria 5088
258 Ga0163162_10048294 3300013306 Bacteria 4264
259 Ga0163162_10049807 3300013306 Bacteria 4199
260 Ga0157372_10047788 3300013307 Bacteria 4756
261 Ga0157375_10012843 3300013308 Bacteria 7438
262 Ga0157375_10059291 3300013308 Bacteria 3791
263 Ga0157375_10367720 3300013308 Bacteria 1604
264 Ga0163163_10005668 3300014325 Bacteria 10830
265 Ga0163163_10029776 3300014325 Bacteria 5253
266 Ga0157380_10154758 3300014326 Bacteria 1986
267 Ga0157380_10157950 3300014326 Bacteria 1967
268 Ga0157377_10137467 3300014745 Bacteria 1499
269 Ga0157379_10004055 3300014968 Bacteria 12495
270 Ga0157379_10112884 3300014968 Bacteria 2442
271 Ga0157379_10148229 3300014968 Bacteria 2116
272 Ga0157376_10047037 3300014969 Bacteria 3561
273 Ga0157376_10049589 3300014969 Bacteria 3478
274 Ga0182006_1010159 3300015261 Bacteria 4195
275 Ga0183362_10002 3300015683 Bacteria 1432711
276 Ga0163161_10021414 3300017792 Bacteria 4544
277 Ga0163161_10079810 3300017792 Bacteria 2407
278 Ga0213872_10000309 3300021361 Bacteria 41727
279 Ga0213872_10020490 3300021361 Bacteria 3048
280 Ga0209435_100008 3300025206 Bacteria 503644
281 Ga0209436_107453 3300025208 Bacteria 2284
282 Ga0209784_100002 3300025224 Bacteria 1753105
283 Ga0209566_100003 3300025225 Bacteria 1753105
284 Ga0209674_100004 3300025226 Bacteria 1753105
285 Ga0209563_100006 3300025230 Bacteria 1753105
286 Ga0207425_1000606 3300025245 Bacteria 20792
287 Ga0207425_1014645 3300025245 Bacteria 1776
288 Ga0209646_1000079 3300025246 Bacteria 207677
289 Ga0209026_1000067 3300025250 Bacteria 207677
290 Ga0209677_100003 3300025253 Bacteria 1753105
291 Ga0209759_1000056 3300025256 Bacteria 207677
292 Ga0209129_1007932 3300025258 Bacteria 3047
293 Ga0209565_1000041 3300025263 Bacteria 251081
294 Ga0209565_1000849 3300025263 Bacteria 17247
295 Ga0209673_1000012 3300025273 Bacteria 579480
296 Ga0209130_1000014 3300025284 Bacteria 412039
297 Ga0209130_1000184 3300025284 Bacteria 87817
298 Ga0207673_1007572 3300025290 Bacteria 1364
299 Ga0209675_1000475 3300025291 Bacteria 30742
300 Ga0209675_1000771 3300025291 Bacteria 21464
301 Ga0209675_1007151 3300025291 Bacteria 4330
302 Ga0209676_1000013 3300025292 Bacteria 816080
303 Ga0209676_1003804 3300025292 Bacteria 8920
304 Ga0209676_1004437 3300025292 Bacteria 7827
305 Ga0209676_1004828 3300025292 Bacteria 7319
306 Ga0209564_1001251 3300025295 Bacteria 28255
307 Ga0209564_1001414 3300025295 Bacteria 24743
308 Ga0209564_1006578 3300025295 Bacteria 6234
309 Ga0209758_1001500 3300025297 Bacteria 27142
310 Ga0209758_1006824 3300025297 Bacteria 8001
311 Ga0209050_1000008 3300025298 Bacteria 1144179
312 Ga0209050_1003807 3300025298 Bacteria 10766
313 Ga0209050_1004622 3300025298 Bacteria 9190
314 Ga0209050_1013208 3300025298 Bacteria 3692
315 Ga0209256_1000003 3300025299 Bacteria 1661127
316 Ga0209256_1037408 3300025299 Bacteria 1264
317 Ga0207426_1000091 3300025302 Bacteria 280561
318 Ga0209051_1000005 3300025303 Bacteria 1142353
319 Ga0209051_1003394 3300025303 Bacteria 10450
320 Ga0209257_1000048 3300025304 Bacteria 455536
321 Ga0207697_10003156 3300025315 Bacteria 8217
322 Ga0207656_10018982 3300025321 Bacteria 2715
323 Ga0207656_10019459 3300025321 Bacteria 2686
324 Ga0207656_10057726 3300025321 Bacteria 1694
325 Ga0207656_10087617 3300025321 Bacteria 1408
326 Ga0207682_10012204 3300025893 Bacteria 3354
327 Ga0207680_10002176 3300025903 Bacteria 9180
328 Ga0207645_10013887 3300025907 Bacteria 5403
329 Ga0207645_10040010 3300025907 Bacteria 3003
330 Ga0207645_10087083 3300025907 Bacteria 2007
331 Ga0207643_10059044 3300025908 Bacteria 2188
332 Ga0207643_10081964 3300025908 Bacteria 1870
333 Ga0207705_10221420 3300025909 Bacteria 1438
334 Ga0207654_10162794 3300025911 Bacteria 1442
335 Ga0207707_10165411 3300025912 Bacteria 1933
336 Ga0207695_10001065 3300025913 Bacteria 48010
337 Ga0207695_10012472 3300025913 Bacteria 10200
338 Ga0207695_10081043 3300025913 Bacteria 3286
339 Ga0207695_10127174 3300025913 Bacteria 2509
340 Ga0207671_10011643 3300025914 Bacteria 7137
341 Ga0207660_10171494 3300025917 Bacteria 1680
342 Ga0207662_10091275 3300025918 Bacteria 1874
343 Ga0207657_10087855 3300025919 Bacteria 2600
344 Ga0207649_10001848 3300025920 Bacteria 12101
345 Ga0207652_10020652 3300025921 Bacteria 5427
346 Ga0207646_10102106 3300025922 Bacteria 2571
347 Ga0207681_10060356 3300025923 Bacteria 2603
348 Ga0207681_10132286 3300025923 Bacteria 1846
349 Ga0207694_10000446 3300025924 Bacteria 38303
350 Ga0207694_10021587 3300025924 Bacteria 4879
351 Ga0207694_10084479 3300025924 Bacteria 2497
352 Ga0207650_10000970 3300025925 Bacteria 21577
353 Ga0207650_10007280 3300025925 Bacteria 7535
354 Ga0207650_10021249 3300025925 Bacteria 4588
355 Ga0207659_10000781 3300025926 Bacteria 18812
356 Ga0207659_10005370 3300025926 Bacteria 7762
357 Ga0207659_10017024 3300025926 Bacteria 4743
358 Ga0207659_10022515 3300025926 Bacteria 4196
359 Ga0207659_10063619 3300025926 Bacteria 2667
360 Ga0207659_10184227 3300025926 Bacteria 1657
361 Ga0207687_10067989 3300025927 Bacteria 2536
362 Ga0207687_10145697 3300025927 Bacteria 1802
363 Ga0207644_10000899 3300025931 Bacteria 18825
364 Ga0207644_10003807 3300025931 Bacteria 9770
365 Ga0207644_10013865 3300025931 Bacteria 5383
366 Ga0207644_10041525 3300025931 Bacteria 3254
367 Ga0207644_10162676 3300025931 Bacteria 1736
368 Ga0207644_10332590 3300025931 Bacteria 1230
369 Ga0207690_10011751 3300025932 Bacteria 5237
370 Ga0207706_10095355 3300025933 Bacteria 2617
371 Ga0207686_10001268 3300025934 Bacteria 14522
372 Ga0207686_10003551 3300025934 Bacteria 8367
373 Ga0207686_10006148 3300025934 Bacteria 6450
374 Ga0207686_10006189 3300025934 Bacteria 6433
375 Ga0207686_10096621 3300025934 Bacteria 1963
376 Ga0207686_10120740 3300025934 Bacteria 1783
377 Ga0207709_10029914 3300025935 Bacteria 3164
378 Ga0207669_10010778 3300025937 Bacteria 4416
379 Ga0207669_10019707 3300025937 Bacteria 3520
380 Ga0207669_10121296 3300025937 Bacteria 1775
381 Ga0207704_10032343 3300025938 Bacteria 2959
382 Ga0207704_10138846 3300025938 Bacteria 1696
383 Ga0207691_10000699 3300025940 Bacteria 33182
384 Ga0207691_10002051 3300025940 Bacteria 19693
385 Ga0207691_10013535 3300025940 Bacteria 7802
386 Ga0207691_10043113 3300025940 Bacteria 4159
387 Ga0207691_10062341 3300025940 Bacteria 3384
388 Ga0207691_10077728 3300025940 Bacteria 2989
389 Ga0207691_10091581 3300025940 Bacteria 2724
390 Ga0207691_10130672 3300025940 Bacteria 2219
391 Ga0207691_10286073 3300025940 Bacteria 1418
392 Ga0207711_10088590 3300025941 Bacteria 2718
393 Ga0207711_10131505 3300025941 Bacteria 2244
394 Ga0207689_10008871 3300025942 Bacteria 8727
395 Ga0207689_10012877 3300025942 Bacteria 7144
396 Ga0207689_10043811 3300025942 Bacteria 3699
397 Ga0207689_10062550 3300025942 Bacteria 3061
398 Ga0207689_10066991 3300025942 Bacteria 2951
399 Ga0207689_10093104 3300025942 Bacteria 2475
400 Ga0207679_10015442 3300025945 Bacteria 5046
401 Ga0207679_10185577 3300025945 Bacteria 1724
402 Ga0207679_10241447 3300025945 Bacteria 1531
403 Ga0207667_10000036 3300025949 Bacteria 297966
404 Ga0207667_10053810 3300025949 Bacteria 4234
405 Ga0207651_10005355 3300025960 Bacteria 6581
406 Ga0207651_10074131 3300025960 Bacteria 2423
407 Ga0207651_10180655 3300025960 Bacteria 1673
408 Ga0207712_10073144 3300025961 Bacteria 2471
409 Ga0207712_10240967 3300025961 Bacteria 1457
410 Ga0207668_10006822 3300025972 Bacteria 6767
411 Ga0207668_10161281 3300025972 Bacteria 1747
412 Ga0207640_10021988 3300025981 Bacteria 3810
413 Ga0207640_10103223 3300025981 Bacteria 2004
414 Ga0207640_10234851 3300025981 Bacteria 1413
415 Ga0207658_10022502 3300025986 Bacteria 4389
416 Ga0207677_10008047 3300026023 Bacteria 5869
417 Ga0207677_10014636 3300026023 Bacteria 4589
418 Ga0207677_10125202 3300026023 Bacteria 1941
419 Ga0207703_10002007 3300026035 Bacteria 17969
420 Ga0207703_10017382 3300026035 Bacteria 5615
421 Ga0207703_10030390 3300026035 Bacteria 4269
422 Ga0207703_10077061 3300026035 Bacteria 2767
423 Ga0207639_10091133 3300026041 Bacteria 2440
424 Ga0207678_10024103 3300026067 Bacteria 5317
425 Ga0207678_10074208 3300026067 Bacteria 2915
426 Ga0207702_10014485 3300026078 Bacteria 6548
427 Ga0207702_10042536 3300026078 Bacteria 3811
428 Ga0207702_10143889 3300026078 Bacteria 2161
429 Ga0207641_10028000 3300026088 Bacteria 4654
430 Ga0207648_10000556 3300026089 Bacteria 41762
431 Ga0207648_10027677 3300026089 Bacteria 5031
432 Ga0207648_10071974 3300026089 Bacteria 3013
433 Ga0207648_10143811 3300026089 Bacteria 2103
434 Ga0207648_10283153 3300026089 Bacteria 1483
435 Ga0207676_10002172 3300026095 Bacteria 14148
436 Ga0207676_10047336 3300026095 Bacteria 3332
437 Ga0207676_10051685 3300026095 Bacteria 3209
438 Ga0207674_10022936 3300026116 Bacteria 6696
439 Ga0207675_100002028 3300026118 Bacteria 20196
440 Ga0207683_10019395 3300026121 Bacteria 5807
441 Ga0207683_10086108 3300026121 Bacteria 2793
442 Ga0207683_10251362 3300026121 Bacteria 1613
443 Ga0207698_10176448 3300026142 Bacteria 1887
444 Ga0209969_1011759 3300027360 Bacteria 1259
445 Ga0209981_1008816 3300027378 Bacteria 1371
446 Ga0209966_1018790 3300027695 Bacteria 1326
447 Ga0207428_10015146 3300027907 Bacteria 6673
448 Ga0207428_10038230 3300027907 Bacteria 3902
449 Ga0268265_10133883 3300028380 Bacteria 2064
450 Ga0268265_10134579 3300028380 Bacteria 2060
451 Ga0268265_10219514 3300028380 Bacteria 1662
452 Ga0268265_10357048 3300028380 Bacteria 1336
453 Ga0268264_10017825 3300028381 Bacteria 5812
454 Ga0268264_10018647 3300028381 Bacteria 5673
455 Ga0268264_10146873 3300028381 Bacteria 2110
456 Ga0307517_10009075 3300028786 Bacteria 14168
457 Ga0307517_10047929 3300028786 Bacteria 4412
458 Ga0307515_10000049 3300028794 Bacteria 278611
459 Ga0307515_10000485 3300028794 Bacteria 94915
460 Ga0307515_10028979 3300028794 Bacteria 9381
461 Ga0307515_10040590 3300028794 Bacteria 7353
462 Ga0307515_10116866 3300028794 Bacteria 3058
463 Ga0265332_10003549 3300031238 Bacteria 7501
464 Ga0265328_10072432 3300031239 Bacteria 1267
465 Ga0307513_10002838 3300031456 Bacteria 23744
466 Ga0307513_10004164 3300031456 Bacteria 19364
467 Ga0307513_10105397 3300031456 Bacteria 2829
468 Ga0307513_10151350 3300031456 Bacteria 2228
469 Ga0307509_10000092 3300031507 Bacteria 124019
470 Ga0307509_10002037 3300031507 Bacteria 33298
471 Ga0307509_10042928 3300031507 Bacteria 4896
472 Ga0307408_100002928 3300031548 Bacteria 11829
473 Ga0307408_100012702 3300031548 Bacteria 5585
474 Ga0307408_100033563 3300031548 Bacteria 3587
475 Ga0307408_100054287 3300031548 Bacteria 2897
476 Ga0307408_100134940 3300031548 Bacteria 1930
477 Ga0307508_10001131 3300031616 Bacteria 30761
478 Ga0307508_10003490 3300031616 Bacteria 15867
479 Ga0307514_10000200 3300031649 Bacteria 167194
480 Ga0307514_10000225 3300031649 Bacteria 151002
481 Ga0265314_10001584 3300031711 Bacteria 25021
482 Ga0307516_10000921 3300031730 Bacteria 40429
483 Ga0307405_10020379 3300031731 Bacteria 3704
484 Ga0307413_10034040 3300031824 Bacteria 2908
485 Ga0307413_10035752 3300031824 Bacteria 2853
486 Ga0307413_10136874 3300031824 Bacteria 1686
487 Ga0307410_10019217 3300031852 Bacteria 4151
488 Ga0307410_10022308 3300031852 Bacteria 3911
489 Ga0307406_10003971 3300031901 Bacteria 8041
490 Ga0307406_10010157 3300031901 Bacteria 5304
491 Ga0307407_10064951 3300031903 Bacteria 2147
492 Ga0307407_10141455 3300031903 Bacteria 1553
493 Ga0307412_10000555 3300031911 Bacteria 22198
494 Ga0307412_10066780 3300031911 Bacteria 2439
495 Ga0307412_10084366 3300031911 Bacteria 2205
496 Ga0307409_100000467 3300031995 Bacteria 17264
497 Ga0307409_100465647 3300031995 Bacteria 1223
498 Ga0307416_100106798 3300032002 Bacteria 2455
499 Ga0307416_100120510 3300032002 Bacteria 2336
500 Ga0307416_100144348 3300032002 Bacteria 2170
501 Ga0307414_10071742 3300032004 Bacteria 2499
502 Ga0307411_10005170 3300032005 Bacteria 6380
503 Ga0307411_10021368 3300032005 Bacteria 3786
504 Ga0307411_10051162 3300032005 Bacteria 2694
505 Ga0307411_10116765 3300032005 Bacteria 1922
506 Ga0307415_100009800 3300032126 Bacteria 5393
507 Ga0307415_100235268 3300032126 Bacteria 1478
508 Ga0307510_10001210 3300033180 Bacteria 27978
509 Ga0373943_0148996 3300035170 Bacteria 1266
510 Ga0373955_0194819 3300035172 Bacteria 1206
511 Ga0373931_0040703 3300035691 Bacteria 2439
512 Ga0373927_0032741 3300035695 Bacteria 3386
513 Ga0373933_0243830 3300035724 Bacteria 1156
514 Ga0373947_0027386 3300035725 Bacteria 3336
515 Ga0373937_0494548 3300036401 Bacteria 1162
516 Ga0373925_0010856 3300037068 Bacteria 6606
517 Ga0373925_0027694 3300037068 Bacteria 4148
518 Ga0373925_0224749 3300037068 Bacteria 1499
519 Ga0395900_0089243 3300037418 Bacteria 3169
520 Ga0395900_0131119 3300037418 Bacteria 2569
521 Ga0395905_0000047 3300037471 Bacteria 237582
522 Ga0395905_0001267 3300037471 Bacteria 31206
523 Ga0395905_0003737 3300037471 Bacteria 16126
524 Ga0395905_0016587 3300037471 Bacteria 7000
525 Ga0395905_0020586 3300037471 Bacteria 6246
526 Ga0436365_0761091 3300039437 Bacteria 1133
527 Ga0436365_1311379 3300039437 Bacteria 4381
528 Ga0436361_0236312 3300039447 Bacteria 14640
529 Ga0436361_0545923 3300039447 Bacteria 57292
530 Ga0436361_0782766 3300039447 Bacteria 5609
531 Ga0439431_0002520 3300041997 Bacteria 4050
532 Ga0439448_0048187 3300042005 Bacteria 1391
533 Ga0450911_000410 3300042115 Bacteria 14168
534 Ga0439435_0000488 3300042436 Bacteria 6305
535 Ga0439460_0012015 3300042461 Bacteria 2239
536 Ga0451577_0005487 3300042876 Bacteria 12985
537 Ga0451577_0101670 3300042876 Bacteria 2568
538 Ga0466969_0035807 3300044656 Bacteria 2509
539 Ga0453683_0214985 3300044673 Bacteria 1222
540 Ga0453684_0033003 3300044712 Bacteria 7226
541 Ga0453684_0038319 3300044712 Bacteria 6556
542 Ga0453684_0082011 3300044712 Bacteria 4019
543 Ga0466971_0057708 3300044719 Bacteria 1752
544 Ga0495592_0000413 3300046454 Bacteria 32677
545 Ga0495629_0022966 3300046459 Bacteria 4446
546 Ga0495580_0065960 3300046472 Bacteria 2535
547 Ga0495580_0068885 3300046472 Bacteria 2473
548 Ga0495607_0000386 3300046501 Bacteria 45031
549 Ga0495608_0050822 3300046511 Bacteria 2750
550 Ga0495632_0005226 3300046519 Bacteria 8651
551 Ga0495632_0012832 3300046519 Bacteria 4809
552 Ga0495666_0024170 3300046526 Bacteria 3003
553 Ga0495652_0130108 3300046529 Bacteria 1994
554 Ga0495654_0005706 3300046530 Bacteria 7177
555 Ga0495654_0093560 3300046530 Bacteria 1392
556 Ga0495621_0002601 3300046539 Bacteria 4874
557 Ga0495597_0000116 3300046542 Bacteria 72210
558 Ga0495645_0038509 3300046543 Bacteria 3487
559 Ga0495633_0003149 3300046558 Bacteria 11172
560 Ga0495668_0039347 3300046616 Bacteria 2640
561 Ga0495634_0089188 3300046642 Bacteria 2005
562 Ga0495599_0146676 3300046678 Bacteria 1462
563 Ga0495647_0082743 3300046681 Bacteria 1304
564 Ga0495658_0037329 3300046683 Bacteria 2685
565 Ga0495658_0141810 3300046683 Bacteria 1470
566 Ga0495658_0150575 3300046683 Bacteria 1429
567 Ga0495669_0022259 3300046684 Bacteria 2753
568 Ga0495613_0107558 3300046689 Bacteria 2012
569 Ga0495636_0009989 3300047318 Bacteria 3741
570 Ga0495674_0019794 3300047319 Bacteria 6241
571 Ga0495687_001245 3300047443 Bacteria 24266
572 Ga0495687_007634 3300047443 Bacteria 6335
573 Ga0495681_0025029 3300047470 Bacteria 3129
574 Ga0495686_0002020 3300047472 Bacteria 20040
575 Ga0495593_0103305 3300047673 Bacteria 1460
576 Ga0495615_0003944 3300048090 Bacteria 2539
577 Ga0496108_0108107 3300048911 Bacteria 2376
578 Ga0496108_0195632 3300048911 Bacteria 1753
579 Ga0496108_0243596 3300048911 Bacteria 1564
580 Ga0496109_0398109 3300048912 Bacteria 1301
581 Ga0496113_0174977 3300048916 Bacteria 1701
582 Ga0496116_0007062 3300048919 Bacteria 10056
583 Ga0496116_0127692 3300048919 Bacteria 1456
584 Ga0496118_0005733 3300048921 Bacteria 13970
585 Ga0496118_0047398 3300048921 Bacteria 3330
586 Ga0496119_0007271 3300048922 Bacteria 10017
587 Ga0496120_0002111 3300048923 Bacteria 21276
588 Ga0496121_0000127 3300048924 Bacteria 168545
589 Ga0496121_0002444 3300048924 Bacteria 28404
590 Ga0496122_0000573 3300048925 Bacteria 75439
591 Ga0496122_0002372 3300048925 Bacteria 26975
592 Ga0496123_0000108 3300048926 Bacteria 166102
593 Ga0496123_0002762 3300048926 Bacteria 21000
594 Ga0496123_0009770 3300048926 Bacteria 8575
595 Ga0496124_0052937 3300048927 Bacteria 3445
596 Ga0496124_0078600 3300048927 Bacteria 2718
597 Ga0496125_0000011 3300048928 Bacteria 655895
598 Ga0496125_0012601 3300048928 Bacteria 8377
599 Ga0496125_0027391 3300048928 Bacteria 5166
600 Ga0496125_0034967 3300048928 Bacteria 4419
601 Ga0496126_0093146 3300048929 Bacteria 2646
602 Ga0501033_0074063 3300049570 Bacteria 2500
603 Ga0501034_0029758 3300049571 Bacteria 5552
604 Ga0501036_0104223 3300049572 Bacteria 2399
605 Ga0501046_0030512 3300049580 Bacteria 4375
606 Ga0501048_0199312 3300049582 Bacteria 1419
607 Ga0501048_0260631 3300049582 Bacteria 1232
608 Ga0501076_0066908 3300049592 Bacteria 2869
609 Ga0501235_021491 3300049669 Bacteria 1435
610 Ga0501257_015645 3300049686 Bacteria 1754
611 Ga0501079_0146853 3300049741 Bacteria 1838
612 Ga0501045_0200445 3300049824 Bacteria 1487
613 nmdc:mga03683_7427_c1 3300050489 Bacteria 3804
614 nmdc:mga00v17_18949_c1 3300050491 Bacteria 3918
615 nmdc:mga0k408_13244_c1 3300050493 Bacteria 4520
616 nmdc:mga0k408_20974_c1 3300050493 Bacteria 3666
617 nmdc:mga0k408_73943_c1 3300050493 Bacteria 1991
618 nmdc:mga07m45_122280_c1 3300050496 Bacteria 1504
619 nmdc:mga07m45_17054_c1 3300050496 Bacteria 3894
620 nmdc:mga07m45_38373_c1 3300050496 Bacteria 2673
621 nmdc:mga07m45_39965_c1 3300050496 Bacteria 2624
622 nmdc:mga07m45_9523_c1 3300050496 Bacteria 5042
623 nmdc:mga05p37_10060_c1 3300050507 Bacteria 11226
624 nmdc:mga05p37_170371_c1 3300050507 Bacteria 2655
625 nmdc:mga09592_101942_c1 3300050508 Bacteria 2459
626 nmdc:mga0qj67_160894_c1 3300050509 Bacteria 1823
627 nmdc:mga0qj67_33522_c1 3300050509 Bacteria 4007
628 nmdc:mga0qj67_54326_c1 3300050509 Bacteria 3172
629 nmdc:mga06r32_130038_c1 3300050510 Bacteria 2489
630 nmdc:mga06r32_231916_c1 3300050510 Bacteria 1834
631 nmdc:mga08y16_18948_c1 3300050511 Bacteria 7247
632 nmdc:mga08y16_235643_c1 3300050511 Bacteria 1893
633 nmdc:mga0n895_369939_c1 3300050512 Bacteria 1451
634 nmdc:mga0n895_96729_c1 3300050512 Bacteria 1494
635 nmdc:mga0a205_71671_c1 3300050515 Bacteria 3347
636 nmdc:mga0sz30_22786_c1 3300050516 Bacteria 2544
637 Ga0495601_0008116 3300053077 Bacteria 6191
638 Ga0495612_0063127 3300053078 Bacteria 1536
639 Ga0495595_0065371 3300053084 Bacteria 1711
640 Ga0500644_0003026 3300053088 Bacteria 4170
641 Ga0500644_0006672 3300053088 Bacteria 2969
642 Ga0500644_0016547 3300053088 Bacteria 2124
643 Ga0500583_0027257 3300053092 Bacteria 2465
644 Ga0500651_0130431 3300053093 Bacteria 1521
645 Ga0500650_0027497 3300053098 Bacteria 2560
646 Ga0500562_017882 3300053108 Bacteria 1830
647 Ga0500593_000168 3300053117 Bacteria 26386
648 Ga0500594_0019549 3300053118 Bacteria 1680
649 Ga0500652_029551 3300053131 Bacteria 2138
650 Ga0500559_0000017 3300053136 Bacteria 143646
651 Ga0500559_0009195 3300053136 Bacteria 4289
652 Ga0500568_0023455 3300053139 Bacteria 2624
653 Ga0500568_0028241 3300053139 Bacteria 2340
654 Ga0500604_0012271 3300053151 Bacteria 2312
655 Ga0500622_0002180 3300053156 Bacteria 14473
656 Ga0500622_0014643 3300053156 Bacteria 4206
657 Ga0500622_0080851 3300053156 Bacteria 1627
658 Ga0500645_000333 3300053730 Bacteria 33591
659 Ga0500645_003191 3300053730 Bacteria 6811
660 Ga0500645_004530 3300053730 Bacteria 5302
661 Ga0500661_000690 3300055283 Bacteria 6340

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0260631 Ga0501048_0260631_12_863 283
2 3300050496 nmdc:mga07m45_122280_c1 nmdc:mga07m45_122280_c1_286_1335 304
3 3300005937 Ga0081455_10099808 Ga0081455_100998081 309
4 3300047318 Ga0495636_0009989 Ga0495636_0009989_138_1166 316
5 3300005548 Ga0070665_100216738 Ga0070665_1002167382 317
6 3300005563 Ga0068855_100000046 Ga0068855_10000004617 317
7 3300005834 Ga0068851_10030875 Ga0068851_100308753 317
8 3300009545 Ga0105237_10020547 Ga0105237_100205472 317
9 3300009551 Ga0105238_10000917 Ga0105238_1000091712 317
10 3300015261 Ga0182006_1010159 Ga0182006_10101592 317
11 3300025321 Ga0207656_10087617 Ga0207656_100876171 317
12 3300025913 Ga0207695_10001065 Ga0207695_1000106524 317
13 3300025924 Ga0207694_10000446 Ga0207694_1000044622 317
14 3300025949 Ga0207667_10000036 Ga0207667_10000036102 317
15 3300003751 Ga0055538_1000002 Ga0055538_1000002461 318
16 3300003752 Ga0055539_1000002 Ga0055539_1000002461 318
17 3300003756 Ga0055533_1000004 Ga0055533_1000004461 318
18 3300003759 Ga0055525_1000002 Ga0055525_1000002461 318
19 3300003841 Ga0055541_1000002 Ga0055541_1000002381 318
20 3300025224 Ga0209784_100002 Ga0209784_100002690 318
21 3300025225 Ga0209566_100003 Ga0209566_100003690 318
22 3300025226 Ga0209674_100004 Ga0209674_100004690 318
23 3300025230 Ga0209563_100006 Ga0209563_100006690 318
24 3300025253 Ga0209677_100003 Ga0209677_100003690 318
25 3300039447 Ga0436361_0236312 Ga0436361_0236312_1916_2950 318
26 3300005338 Ga0068868_100118838 Ga0068868_1001188382 320
27 3300005364 Ga0070673_100260087 Ga0070673_1002600872 320
28 3300005466 Ga0070685_10211923 Ga0070685_102119232 320
29 3300005544 Ga0070686_100177796 Ga0070686_1001777962 320
30 3300005547 Ga0070693_100001479 Ga0070693_1000014796 320
31 3300005842 Ga0068858_100159500 Ga0068858_1001595001 320
32 3300005843 Ga0068860_100145922 Ga0068860_1001459223 320
33 3300006237 Ga0097621_100005396 Ga0097621_1000053967 320
34 3300006237 Ga0097621_100158974 Ga0097621_1001589742 320
35 3300006358 Ga0068871_100346266 Ga0068871_1003462662 320
36 3300009177 Ga0105248_10061085 Ga0105248_100610853 320
37 3300013306 Ga0163162_10049807 Ga0163162_100498074 320
38 3300013308 Ga0157375_10012843 Ga0157375_100128433 320
39 3300014968 Ga0157379_10148229 Ga0157379_101482293 320
40 3300025918 Ga0207662_10091275 Ga0207662_100912752 320
41 3300025927 Ga0207687_10145697 Ga0207687_101456971 320
42 3300025934 Ga0207686_10006189 Ga0207686_100061895 320
43 3300025934 Ga0207686_10120740 Ga0207686_101207402 320
44 3300025938 Ga0207704_10032343 Ga0207704_100323433 320
45 3300025942 Ga0207689_10012877 Ga0207689_100128777 320
46 3300025960 Ga0207651_10074131 Ga0207651_100741312 320
47 3300026023 Ga0207677_10125202 Ga0207677_101252022 320
48 3300026035 Ga0207703_10077061 Ga0207703_100770613 320
49 3300028381 Ga0268264_10146873 Ga0268264_101468732 320
50 3300031548 Ga0307408_100054287 Ga0307408_1000542871 320
51 3300031824 Ga0307413_10035752 Ga0307413_100357522 320
52 3300031852 Ga0307410_10022308 Ga0307410_100223082 320
53 3300032002 Ga0307416_100106798 Ga0307416_1001067982 320
54 3300032126 Ga0307415_100235268 Ga0307415_1002352681 320
55 3300044712 Ga0453684_0082011 Ga0453684_0082011_2969_4000 320
56 3300050512 nmdc:mga0n895_369939_c1 nmdc:mga0n895_369939_c1_326_1366 320
57 3300006353 Ga0075370_10001530 Ga0075370_100015308 321
58 3300050496 nmdc:mga07m45_9523_c1 nmdc:mga07m45_9523_c1_1240_2277 321
59 3300006914 Ga0075436_100112267 Ga0075436_1001122672 322
60 3300009148 Ga0105243_10130233 Ga0105243_101302332 323
61 3300028794 Ga0307515_10000049 Ga0307515_1000004995 324
62 3300049582 Ga0501048_0199312 Ga0501048_0199312_181_1212 324
63 3300025913 Ga0207695_10012472 Ga0207695_100124727 325
64 3300047470 Ga0495681_0025029 Ga0495681_0025029_211_1203 325
65 3300031824 Ga0307413_10136874 Ga0307413_101368742 326
66 3300032005 Ga0307411_10051162 Ga0307411_100511622 326
67 3300014326 Ga0157380_10157950 Ga0157380_101579502 327
68 3300031730 Ga0307516_10000921 Ga0307516_1000092131 327
69 3300050496 nmdc:mga07m45_39965_c1 nmdc:mga07m45_39965_c1_382_1419 327
70 3300025908 Ga0207643_10081964 Ga0207643_100819642 328
71 3300028786 Ga0307517_10009075 Ga0307517_100090758 328
72 3300031616 Ga0307508_10003490 Ga0307508_100034901 328
73 3300005329 Ga0070683_100043020 Ga0070683_1000430203 329
74 3300005339 Ga0070660_100057090 Ga0070660_1000570902 329
75 3300005344 Ga0070661_100044865 Ga0070661_1000448653 329
76 3300005366 Ga0070659_100028990 Ga0070659_1000289903 329
77 3300005535 Ga0070684_100203051 Ga0070684_1002030512 329
78 3300005564 Ga0070664_100031391 Ga0070664_1000313913 329
79 3300005577 Ga0068857_100052496 Ga0068857_1000524962 329
80 3300005578 Ga0068854_100038067 Ga0068854_1000380672 329
81 3300005614 Ga0068856_100027043 Ga0068856_1000270433 329
82 3300005616 Ga0068852_100070416 Ga0068852_1000704163 329
83 3300005834 Ga0068851_10020708 Ga0068851_100207082 329
84 3300009174 Ga0105241_10290324 Ga0105241_102903242 329
85 3300009551 Ga0105238_10025045 Ga0105238_100250452 329
86 3300013100 Ga0157373_10037647 Ga0157373_100376473 329
87 3300013102 Ga0157371_10160387 Ga0157371_101603872 329
88 3300013105 Ga0157369_10100400 Ga0157369_101004003 329
89 3300013307 Ga0157372_10047788 Ga0157372_100477884 329
90 3300025321 Ga0207656_10018982 Ga0207656_100189823 329
91 3300025919 Ga0207657_10087855 Ga0207657_100878552 329
92 3300025920 Ga0207649_10001848 Ga0207649_100018484 329
93 3300025924 Ga0207694_10021587 Ga0207694_100215874 329
94 3300025932 Ga0207690_10011751 Ga0207690_100117514 329
95 3300025945 Ga0207679_10015442 Ga0207679_100154424 329
96 3300026041 Ga0207639_10091133 Ga0207639_100911332 329
97 3300026078 Ga0207702_10014485 Ga0207702_100144853 329
98 3300026142 Ga0207698_10176448 Ga0207698_101764482 329
99 3300042876 Ga0451577_0005487 Ga0451577_0005487_3050_4078 329
100 3300044712 Ga0453684_0038319 Ga0453684_0038319_2274_3302 329
101 3300048916 Ga0496113_0174977 Ga0496113_0174977_445_1488 329
102 3300006852 Ga0075433_10192723 Ga0075433_101927232 330
103 3300046681 Ga0495647_0082743 Ga0495647_0082743_35_1072 330
104 3300050515 nmdc:mga0a205_71671_c1 nmdc:mga0a205_71671_c1_430_1446 330
105 iso_pu_bacteria 2998344455 2998346473 330
106 3300039437 Ga0436365_1311379 Ga0436365_1311379_95_1132 331
107 iso_pu_bacteria 2599185292 2599906249 331
108 iso_pu_bacteria 2643221569 2643862032 331
109 iso_pu_bacteria 2643221594 2643980924 331
110 iso_pu_bacteria 2643221621 2644122378 331
111 iso_pu_bacteria 2808606395 2809031750 331
112 iso_pu_bacteria 2857537821 2857540709 331
113 iso_pu_bacteria 2857542790 2857543297 331
114 iso_pu_bacteria 2858950400 2858956584 331
115 iso_pu_bacteria 2901300506 2901308732 331
116 iso_pu_bacteria 2904601388 2904602527 331
117 iso_pu_bacteria 2941479691 2941482233 331
118 iso_pu_bacteria 8002392321 8002394680 331
119 3300042876 Ga0451577_0101670 Ga0451577_0101670_335_1372 332
120 iso_pu_bacteria 2585428057 2587730741 332
121 iso_pu_bacteria 2839094727 2839095770 332
122 3300003215 JGI25153J46596_10002339 JGI25153J46596_100023397 333
123 3300025258 Ga0209129_1007932 Ga0209129_10079323 333
124 3300025297 Ga0209758_1001500 Ga0209758_10015005 333
125 3300027360 Ga0209969_1011759 Ga0209969_10117591 333
126 3300027378 Ga0209981_1008816 Ga0209981_10088162 333
127 3300028786 Ga0307517_10047929 Ga0307517_100479293 333
128 3300028794 Ga0307515_10040590 Ga0307515_100405906 333
129 3300031507 Ga0307509_10042928 Ga0307509_100429284 333
130 3300046683 Ga0495658_0141810 Ga0495658_0141810_302_1342 333
131 3300047472 Ga0495686_0002020 Ga0495686_0002020_7633_8637 333
132 3300053093 Ga0500651_0130431 Ga0500651_0130431_138_1151 333
133 iso_pu_bacteria 2513237165 2514043261 333
134 iso_pu_bacteria 644736347 644750160 333
135 3300003771 Ga0055526_1000020 Ga0055526_1000020117 334
136 3300005341 Ga0070691_10102727 Ga0070691_101027272 334
137 3300005438 Ga0070701_10030791 Ga0070701_100307912 334
138 3300005438 Ga0070701_10093623 Ga0070701_100936232 334
139 3300021361 Ga0213872_10020490 Ga0213872_100204903 334
140 3300037068 Ga0373925_0010856 Ga0373925_0010856_4268_5284 334
141 3300037471 Ga0395905_0001267 Ga0395905_0001267_14026_15051 334
142 3300039447 Ga0436361_0782766 Ga0436361_0782766_224_1237 334
143 3300005345 Ga0070692_10200717 Ga0070692_102007171 335
144 3300005353 Ga0070669_100012786 Ga0070669_1000127865 335
145 3300005444 Ga0070694_100005264 Ga0070694_1000052648 335
146 3300005471 Ga0070698_100154513 Ga0070698_1001545131 335
147 3300005546 Ga0070696_100027522 Ga0070696_1000275223 335
148 3300005549 Ga0070704_100034749 Ga0070704_1000347493 335
149 3300005549 Ga0070704_100124000 Ga0070704_1001240002 335
150 3300005615 Ga0070702_100131219 Ga0070702_1001312192 335
151 3300005617 Ga0068859_100023632 Ga0068859_1000236326 335
152 3300006051 Ga0075364_10039346 Ga0075364_100393463 335
153 3300006931 Ga0097620_100023632 Ga0097620_1000236322 335
154 3300009094 Ga0111539_10122371 Ga0111539_101223712 335
155 3300009098 Ga0105245_10059808 Ga0105245_100598083 335
156 3300009176 Ga0105242_10022167 Ga0105242_100221675 335
157 3300025292 Ga0209676_1004828 Ga0209676_10048282 335
158 3300025298 Ga0209050_1004622 Ga0209050_10046229 335
159 3300025908 Ga0207643_10059044 Ga0207643_100590442 335
160 3300025917 Ga0207660_10171494 Ga0207660_101714942 335
161 3300025934 Ga0207686_10006148 Ga0207686_100061485 335
162 3300031911 Ga0307412_10000555 Ga0307412_1000055515 335
163 3300037418 Ga0395900_0131119 Ga0395900_0131119_100_1119 335
164 3300046684 Ga0495669_0022259 Ga0495669_0022259_847_1869 335
165 3300048919 Ga0496116_0007062 Ga0496116_0007062_8450_9472 335
166 3300048919 Ga0496116_0127692 Ga0496116_0127692_43_1065 335
167 3300048921 Ga0496118_0005733 Ga0496118_0005733_3365_4387 335
168 3300048921 Ga0496118_0047398 Ga0496118_0047398_767_1789 335
169 3300048922 Ga0496119_0007271 Ga0496119_0007271_6729_7751 335
170 3300048923 Ga0496120_0002111 Ga0496120_0002111_1376_2398 335
171 3300048924 Ga0496121_0000127 Ga0496121_0000127_4111_5133 335
172 3300048925 Ga0496122_0000573 Ga0496122_0000573_52153_53175 335
173 3300048926 Ga0496123_0002762 Ga0496123_0002762_7633_8655 335
174 3300048926 Ga0496123_0009770 Ga0496123_0009770_3469_4491 335
175 3300048927 Ga0496124_0052937 Ga0496124_0052937_1391_2413 335
176 3300048928 Ga0496125_0000011 Ga0496125_0000011_436676_437698 335
177 3300048928 Ga0496125_0034967 Ga0496125_0034967_1498_2580 335
178 3300049570 Ga0501033_0074063 Ga0501033_0074063_1177_2208 335
179 3300049571 Ga0501034_0029758 Ga0501034_0029758_1217_2248 335
180 3300049580 Ga0501046_0030512 Ga0501046_0030512_3130_4161 335
181 3300050511 nmdc:mga08y16_235643_c1 nmdc:mga08y16_235643_c1_513_1532 335
182 3300003322 rootL2_10086437 rootL2_100864372 336
183 3300003322 rootL2_10156818 rootL2_101568181 336
184 3300005340 Ga0070689_100046642 Ga0070689_1000466422 336
185 3300005354 Ga0070675_100122376 Ga0070675_1001223761 336
186 3300005355 Ga0070671_100076416 Ga0070671_1000764163 336
187 3300005365 Ga0070688_100038186 Ga0070688_1000381863 336
188 3300005438 Ga0070701_10068255 Ga0070701_100682551 336
189 3300005456 Ga0070678_100128903 Ga0070678_1001289032 336
190 3300005547 Ga0070693_100016391 Ga0070693_1000163913 336
191 3300005577 Ga0068857_100066359 Ga0068857_1000663593 336
192 3300009093 Ga0105240_10112430 Ga0105240_101124303 336
193 3300009174 Ga0105241_10138049 Ga0105241_101380493 336
194 3300021361 Ga0213872_10000309 Ga0213872_100003098 336
195 3300025911 Ga0207654_10162794 Ga0207654_101627942 336
196 3300025913 Ga0207695_10127174 Ga0207695_101271743 336
197 3300025940 Ga0207691_10000699 Ga0207691_100006995 336
198 3300025942 Ga0207689_10062550 Ga0207689_100625502 336
199 3300026116 Ga0207674_10022936 Ga0207674_100229365 336
200 3300026121 Ga0207683_10251362 Ga0207683_102513622 336
201 3300039447 Ga0436361_0545923 Ga0436361_0545923_32441_33469 336
202 3300046519 Ga0495632_0005226 Ga0495632_0005226_2662_3684 336
203 3300053139 Ga0500568_0023455 Ga0500568_0023455_1223_2245 336
204 3300053156 Ga0500622_0080851 Ga0500622_0080851_17_1039 336
205 iso_pu_bacteria 2932422444 2932426022 336
206 3300005356 Ga0070674_100130689 Ga0070674_1001306892 337
207 3300005440 Ga0070705_100040144 Ga0070705_1000401442 337
208 3300005444 Ga0070694_100004656 Ga0070694_1000046562 337
209 3300005445 Ga0070708_100000315 Ga0070708_10000031519 337
210 3300005545 Ga0070695_100041780 Ga0070695_1000417801 337
211 3300005549 Ga0070704_100028056 Ga0070704_1000280563 337
212 3300005985 Ga0081539_10071773 Ga0081539_100717731 337
213 3300006237 Ga0097621_100155137 Ga0097621_1001551372 337
214 3300006844 Ga0075428_100348057 Ga0075428_1003480572 337
215 3300006846 Ga0075430_100071766 Ga0075430_1000717663 337
216 3300006846 Ga0075430_100250233 Ga0075430_1002502331 337
217 3300006847 Ga0075431_100189735 Ga0075431_1001897353 337
218 3300009094 Ga0111539_10144487 Ga0111539_101444872 337
219 3300009176 Ga0105242_10205197 Ga0105242_102051971 337
220 3300014745 Ga0157377_10137467 Ga0157377_101374672 337
221 3300025934 Ga0207686_10096621 Ga0207686_100966212 337
222 3300025937 Ga0207669_10121296 Ga0207669_101212962 337
223 3300031548 Ga0307408_100012702 Ga0307408_1000127024 337
224 3300042436 Ga0439435_0000488 Ga0439435_0000488_4277_5299 337
225 3300042461 Ga0439460_0012015 Ga0439460_0012015_305_1327 337
226 3300044673 Ga0453683_0214985 Ga0453683_0214985_192_1211 337
227 3300046539 Ga0495621_0002601 Ga0495621_0002601_3481_4503 337
228 3300046683 Ga0495658_0150575 Ga0495658_0150575_41_1084 337
229 3300050493 nmdc:mga0k408_20974_c1 nmdc:mga0k408_20974_c1_1493_2515 337
230 3300050507 nmdc:mga05p37_10060_c1 nmdc:mga05p37_10060_c1_3052_4077 337
231 3300050509 nmdc:mga0qj67_160894_c1 nmdc:mga0qj67_160894_c1_331_1350 337
232 3300050509 nmdc:mga0qj67_33522_c1 nmdc:mga0qj67_33522_c1_2862_3884 337
233 3300050509 nmdc:mga0qj67_54326_c1 nmdc:mga0qj67_54326_c1_1729_2751 337
234 3300050510 nmdc:mga06r32_130038_c1 nmdc:mga06r32_130038_c1_170_1192 337
235 iso_pu_bacteria 2738543012 2739245110 337
236 iso_pu_bacteria 2738543013 2739251337 337
237 iso_pu_bacteria 2816332133 2816474520 337
238 iso_pu_bacteria 2842747753 2842747813 337
239 iso_pu_bacteria 2857576091 2857576937 337
240 iso_pu_bacteria 2904479285 2904479389 337
241 3300005355 Ga0070671_100012210 Ga0070671_1000122102 338
242 3300005459 Ga0068867_100337972 Ga0068867_1003379721 338
243 3300005468 Ga0070707_100256972 Ga0070707_1002569722 338
244 3300005543 Ga0070672_100277629 Ga0070672_1002776291 338
245 3300005618 Ga0068864_100116200 Ga0068864_1001162002 338
246 3300005842 Ga0068858_100007317 Ga0068858_1000073178 338
247 3300006844 Ga0075428_100061865 Ga0075428_1000618653 338
248 3300006844 Ga0075428_100145137 Ga0075428_1001451372 338
249 3300009094 Ga0111539_10002368 Ga0111539_1000236822 338
250 3300009177 Ga0105248_10091165 Ga0105248_100911652 338
251 3300009551 Ga0105238_10244185 Ga0105238_102441852 338
252 3300013306 Ga0163162_10026458 Ga0163162_100264582 338
253 3300014325 Ga0163163_10029776 Ga0163163_100297762 338
254 3300017792 Ga0163161_10079810 Ga0163161_100798102 338
255 3300025922 Ga0207646_10102106 Ga0207646_101021062 338
256 3300025924 Ga0207694_10084479 Ga0207694_100844792 338
257 3300025934 Ga0207686_10003551 Ga0207686_100035513 338
258 3300025935 Ga0207709_10029914 Ga0207709_100299142 338
259 3300026035 Ga0207703_10017382 Ga0207703_100173825 338
260 3300027695 Ga0209966_1018790 Ga0209966_10187901 338
261 3300027907 Ga0207428_10015146 Ga0207428_100151462 338
262 3300031824 Ga0307413_10034040 Ga0307413_100340402 338
263 3300031903 Ga0307407_10064951 Ga0307407_100649512 338
264 3300031995 Ga0307409_100465647 Ga0307409_1004656471 338
265 3300032005 Ga0307411_10116765 Ga0307411_101167651 338
266 3300036401 Ga0373937_0494548 Ga0373937_0494548_129_1151 338
267 3300049572 Ga0501036_0104223 Ga0501036_0104223_920_1951 338
268 3300049592 Ga0501076_0066908 Ga0501076_0066908_107_1138 338
269 3300049824 Ga0501045_0200445 Ga0501045_0200445_253_1305 338
270 3300050508 nmdc:mga09592_101942_c1 nmdc:mga09592_101942_c1_1089_2117 338
271 3300050511 nmdc:mga08y16_18948_c1 nmdc:mga08y16_18948_c1_912_1940 338
272 3300050512 nmdc:mga0n895_96729_c1 nmdc:mga0n895_96729_c1_101_1129 338
273 iso_pu_bacteria 2842718218 2842721726 338
274 iso_pu_bacteria 2928115317 2928116428 338
275 3300005295 Ga0065707_10025584 Ga0065707_100255842 339
276 3300005458 Ga0070681_10199563 Ga0070681_101995631 339
277 3300005549 Ga0070704_100018982 Ga0070704_1000189822 339
278 3300006195 Ga0075366_10117996 Ga0075366_101179962 339
279 3300006880 Ga0075429_100189647 Ga0075429_1001896472 339
280 3300025912 Ga0207707_10165411 Ga0207707_101654111 339
281 3300025921 Ga0207652_10020652 Ga0207652_100206524 339
282 3300046530 Ga0495654_0005706 Ga0495654_0005706_1364_2395 339
283 3300046558 Ga0495633_0003149 Ga0495633_0003149_8069_9103 339
284 3300050493 nmdc:mga0k408_73943_c1 nmdc:mga0k408_73943_c1_654_1685 339
285 3300050510 nmdc:mga06r32_231916_c1 nmdc:mga06r32_231916_c1_584_1615 339
286 iso_pu_bacteria 2643221654 2644305167 339
287 3300003781 Ga0055536_1017457 Ga0055536_10174572 340
288 3300003784 Ga0055534_1001095 Ga0055534_10010955 340
289 3300005295 Ga0065707_10021263 Ga0065707_100212631 340
290 3300005353 Ga0070669_100150414 Ga0070669_1001504142 340
291 3300005937 Ga0081455_10055091 Ga0081455_100550913 340
292 3300009176 Ga0105242_10013179 Ga0105242_100131795 340
293 3300009553 Ga0105249_10260785 Ga0105249_102607852 340
294 3300015683 Ga0183362_10002 Ga0183362_10002375 340
295 3300025291 Ga0209675_1000771 Ga0209675_100077124 340
296 3300025292 Ga0209676_1003804 Ga0209676_10038044 340
297 3300025298 Ga0209050_1013208 Ga0209050_10132082 340
298 3300025303 Ga0209051_1003394 Ga0209051_10033944 340
299 3300025934 Ga0207686_10001268 Ga0207686_1000126814 340
300 3300028794 Ga0307515_10000485 Ga0307515_1000048575 340
301 3300031548 Ga0307408_100033563 Ga0307408_1000335633 340
302 3300031649 Ga0307514_10000200 Ga0307514_10000200113 340
303 3300031649 Ga0307514_10000225 Ga0307514_1000022520 340
304 3300031903 Ga0307407_10141455 Ga0307407_101414552 340
305 3300046501 Ga0495607_0000386 Ga0495607_0000386_8713_9756 340
306 3300046678 Ga0495599_0146676 Ga0495599_0146676_112_1170 340
307 3300047319 Ga0495674_0019794 Ga0495674_0019794_2351_3409 340
308 3300048925 Ga0496122_0002372 Ga0496122_0002372_3995_5029 340
309 3300048926 Ga0496123_0000108 Ga0496123_0000108_81705_82739 340
310 3300048927 Ga0496124_0078600 Ga0496124_0078600_833_1867 340
311 3300048928 Ga0496125_0027391 Ga0496125_0027391_3039_4151 340
312 3300048929 Ga0496126_0093146 Ga0496126_0093146_571_1683 340
313 3300053136 Ga0500559_0009195 Ga0500559_0009195_118_1152 340
314 3300053156 Ga0500622_0014643 Ga0500622_0014643_1414_2448 340
315 iso_pu_bacteria 2842324504 2842325542 340
316 iso_pu_bacteria 2842348783 2842349821 340
317 iso_pu_bacteria 2842454564 2842454942 340
318 3300005548 Ga0070665_100119200 Ga0070665_1001192002 341
319 3300041997 Ga0439431_0002520 Ga0439431_0002520_883_1911 341
320 3300042115 Ga0450911_000410 Ga0450911_000410_3718_4761 341
321 3300046530 Ga0495654_0093560 Ga0495654_0093560_14_1051 341
322 3300046542 Ga0495597_0000116 Ga0495597_0000116_26920_27957 341
323 3300048924 Ga0496121_0002444 Ga0496121_0002444_4031_5074 341
324 3300048928 Ga0496125_0012601 Ga0496125_0012601_6901_7944 341
325 3300050516 nmdc:mga0sz30_22786_c1 nmdc:mga0sz30_22786_c1_999_2159 341
326 3300035691 Ga0373931_0040703 Ga0373931_0040703_143_1186 342
327 3300003316 rootH1_10071182 rootH1_100711821 343
328 3300005293 Ga0065715_10049973 Ga0065715_100499731 343
329 3300005327 Ga0070658_10221720 Ga0070658_102217202 343
330 3300005328 Ga0070676_10005475 Ga0070676_100054753 343
331 3300005328 Ga0070676_10054864 Ga0070676_100548642 343
332 3300005328 Ga0070676_10059423 Ga0070676_100594232 343
333 3300005330 Ga0070690_100002075 Ga0070690_1000020759 343
334 3300005330 Ga0070690_100043091 Ga0070690_1000430912 343
335 3300005331 Ga0070670_100008340 Ga0070670_1000083404 343
336 3300005331 Ga0070670_100146042 Ga0070670_1001460421 343
337 3300005331 Ga0070670_100174832 Ga0070670_1001748322 343
338 3300005331 Ga0070670_100286220 Ga0070670_1002862202 343
339 3300005335 Ga0070666_10004654 Ga0070666_100046544 343
340 3300005338 Ga0068868_100003547 Ga0068868_1000035472 343
341 3300005338 Ga0068868_100338209 Ga0068868_1003382091 343
342 3300005347 Ga0070668_100008228 Ga0070668_1000082283 343
343 3300005347 Ga0070668_100069906 Ga0070668_1000699062 343
344 3300005353 Ga0070669_100036817 Ga0070669_1000368172 343
345 3300005354 Ga0070675_100019717 Ga0070675_1000197171 343
346 3300005354 Ga0070675_100101870 Ga0070675_1001018702 343
347 3300005354 Ga0070675_100111346 Ga0070675_1001113461 343
348 3300005354 Ga0070675_100191275 Ga0070675_1001912752 343
349 3300005354 Ga0070675_100201967 Ga0070675_1002019672 343
350 3300005355 Ga0070671_100005362 Ga0070671_1000053624 343
351 3300005355 Ga0070671_100033723 Ga0070671_1000337234 343
352 3300005355 Ga0070671_100042851 Ga0070671_1000428511 343
353 3300005355 Ga0070671_100073624 Ga0070671_1000736243 343
354 3300005356 Ga0070674_100004474 Ga0070674_1000044743 343
355 3300005356 Ga0070674_100074001 Ga0070674_1000740011 343
356 3300005356 Ga0070674_100109658 Ga0070674_1001096582 343
357 3300005364 Ga0070673_100000694 Ga0070673_1000006943 343
358 3300005364 Ga0070673_100069049 Ga0070673_1000690492 343
359 3300005364 Ga0070673_100078150 Ga0070673_1000781503 343
360 3300005364 Ga0070673_100112208 Ga0070673_1001122082 343
361 3300005365 Ga0070688_100009318 Ga0070688_1000093183 343
362 3300005367 Ga0070667_100010648 Ga0070667_1000106483 343
363 3300005367 Ga0070667_100016789 Ga0070667_1000167894 343
364 3300005367 Ga0070667_100051232 Ga0070667_1000512322 343
365 3300005367 Ga0070667_100262524 Ga0070667_1002625242 343
366 3300005445 Ga0070708_100465395 Ga0070708_1004653951 343
367 3300005455 Ga0070663_100071966 Ga0070663_1000719662 343
368 3300005456 Ga0070678_100022799 Ga0070678_1000227991 343
369 3300005456 Ga0070678_100169129 Ga0070678_1001691292 343
370 3300005456 Ga0070678_100242948 Ga0070678_1002429482 343
371 3300005457 Ga0070662_100061938 Ga0070662_1000619381 343
372 3300005459 Ga0068867_100047316 Ga0068867_1000473163 343
373 3300005467 Ga0070706_100002711 Ga0070706_1000027114 343
374 3300005471 Ga0070698_100131622 Ga0070698_1001316222 343
375 3300005535 Ga0070684_100503726 Ga0070684_1005037261 343
376 3300005543 Ga0070672_100035426 Ga0070672_1000354262 343
377 3300005543 Ga0070672_100100188 Ga0070672_1001001882 343
378 3300005548 Ga0070665_100053512 Ga0070665_1000535123 343
379 3300005563 Ga0068855_100034097 Ga0068855_1000340974 343
380 3300005564 Ga0070664_100047904 Ga0070664_1000479043 343
381 3300005564 Ga0070664_100121069 Ga0070664_1001210693 343
382 3300005577 Ga0068857_100078704 Ga0068857_1000787043 343
383 3300005578 Ga0068854_100091832 Ga0068854_1000918322 343
384 3300005616 Ga0068852_100282928 Ga0068852_1002829282 343
385 3300005616 Ga0068852_100406297 Ga0068852_1004062972 343
386 3300005617 Ga0068859_100044579 Ga0068859_1000445792 343
387 3300005618 Ga0068864_100000351 Ga0068864_10000035133 343
388 3300005618 Ga0068864_100027130 Ga0068864_1000271304 343
389 3300005718 Ga0068866_10063236 Ga0068866_100632362 343
390 3300005718 Ga0068866_10183807 Ga0068866_101838072 343
391 3300005834 Ga0068851_10064987 Ga0068851_100649872 343
392 3300005834 Ga0068851_10101875 Ga0068851_101018752 343
393 3300005834 Ga0068851_10119175 Ga0068851_101191752 343
394 3300005841 Ga0068863_100002991 Ga0068863_10000299114 343
395 3300005841 Ga0068863_100093690 Ga0068863_1000936903 343
396 3300005842 Ga0068858_100000729 Ga0068858_10000072916 343
397 3300005842 Ga0068858_100003527 Ga0068858_10000352713 343
398 3300005842 Ga0068858_100030103 Ga0068858_1000301032 343
399 3300005842 Ga0068858_100201199 Ga0068858_1002011992 343
400 3300005843 Ga0068860_100020683 Ga0068860_1000206833 343
401 3300005843 Ga0068860_100020950 Ga0068860_1000209503 343
402 3300005843 Ga0068860_100060223 Ga0068860_1000602232 343
403 3300005843 Ga0068860_100103009 Ga0068860_1001030093 343
404 3300006177 Ga0075362_10043772 Ga0075362_100437722 343
405 3300006195 Ga0075366_10058455 Ga0075366_100584553 343
406 3300006195 Ga0075366_10059689 Ga0075366_100596892 343
407 3300006237 Ga0097621_100009828 Ga0097621_1000098285 343
408 3300006237 Ga0097621_100065188 Ga0097621_1000651883 343
409 3300006237 Ga0097621_100065508 Ga0097621_1000655083 343
410 3300006353 Ga0075370_10001898 Ga0075370_100018984 343
411 3300006353 Ga0075370_10003975 Ga0075370_100039752 343
412 3300006358 Ga0068871_100012921 Ga0068871_1000129212 343
413 3300006358 Ga0068871_100056592 Ga0068871_1000565922 343
414 3300006358 Ga0068871_100072962 Ga0068871_1000729623 343
415 3300006931 Ga0097620_100044579 Ga0097620_1000445792 343
416 3300009093 Ga0105240_10331093 Ga0105240_103310932 343
417 3300009098 Ga0105245_10150428 Ga0105245_101504282 343
418 3300009148 Ga0105243_10098763 Ga0105243_100987632 343
419 3300009177 Ga0105248_10123781 Ga0105248_101237813 343
420 3300009177 Ga0105248_10207135 Ga0105248_102071352 343
421 3300009553 Ga0105249_10016622 Ga0105249_100166225 343
422 3300010375 Ga0105239_10054317 Ga0105239_100543174 343
423 3300013296 Ga0157374_10016933 Ga0157374_100169334 343
424 3300013306 Ga0163162_10033724 Ga0163162_100337244 343
425 3300013306 Ga0163162_10048294 Ga0163162_100482941 343
426 3300013308 Ga0157375_10059291 Ga0157375_100592913 343
427 3300013308 Ga0157375_10367720 Ga0157375_103677201 343
428 3300014325 Ga0163163_10005668 Ga0163163_100056689 343
429 3300014326 Ga0157380_10154758 Ga0157380_101547582 343
430 3300014968 Ga0157379_10004055 Ga0157379_100040553 343
431 3300014969 Ga0157376_10047037 Ga0157376_100470372 343
432 3300025290 Ga0207673_1007572 Ga0207673_10075722 343
433 3300025315 Ga0207697_10003156 Ga0207697_100031566 343
434 3300025321 Ga0207656_10019459 Ga0207656_100194592 343
435 3300025321 Ga0207656_10057726 Ga0207656_100577261 343
436 3300025893 Ga0207682_10012204 Ga0207682_100122043 343
437 3300025903 Ga0207680_10002176 Ga0207680_100021764 343
438 3300025907 Ga0207645_10013887 Ga0207645_100138872 343
439 3300025907 Ga0207645_10040010 Ga0207645_100400102 343
440 3300025907 Ga0207645_10087083 Ga0207645_100870832 343
441 3300025909 Ga0207705_10221420 Ga0207705_102214201 343
442 3300025913 Ga0207695_10081043 Ga0207695_100810431 343
443 3300025914 Ga0207671_10011643 Ga0207671_100116434 343
444 3300025923 Ga0207681_10060356 Ga0207681_100603562 343
445 3300025925 Ga0207650_10000970 Ga0207650_1000097014 343
446 3300025925 Ga0207650_10007280 Ga0207650_100072802 343
447 3300025925 Ga0207650_10021249 Ga0207650_100212493 343
448 3300025926 Ga0207659_10000781 Ga0207659_100007815 343
449 3300025926 Ga0207659_10005370 Ga0207659_100053702 343
450 3300025926 Ga0207659_10017024 Ga0207659_100170243 343
451 3300025926 Ga0207659_10022515 Ga0207659_100225152 343
452 3300025926 Ga0207659_10063619 Ga0207659_100636192 343
453 3300025926 Ga0207659_10184227 Ga0207659_101842272 343
454 3300025927 Ga0207687_10067989 Ga0207687_100679892 343
455 3300025931 Ga0207644_10000899 Ga0207644_100008995 343
456 3300025931 Ga0207644_10003807 Ga0207644_100038077 343
457 3300025931 Ga0207644_10013865 Ga0207644_100138653 343
458 3300025931 Ga0207644_10041525 Ga0207644_100415252 343
459 3300025931 Ga0207644_10162676 Ga0207644_101626762 343
460 3300025931 Ga0207644_10332590 Ga0207644_103325902 343
461 3300025933 Ga0207706_10095355 Ga0207706_100953553 343
462 3300025937 Ga0207669_10010778 Ga0207669_100107783 343
463 3300025937 Ga0207669_10019707 Ga0207669_100197072 343
464 3300025938 Ga0207704_10138846 Ga0207704_101388462 343
465 3300025940 Ga0207691_10002051 Ga0207691_100020512 343
466 3300025940 Ga0207691_10013535 Ga0207691_100135355 343
467 3300025940 Ga0207691_10043113 Ga0207691_100431133 343
468 3300025940 Ga0207691_10062341 Ga0207691_100623413 343
469 3300025940 Ga0207691_10077728 Ga0207691_100777282 343
470 3300025940 Ga0207691_10091581 Ga0207691_100915812 343
471 3300025940 Ga0207691_10286073 Ga0207691_102860732 343
472 3300025941 Ga0207711_10088590 Ga0207711_100885902 343
473 3300025941 Ga0207711_10131505 Ga0207711_101315053 343
474 3300025942 Ga0207689_10008871 Ga0207689_100088713 343
475 3300025942 Ga0207689_10043811 Ga0207689_100438114 343
476 3300025942 Ga0207689_10066991 Ga0207689_100669913 343
477 3300025942 Ga0207689_10093104 Ga0207689_100931043 343
478 3300025945 Ga0207679_10185577 Ga0207679_101855772 343
479 3300025945 Ga0207679_10241447 Ga0207679_102414472 343
480 3300025949 Ga0207667_10053810 Ga0207667_100538103 343
481 3300025960 Ga0207651_10005355 Ga0207651_100053553 343
482 3300025960 Ga0207651_10180655 Ga0207651_101806551 343
483 3300025961 Ga0207712_10073144 Ga0207712_100731442 343
484 3300025972 Ga0207668_10006822 Ga0207668_100068224 343
485 3300025972 Ga0207668_10161281 Ga0207668_101612812 343
486 3300025981 Ga0207640_10021988 Ga0207640_100219883 343
487 3300025981 Ga0207640_10103223 Ga0207640_101032232 343
488 3300025981 Ga0207640_10234851 Ga0207640_102348512 343
489 3300025986 Ga0207658_10022502 Ga0207658_100225023 343
490 3300026023 Ga0207677_10008047 Ga0207677_100080473 343
491 3300026023 Ga0207677_10014636 Ga0207677_100146364 343
492 3300026035 Ga0207703_10002007 Ga0207703_100020079 343
493 3300026035 Ga0207703_10030390 Ga0207703_100303903 343
494 3300026067 Ga0207678_10024103 Ga0207678_100241033 343
495 3300026067 Ga0207678_10074208 Ga0207678_100742083 343
496 3300026078 Ga0207702_10042536 Ga0207702_100425363 343
497 3300026088 Ga0207641_10028000 Ga0207641_100280002 343
498 3300026089 Ga0207648_10027677 Ga0207648_100276773 343
499 3300026089 Ga0207648_10071974 Ga0207648_100719742 343
500 3300026089 Ga0207648_10143811 Ga0207648_101438111 343
501 3300026089 Ga0207648_10283153 Ga0207648_102831531 343
502 3300026095 Ga0207676_10002172 Ga0207676_100021724 343
503 3300026095 Ga0207676_10047336 Ga0207676_100473363 343
504 3300026095 Ga0207676_10051685 Ga0207676_100516852 343
505 3300026121 Ga0207683_10019395 Ga0207683_100193951 343
506 3300026121 Ga0207683_10086108 Ga0207683_100861083 343
507 3300028380 Ga0268265_10134579 Ga0268265_101345792 343
508 3300028380 Ga0268265_10219514 Ga0268265_102195142 343
509 3300028380 Ga0268265_10357048 Ga0268265_103570482 343
510 3300028381 Ga0268264_10017825 Ga0268264_100178254 343
511 3300028381 Ga0268264_10018647 Ga0268264_100186474 343
512 3300031456 Ga0307513_10151350 Ga0307513_101513502 343
513 3300031507 Ga0307509_10000092 Ga0307509_1000009251 343
514 3300031507 Ga0307509_10002037 Ga0307509_100020373 343
515 3300031548 Ga0307408_100134940 Ga0307408_1001349402 343
516 3300031616 Ga0307508_10001131 Ga0307508_100011319 343
517 3300031731 Ga0307405_10020379 Ga0307405_100203793 343
518 3300031852 Ga0307410_10019217 Ga0307410_100192173 343
519 3300031901 Ga0307406_10010157 Ga0307406_100101574 343
520 3300031911 Ga0307412_10066780 Ga0307412_100667802 343
521 3300031911 Ga0307412_10084366 Ga0307412_100843662 343
522 3300031995 Ga0307409_100000467 Ga0307409_10000046717 343
523 3300032002 Ga0307416_100120510 Ga0307416_1001205102 343
524 3300032004 Ga0307414_10071742 Ga0307414_100717423 343
525 3300032005 Ga0307411_10005170 Ga0307411_100051701 343
526 3300032005 Ga0307411_10021368 Ga0307411_100213683 343
527 3300032126 Ga0307415_100009800 Ga0307415_1000098005 343
528 3300033180 Ga0307510_10001210 Ga0307510_1000121011 343
529 3300035170 Ga0373943_0148996 Ga0373943_0148996_60_1103 343
530 3300035172 Ga0373955_0194819 Ga0373955_0194819_151_1194 343
531 3300035724 Ga0373933_0243830 Ga0373933_0243830_30_1073 343
532 3300035725 Ga0373947_0027386 Ga0373947_0027386_1220_2263 343
533 3300037068 Ga0373925_0224749 Ga0373925_0224749_309_1346 343
534 3300046454 Ga0495592_0000413 Ga0495592_0000413_3111_4148 343
535 3300046459 Ga0495629_0022966 Ga0495629_0022966_2179_3216 343
536 3300046472 Ga0495580_0065960 Ga0495580_0065960_1253_2290 343
537 3300046472 Ga0495580_0068885 Ga0495580_0068885_542_1585 343
538 3300046511 Ga0495608_0050822 Ga0495608_0050822_651_1688 343
539 3300046519 Ga0495632_0012832 Ga0495632_0012832_1292_2329 343
540 3300046526 Ga0495666_0024170 Ga0495666_0024170_97_1134 343
541 3300046529 Ga0495652_0130108 Ga0495652_0130108_109_1146 343
542 3300046543 Ga0495645_0038509 Ga0495645_0038509_614_1657 343
543 3300046616 Ga0495668_0039347 Ga0495668_0039347_260_1297 343
544 3300046642 Ga0495634_0089188 Ga0495634_0089188_604_1641 343
545 3300046689 Ga0495613_0107558 Ga0495613_0107558_192_1235 343
546 3300047443 Ga0495687_001245 Ga0495687_001245_11720_12757 343
547 3300047443 Ga0495687_007634 Ga0495687_007634_3486_4523 343
548 3300047673 Ga0495593_0103305 Ga0495593_0103305_262_1299 343
549 3300048911 Ga0496108_0108107 Ga0496108_0108107_1163_2206 343
550 3300048911 Ga0496108_0195632 Ga0496108_0195632_117_1163 343
551 3300048911 Ga0496108_0243596 Ga0496108_0243596_306_1355 343
552 3300048912 Ga0496109_0398109 Ga0496109_0398109_102_1145 343
553 3300049669 Ga0501235_021491 Ga0501235_021491_41_1084 343
554 3300050489 nmdc:mga03683_7427_c1 nmdc:mga03683_7427_c1_667_1704 343
555 3300050491 nmdc:mga00v17_18949_c1 nmdc:mga00v17_18949_c1_49_1086 343
556 3300050493 nmdc:mga0k408_13244_c1 nmdc:mga0k408_13244_c1_344_1381 343
557 3300050496 nmdc:mga07m45_17054_c1 nmdc:mga07m45_17054_c1_2779_3816 343
558 3300050496 nmdc:mga07m45_38373_c1 nmdc:mga07m45_38373_c1_1084_2130 343
559 3300053077 Ga0495601_0008116 Ga0495601_0008116_519_1556 343
560 3300053078 Ga0495612_0063127 Ga0495612_0063127_187_1224 343
561 3300053084 Ga0495595_0065371 Ga0495595_0065371_254_1297 343
562 3300053088 Ga0500644_0006672 Ga0500644_0006672_827_1864 343
563 3300053092 Ga0500583_0027257 Ga0500583_0027257_182_1222 343
564 3300053108 Ga0500562_017882 Ga0500562_017882_247_1284 343
565 3300053118 Ga0500594_0019549 Ga0500594_0019549_77_1114 343
566 3300053131 Ga0500652_029551 Ga0500652_029551_1009_2046 343
567 3300053136 Ga0500559_0000017 Ga0500559_0000017_80592_81629 343
568 3300053139 Ga0500568_0028241 Ga0500568_0028241_504_1541 343
569 3300053151 Ga0500604_0012271 Ga0500604_0012271_434_1471 343
570 3300053156 Ga0500622_0002180 Ga0500622_0002180_4418_5455 343
571 3300053730 Ga0500645_003191 Ga0500645_003191_2728_3780 343
572 3300006195 Ga0075366_10022146 Ga0075366_100221462 344
573 3300009176 Ga0105242_10067299 Ga0105242_100672994 344
574 3300028380 Ga0268265_10133883 Ga0268265_101338832 344
575 3300031456 Ga0307513_10004164 Ga0307513_1000416413 344
576 3300037471 Ga0395905_0003737 Ga0395905_0003737_2235_3272 344
577 3300039437 Ga0436365_0761091 Ga0436365_0761091_37_1089 344
578 3300049741 Ga0501079_0146853 Ga0501079_0146853_739_1776 344
579 3300005295 Ga0065707_10093320 Ga0065707_100933202 345
580 3300005338 Ga0068868_100176798 Ga0068868_1001767981 345
581 3300005459 Ga0068867_100023179 Ga0068867_1000231793 345
582 3300005543 Ga0070672_100280430 Ga0070672_1002804302 345
583 3300005614 Ga0068856_100107861 Ga0068856_1001078613 345
584 3300005719 Ga0068861_100002726 Ga0068861_1000027269 345
585 3300005843 Ga0068860_100002318 Ga0068860_1000023186 345
586 3300006038 Ga0075365_10063964 Ga0075365_100639643 345
587 3300006048 Ga0075363_100152511 Ga0075363_1001525111 345
588 3300006058 Ga0075432_10005083 Ga0075432_100050834 345
589 3300006178 Ga0075367_10133118 Ga0075367_101331182 345
590 3300006881 Ga0068865_100025960 Ga0068865_1000259602 345
591 3300009553 Ga0105249_10038399 Ga0105249_100383992 345
592 3300013297 Ga0157378_10090108 Ga0157378_100901082 345
593 3300013306 Ga0163162_10002191 Ga0163162_100021919 345
594 3300014968 Ga0157379_10112884 Ga0157379_101128842 345
595 3300014969 Ga0157376_10049589 Ga0157376_100495893 345
596 3300017792 Ga0163161_10021414 Ga0163161_100214144 345
597 3300025923 Ga0207681_10132286 Ga0207681_101322862 345
598 3300025940 Ga0207691_10130672 Ga0207691_101306722 345
599 3300025961 Ga0207712_10240967 Ga0207712_102409671 345
600 3300026078 Ga0207702_10143889 Ga0207702_101438892 345
601 3300026089 Ga0207648_10000556 Ga0207648_1000055648 345
602 3300026118 Ga0207675_100002028 Ga0207675_10000202818 345
603 3300027907 Ga0207428_10038230 Ga0207428_100382303 345
604 3300028794 Ga0307515_10116866 Ga0307515_101168662 345
605 3300031238 Ga0265332_10003549 Ga0265332_100035495 345
606 3300031239 Ga0265328_10072432 Ga0265328_100724322 345
607 3300031456 Ga0307513_10105397 Ga0307513_101053973 345
608 3300031711 Ga0265314_10001584 Ga0265314_100015844 345
609 3300035695 Ga0373927_0032741 Ga0373927_0032741_1100_2137 345
610 3300037068 Ga0373925_0027694 Ga0373925_0027694_1728_2765 345
611 3300037418 Ga0395900_0089243 Ga0395900_0089243_248_1297 345
612 3300037471 Ga0395905_0000047 Ga0395905_0000047_124984_126024 345
613 3300037471 Ga0395905_0016587 Ga0395905_0016587_3513_4550 345
614 3300037471 Ga0395905_0020586 Ga0395905_0020586_3278_4318 345
615 3300044656 Ga0466969_0035807 Ga0466969_0035807_983_2023 345
616 3300044712 Ga0453684_0033003 Ga0453684_0033003_3343_4380 345
617 3300044719 Ga0466971_0057708 Ga0466971_0057708_399_1436 345
618 3300046683 Ga0495658_0037329 Ga0495658_0037329_181_1218 345
619 3300048090 Ga0495615_0003944 Ga0495615_0003944_249_1286 345
620 3300049686 Ga0501257_015645 Ga0501257_015645_660_1697 345
621 3300050507 nmdc:mga05p37_170371_c1 nmdc:mga05p37_170371_c1_1123_2163 345
622 3300053088 Ga0500644_0016547 Ga0500644_0016547_847_1887 345
623 iso_pu_bacteria 2511231002 2511245435 345
624 3300028794 Ga0307515_10028979 Ga0307515_100289793 347
625 3300002774 JGI25150J39212_1001519 JGI25150J39212_10015194 349
626 3300002987 JGI25159J45721_1000190 JGI25159J45721_100019016 349
627 3300003354 JGI25160J50197_1000345 JGI25160J50197_100034519 349
628 3300003374 JGI25161J50226_1000007 JGI25161J50226_1000007205 349
629 3300003773 Ga0055537_1006677 Ga0055537_10066773 349
630 3300004625 Ga0055543_1001205 Ga0055543_10012056 349
631 3300005468 Ga0070707_100175814 Ga0070707_1001758142 349
632 3300006051 Ga0075364_10095096 Ga0075364_100950962 349
633 3300006948 Ga0099826_10181283 Ga0099826_101812831 349
634 3300025208 Ga0209436_107453 Ga0209436_1074532 349
635 3300025245 Ga0207425_1000606 Ga0207425_100060612 349
636 3300025263 Ga0209565_1000849 Ga0209565_10008497 349
637 3300025284 Ga0209130_1000014 Ga0209130_1000014395 349
638 3300025297 Ga0209758_1006824 Ga0209758_10068245 349
639 3300025298 Ga0209050_1003807 Ga0209050_10038075 349
640 3300025299 Ga0209256_1037408 Ga0209256_10374081 349
641 3300025302 Ga0207426_1000091 Ga0207426_100009116 349
642 3300031456 Ga0307513_10002838 Ga0307513_100028381 349
643 3300032002 Ga0307416_100144348 Ga0307416_1001443482 349
644 3300053088 Ga0500644_0003026 Ga0500644_0003026_1302_2351 349
645 3300053098 Ga0500650_0027497 Ga0500650_0027497_1455_2504 349
646 3300053117 Ga0500593_000168 Ga0500593_000168_14648_15697 349
647 3300053730 Ga0500645_000333 Ga0500645_000333_13822_14871 349
648 3300053730 Ga0500645_004530 Ga0500645_004530_2379_3428 349
649 3300055283 Ga0500661_000690 Ga0500661_000690_1871_2920 349
650 3300002774 JGI25150J39212_1008535 JGI25150J39212_10085351 350
651 3300025245 Ga0207425_1014645 Ga0207425_10146452 350
652 3300003771 Ga0055526_1020106 Ga0055526_10201062 351
653 3300005539 Ga0068853_100061096 Ga0068853_1000610962 351
654 3300025291 Ga0209675_1007151 Ga0209675_10071513 351
655 3300025292 Ga0209676_1004437 Ga0209676_10044375 351
656 3300025295 Ga0209564_1006578 Ga0209564_10065783 351
657 3300003771 Ga0055526_1012497 Ga0055526_10124973 352
658 3300025295 Ga0209564_1001414 Ga0209564_10014147 352
659 3300031548 Ga0307408_100002928 Ga0307408_1000029282 352
660 3300031901 Ga0307406_10003971 Ga0307406_100039713 352
661 3300002704 JGI25155J39150_1000121 JGI25155J39150_100012125 353
662 3300002705 JGI25156J39149_1000100 JGI25156J39149_100010025 353
663 3300002738 JGI25154J39366_1000121 JGI25154J39366_100012124 353
664 3300002741 JGI25157J39369_1000130 JGI25157J39369_100013028 353
665 3300002987 JGI25159J45721_1002986 JGI25159J45721_10029864 353
666 3300003187 JGI25151J46595_10018837 JGI25151J46595_100188372 353
667 3300003187 JGI25151J46595_10019083 JGI25151J46595_100190832 353
668 3300003771 Ga0055526_1008255 Ga0055526_10082551 353
669 3300003773 Ga0055537_1000183 Ga0055537_100018332 353
670 3300003773 Ga0055537_1000254 Ga0055537_100025417 353
671 3300003775 Ga0055524_1000101 Ga0055524_100010116 353
672 3300003775 Ga0055524_1000471 Ga0055524_10004713 353
673 3300003784 Ga0055534_1001577 Ga0055534_10015771 353
674 3300003790 Ga0055528_1001026 Ga0055528_10010263 353
675 3300003791 Ga0055530_10001334 Ga0055530_100013348 353
676 3300003792 Ga0055540_1000099 Ga0055540_100009970 353
677 3300003794 Ga0055531_10013122 Ga0055531_100131222 353
678 3300025206 Ga0209435_100008 Ga0209435_100008305 353
679 3300025246 Ga0209646_1000079 Ga0209646_100007928 353
680 3300025250 Ga0209026_1000067 Ga0209026_100006728 353
681 3300025256 Ga0209759_1000056 Ga0209759_100005628 353
682 3300025263 Ga0209565_1000041 Ga0209565_1000041122 353
683 3300025273 Ga0209673_1000012 Ga0209673_100001244 353
684 3300025284 Ga0209130_1000184 Ga0209130_100018467 353
685 3300025291 Ga0209675_1000475 Ga0209675_10004757 353
686 3300025292 Ga0209676_1000013 Ga0209676_1000013356 353
687 3300025295 Ga0209564_1001251 Ga0209564_10012518 353
688 3300025298 Ga0209050_1000008 Ga0209050_1000008356 353
689 3300025299 Ga0209256_1000003 Ga0209256_100000345 353
690 3300025303 Ga0209051_1000005 Ga0209051_1000005356 353
691 3300025304 Ga0209257_1000048 Ga0209257_1000048356 353
692 3300042005 Ga0439448_0048187 Ga0439448_0048187_111_1232 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

56

317

0.84

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

103

348

0.81

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

60

313

0.8

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

69

341

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.9151 34 348
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.9014 34 348
6wce-assembly1.cif.gz_A structure of the periplasmic binding protein p5pa 0.8959 34 346
6wce-assembly1.cif.gz_A structure of the periplasmic binding protein p5pa 0.8905 34 346
7tav-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8413 33 299
ID Description Score Start End Superfamily
1xvyA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8875 37 133 3.40.190.10
4r74A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8864 141 348 3.40.190.10
4r74A02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8699 141 348 3.40.190.10
af_Q2G1D9_30_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8509 37 328 3.40.190.10
3c9hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8486 35 131 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1Y5EC47-F1-model_v4 Putative 2-aminoethylphosphonate ABC transporter substrate-binding protein 0.9876 30 353 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A0R2TF58-F1-model_v4 Phosphonate ABC transporter substrate-binding protein 0.9848 55 353 GO:0015888
GO:0030288
GO:0030975
GO:0030976
GO:0046872
AF-A0A645J1K5-F1-model_v4 Uncharacterized protein 0.9826 206 353 GO:0015888
GO:0030288
GO:0030975
GO:0030976
AF-A0A0R2TF58-F1-model_v4 Phosphonate ABC transporter substrate-binding protein 0.9782 55 353 GO:0015888
GO:0030288
GO:0030975
GO:0030976
GO:0046872
AF-A0A158M7S7-F1-model_v4 Putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein 0.978 33 282 GO:0015888
GO:0030288
GO:0030975
GO:0030976

Feature Viewer

pLDDT pTM Quality
92.08 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map