F475575
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 343 | 684 | 147 |
Family's Representative Sequence
| Representative Sequence | 3300009101|Ga0105247_10825515|Ga0105247_108255151 |
| Length | 175 |
| Sequence | VAGSGAFAAHQNGVIVLNAIPYEPGGTPMTTLNDAVALAADDNGLAVVSTLRADGTIQASLVNAGAMTHPATGQQVLAFVTYGKVKLGNLRVRPQLAATFRRGWMWATVEGRAELAGPDDRQPWLTDADQLRLLLREVFTAAGGTHDNWDEYDRVMAEQRRTVVLVAPTRVYSNG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 2 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 3 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 4 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 5 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 129 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 190 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 191 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 192 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 195 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 196 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 197 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 202 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 203 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 217 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 218 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 219 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 220 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 222 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 223 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 224 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 225 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 226 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 227 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 228 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 229 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 234 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 235 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 292 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 295 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 296 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 329 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 334 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 338 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 339 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 340 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 341 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 342 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 343 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.84 |
| Metatranscriptomes | 0 |
| Isolates | 1.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.95 |
| Nodule | 0.72 |
| Rhizoplane | 11.71 |
| Rhizosphere | 73.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10140460 | 3300002067 | Bacteria | 697 |
| 2 | JGI24750J21931_1032422 | 3300002070 | Bacteria | 771 |
| 3 | JGI24738J21930_10012597 | 3300002075 | Bacteria | 1845 |
| 4 | JGI24749J21850_1030398 | 3300002076 | Bacteria | 775 |
| 5 | JGI24744J21845_10000053 | 3300002077 | Bacteria | 13445 |
| 6 | JGI24744J21845_10006220 | 3300002077 | Bacteria | 2479 |
| 7 | JGI24034J26672_10003514 | 3300002239 | Bacteria | 2187 |
| 8 | JGI24742J22300_10001182 | 3300002244 | Bacteria | 4071 |
| 9 | JGI24751J29686_10061108 | 3300002459 | Bacteria | 776 |
| 10 | rootL2_10132418 | 3300003322 | Bacteria | 1354 |
| 11 | Ga0070658_11138118 | 3300005327 | Bacteria | 679 |
| 12 | Ga0070676_10222942 | 3300005328 | Bacteria | 1246 |
| 13 | Ga0070683_102131417 | 3300005329 | Unclassified | 538 |
| 14 | Ga0070690_100001292 | 3300005330 | Bacteria | 13002 |
| 15 | Ga0068869_100012633 | 3300005334 | Bacteria | 5586 |
| 16 | Ga0070666_10306095 | 3300005335 | Bacteria | 1132 |
| 17 | Ga0070680_100651411 | 3300005336 | Bacteria | 905 |
| 18 | Ga0070682_100001916 | 3300005337 | Bacteria | 11610 |
| 19 | Ga0070682_100199624 | 3300005337 | Bacteria | 1410 |
| 20 | Ga0070682_101893979 | 3300005337 | Bacteria | 522 |
| 21 | Ga0068868_100009639 | 3300005338 | Bacteria | 6966 |
| 22 | Ga0068868_100101718 | 3300005338 | Bacteria | 2326 |
| 23 | Ga0068868_101280560 | 3300005338 | Bacteria | 680 |
| 24 | Ga0070689_100018207 | 3300005340 | Bacteria | 5171 |
| 25 | Ga0070691_10001466 | 3300005341 | Bacteria | 10121 |
| 26 | Ga0070687_100889533 | 3300005343 | Bacteria | 638 |
| 27 | Ga0070668_100000358 | 3300005347 | Bacteria | 30164 |
| 28 | Ga0070668_100003461 | 3300005347 | Bacteria | 11653 |
| 29 | Ga0070668_100364680 | 3300005347 | Bacteria | 1226 |
| 30 | Ga0070668_101893035 | 3300005347 | Bacteria | 549 |
| 31 | Ga0070669_100001662 | 3300005353 | Bacteria | 16093 |
| 32 | Ga0070669_100008249 | 3300005353 | Bacteria | 7439 |
| 33 | Ga0070669_100168239 | 3300005353 | Bacteria | 1707 |
| 34 | Ga0070674_100003807 | 3300005356 | Bacteria | 8528 |
| 35 | Ga0070674_100995792 | 3300005356 | Bacteria | 735 |
| 36 | Ga0070673_100311897 | 3300005364 | Bacteria | 1388 |
| 37 | Ga0070688_100002128 | 3300005365 | Bacteria | 9979 |
| 38 | Ga0070688_100027921 | 3300005365 | Bacteria | 3363 |
| 39 | Ga0070688_100540868 | 3300005365 | Bacteria | 884 |
| 40 | Ga0070688_101148189 | 3300005365 | Bacteria | 622 |
| 41 | Ga0070688_101408464 | 3300005365 | Bacteria | 565 |
| 42 | Ga0070659_100063532 | 3300005366 | Bacteria | 2921 |
| 43 | Ga0070667_100000075 | 3300005367 | Bacteria | 120953 |
| 44 | Ga0070667_100004048 | 3300005367 | Bacteria | 12396 |
| 45 | Ga0070667_100012854 | 3300005367 | Bacteria | 6917 |
| 46 | Ga0070667_100164775 | 3300005367 | Bacteria | 1954 |
| 47 | Ga0070709_10005095 | 3300005434 | Bacteria | 7102 |
| 48 | Ga0070709_10046065 | 3300005434 | Bacteria | 2710 |
| 49 | Ga0070709_10345451 | 3300005434 | Bacteria | 1098 |
| 50 | Ga0070713_100357314 | 3300005436 | Bacteria | 1356 |
| 51 | Ga0070713_100552816 | 3300005436 | Bacteria | 1090 |
| 52 | Ga0070713_100601013 | 3300005436 | Bacteria | 1045 |
| 53 | Ga0070710_10001540 | 3300005437 | Bacteria | 10899 |
| 54 | Ga0070701_10004264 | 3300005438 | Bacteria | 5766 |
| 55 | Ga0070711_100001591 | 3300005439 | Bacteria | 12506 |
| 56 | Ga0070711_100063796 | 3300005439 | Bacteria | 2572 |
| 57 | Ga0070705_100025323 | 3300005440 | Bacteria | 3216 |
| 58 | Ga0070705_100087384 | 3300005440 | Bacteria | 1932 |
| 59 | Ga0070700_100014110 | 3300005441 | Bacteria | 4507 |
| 60 | Ga0070700_100022565 | 3300005441 | Bacteria | 3673 |
| 61 | Ga0070694_100018714 | 3300005444 | Bacteria | 4399 |
| 62 | Ga0070708_100981774 | 3300005445 | Bacteria | 792 |
| 63 | Ga0070663_100002640 | 3300005455 | Bacteria | 10142 |
| 64 | Ga0070663_101339023 | 3300005455 | Bacteria | 633 |
| 65 | Ga0070678_100001197 | 3300005456 | Bacteria | 13803 |
| 66 | Ga0070662_100010769 | 3300005457 | Bacteria | 6019 |
| 67 | Ga0070662_100297193 | 3300005457 | Bacteria | 1311 |
| 68 | Ga0070662_101936736 | 3300005457 | Bacteria | 509 |
| 69 | Ga0070681_10885179 | 3300005458 | Bacteria | 811 |
| 70 | Ga0068867_100006287 | 3300005459 | Bacteria | 8400 |
| 71 | Ga0068867_100199654 | 3300005459 | Bacteria | 1600 |
| 72 | Ga0070685_10057771 | 3300005466 | Bacteria | 2259 |
| 73 | Ga0070685_10474545 | 3300005466 | Bacteria | 881 |
| 74 | Ga0070706_100587810 | 3300005467 | Bacteria | 1035 |
| 75 | Ga0070706_102006561 | 3300005467 | Bacteria | 524 |
| 76 | Ga0070698_101685308 | 3300005471 | Bacteria | 586 |
| 77 | Ga0070684_100168020 | 3300005535 | Bacteria | 1992 |
| 78 | Ga0070684_100272673 | 3300005535 | Bacteria | 1549 |
| 79 | Ga0068853_100051687 | 3300005539 | Bacteria | 3538 |
| 80 | Ga0068853_100064641 | 3300005539 | Bacteria | 3173 |
| 81 | Ga0070672_100188078 | 3300005543 | Bacteria | 1723 |
| 82 | Ga0070695_100040554 | 3300005545 | Bacteria | 2948 |
| 83 | Ga0070696_100003435 | 3300005546 | Bacteria | 10555 |
| 84 | Ga0070693_100032667 | 3300005547 | Bacteria | 2864 |
| 85 | Ga0070693_100122157 | 3300005547 | Bacteria | 1617 |
| 86 | Ga0070665_100005474 | 3300005548 | Bacteria | 13089 |
| 87 | Ga0070665_100006380 | 3300005548 | Bacteria | 12021 |
| 88 | Ga0070665_100059533 | 3300005548 | Bacteria | 3829 |
| 89 | Ga0070665_100259269 | 3300005548 | Bacteria | 1740 |
| 90 | Ga0070665_100461108 | 3300005548 | Bacteria | 1281 |
| 91 | Ga0070665_101103995 | 3300005548 | Bacteria | 805 |
| 92 | Ga0070704_100000391 | 3300005549 | Bacteria | 20083 |
| 93 | Ga0070704_100036324 | 3300005549 | Bacteria | 3357 |
| 94 | Ga0068855_100113289 | 3300005563 | Bacteria | 3111 |
| 95 | Ga0070664_101951543 | 3300005564 | Bacteria | 557 |
| 96 | Ga0068857_100387988 | 3300005577 | Bacteria | 1298 |
| 97 | Ga0068854_100004672 | 3300005578 | Bacteria | 8636 |
| 98 | Ga0068856_100004865 | 3300005614 | Bacteria | 13303 |
| 99 | Ga0070702_100001144 | 3300005615 | Bacteria | 10661 |
| 100 | Ga0070702_100073894 | 3300005615 | Bacteria | 2021 |
| 101 | Ga0068852_101437779 | 3300005616 | Bacteria | 712 |
| 102 | Ga0068852_101771922 | 3300005616 | Bacteria | 640 |
| 103 | Ga0068859_100000606 | 3300005617 | Bacteria | 35852 |
| 104 | Ga0068859_100003251 | 3300005617 | Bacteria | 16545 |
| 105 | Ga0068859_100065886 | 3300005617 | Bacteria | 3656 |
| 106 | Ga0068859_100571564 | 3300005617 | Bacteria | 1224 |
| 107 | Ga0068859_100859037 | 3300005617 | Bacteria | 993 |
| 108 | Ga0068864_100622399 | 3300005618 | Bacteria | 1049 |
| 109 | Ga0068866_10002931 | 3300005718 | Bacteria | 7038 |
| 110 | Ga0068866_10069786 | 3300005718 | Bacteria | 1852 |
| 111 | Ga0068861_100120570 | 3300005719 | Bacteria | 2115 |
| 112 | Ga0068861_100374854 | 3300005719 | Bacteria | 1255 |
| 113 | Ga0068863_100465112 | 3300005841 | Bacteria | 1242 |
| 114 | Ga0068858_100001109 | 3300005842 | Bacteria | 27859 |
| 115 | Ga0068858_100073000 | 3300005842 | Bacteria | 3185 |
| 116 | Ga0068858_101752370 | 3300005842 | Bacteria | 613 |
| 117 | Ga0068860_100000025 | 3300005843 | Bacteria | 271553 |
| 118 | Ga0068860_100012429 | 3300005843 | Bacteria | 8385 |
| 119 | Ga0068860_100801985 | 3300005843 | Bacteria | 955 |
| 120 | Ga0068862_100000045 | 3300005844 | Bacteria | 155641 |
| 121 | Ga0068862_100001869 | 3300005844 | Bacteria | 19086 |
| 122 | Ga0068862_100021009 | 3300005844 | Bacteria | 5455 |
| 123 | Ga0068862_100186010 | 3300005844 | Bacteria | 1866 |
| 124 | Ga0068862_100290319 | 3300005844 | Bacteria | 1502 |
| 125 | Ga0068862_102535226 | 3300005844 | Bacteria | 524 |
| 126 | Ga0081455_10039741 | 3300005937 | Bacteria | 4154 |
| 127 | Ga0081455_10093207 | 3300005937 | Bacteria | 2435 |
| 128 | Ga0081538_10043770 | 3300005981 | Bacteria | 2804 |
| 129 | Ga0081538_10185021 | 3300005981 | Bacteria | 884 |
| 130 | Ga0081540_1044640 | 3300005983 | Bacteria | 2260 |
| 131 | Ga0081540_1119893 | 3300005983 | Bacteria | 1094 |
| 132 | Ga0070717_10993873 | 3300006028 | Bacteria | 764 |
| 133 | Ga0075365_10015619 | 3300006038 | Bacteria | 4596 |
| 134 | Ga0075365_10227436 | 3300006038 | Bacteria | 1309 |
| 135 | Ga0075365_10531100 | 3300006038 | Bacteria | 832 |
| 136 | Ga0075365_10567653 | 3300006038 | Bacteria | 802 |
| 137 | Ga0075368_10392240 | 3300006042 | Bacteria | 609 |
| 138 | Ga0075363_100030212 | 3300006048 | Bacteria | 2803 |
| 139 | Ga0075363_100184374 | 3300006048 | Bacteria | 1188 |
| 140 | Ga0075363_100941004 | 3300006048 | Bacteria | 530 |
| 141 | Ga0075364_10004468 | 3300006051 | Bacteria | 8052 |
| 142 | Ga0075364_10005113 | 3300006051 | Bacteria | 7602 |
| 143 | Ga0075364_10018231 | 3300006051 | Bacteria | 4392 |
| 144 | Ga0075364_10071227 | 3300006051 | Bacteria | 2290 |
| 145 | Ga0075364_10240055 | 3300006051 | Bacteria | 1231 |
| 146 | Ga0075364_10433492 | 3300006051 | Bacteria | 898 |
| 147 | Ga0070716_100001115 | 3300006173 | Bacteria | 11831 |
| 148 | Ga0070716_100013982 | 3300006173 | Bacteria | 4104 |
| 149 | Ga0070716_100047642 | 3300006173 | Bacteria | 2419 |
| 150 | Ga0070716_100575181 | 3300006173 | Bacteria | 844 |
| 151 | Ga0070712_100003721 | 3300006175 | Bacteria | 9391 |
| 152 | Ga0070712_100040073 | 3300006175 | Bacteria | 3209 |
| 153 | Ga0075362_10008504 | 3300006177 | Bacteria | 3927 |
| 154 | Ga0075362_10279148 | 3300006177 | Bacteria | 826 |
| 155 | Ga0075367_10360500 | 3300006178 | Bacteria | 918 |
| 156 | Ga0075369_10004473 | 3300006186 | Bacteria | 5168 |
| 157 | Ga0075369_10013887 | 3300006186 | Bacteria | 3207 |
| 158 | Ga0075369_10058110 | 3300006186 | Bacteria | 1684 |
| 159 | Ga0075369_10112024 | 3300006186 | Bacteria | 1230 |
| 160 | Ga0075369_10137154 | 3300006186 | Bacteria | 1114 |
| 161 | Ga0075369_10138554 | 3300006186 | Bacteria | 1108 |
| 162 | Ga0097621_100190034 | 3300006237 | Bacteria | 1778 |
| 163 | Ga0075370_10002478 | 3300006353 | Bacteria | 8558 |
| 164 | Ga0075370_10206688 | 3300006353 | Bacteria | 1159 |
| 165 | Ga0075370_10443772 | 3300006353 | Bacteria | 780 |
| 166 | Ga0068871_100174587 | 3300006358 | Bacteria | 1844 |
| 167 | Ga0068871_100205001 | 3300006358 | Bacteria | 1704 |
| 168 | Ga0075428_100004846 | 3300006844 | Bacteria | 14930 |
| 169 | Ga0075430_100280293 | 3300006846 | Bacteria | 1379 |
| 170 | Ga0075431_100009857 | 3300006847 | Bacteria | 9591 |
| 171 | Ga0075429_100156557 | 3300006880 | Bacteria | 1995 |
| 172 | Ga0068865_100172714 | 3300006881 | Bacteria | 1658 |
| 173 | Ga0097620_100000606 | 3300006931 | Bacteria | 35852 |
| 174 | Ga0097620_100003251 | 3300006931 | Bacteria | 16545 |
| 175 | Ga0097620_100065888 | 3300006931 | Bacteria | 3656 |
| 176 | Ga0097620_100571680 | 3300006931 | Bacteria | 1224 |
| 177 | Ga0097620_100859134 | 3300006931 | Bacteria | 993 |
| 178 | Ga0099795_10007788 | 3300007788 | Bacteria | 3016 |
| 179 | Ga0105251_10180661 | 3300009011 | Bacteria | 950 |
| 180 | Ga0105244_10252061 | 3300009036 | Bacteria | 823 |
| 181 | Ga0105250_10056101 | 3300009092 | Bacteria | 1581 |
| 182 | Ga0105240_10017249 | 3300009093 | Bacteria | 9739 |
| 183 | Ga0105240_11631791 | 3300009093 | Bacteria | 674 |
| 184 | Ga0105240_12743192 | 3300009093 | Bacteria | 507 |
| 185 | Ga0111539_10498934 | 3300009094 | Bacteria | 1418 |
| 186 | Ga0111539_11906128 | 3300009094 | Bacteria | 689 |
| 187 | Ga0105245_10002903 | 3300009098 | Bacteria | 15381 |
| 188 | Ga0105245_10015297 | 3300009098 | Bacteria | 6686 |
| 189 | Ga0105245_10123070 | 3300009098 | Bacteria | 2425 |
| 190 | Ga0105245_10692525 | 3300009098 | Bacteria | 1052 |
| 191 | Ga0105245_11198151 | 3300009098 | Bacteria | 807 |
| 192 | Ga0105245_12331702 | 3300009098 | Unclassified | 589 |
| 193 | Ga0105247_10000010 | 3300009101 | Bacteria | 302475 |
| 194 | Ga0105247_10000178 | 3300009101 | Bacteria | 61996 |
| 195 | Ga0105247_10000366 | 3300009101 | Bacteria | 38409 |
| 196 | Ga0105247_10825515 | 3300009101 | Bacteria | 709 |
| 197 | Ga0114129_10005689 | 3300009147 | Bacteria | 17652 |
| 198 | Ga0114129_10261011 | 3300009147 | Bacteria | 2322 |
| 199 | Ga0105243_10001450 | 3300009148 | Bacteria | 20829 |
| 200 | Ga0105243_10060285 | 3300009148 | Bacteria | 3031 |
| 201 | Ga0105241_10214778 | 3300009174 | Bacteria | 1613 |
| 202 | Ga0105241_10411288 | 3300009174 | Bacteria | 1189 |
| 203 | Ga0105241_10781865 | 3300009174 | Bacteria | 878 |
| 204 | Ga0105242_10004714 | 3300009176 | Bacteria | 10558 |
| 205 | Ga0105242_10120942 | 3300009176 | Bacteria | 2247 |
| 206 | Ga0105242_10149393 | 3300009176 | Bacteria | 2036 |
| 207 | Ga0105248_10000145 | 3300009177 | Bacteria | 81917 |
| 208 | Ga0105248_10002194 | 3300009177 | Bacteria | 21610 |
| 209 | Ga0105248_10007315 | 3300009177 | Bacteria | 12115 |
| 210 | Ga0105248_10772473 | 3300009177 | Bacteria | 1084 |
| 211 | Ga0105237_10005813 | 3300009545 | Bacteria | 13836 |
| 212 | Ga0105237_10025835 | 3300009545 | Bacteria | 6004 |
| 213 | Ga0105237_10513643 | 3300009545 | Bacteria | 1205 |
| 214 | Ga0105238_10611824 | 3300009551 | Bacteria | 1098 |
| 215 | Ga0105238_11305256 | 3300009551 | Bacteria | 752 |
| 216 | Ga0105238_12904706 | 3300009551 | Bacteria | 515 |
| 217 | Ga0105249_10000010 | 3300009553 | Bacteria | 306939 |
| 218 | Ga0105249_10007809 | 3300009553 | Bacteria | 9318 |
| 219 | Ga0105249_10699719 | 3300009553 | Bacteria | 1073 |
| 220 | Ga0099796_10009296 | 3300010159 | Bacteria | 2655 |
| 221 | Ga0105239_10013580 | 3300010375 | Bacteria | 9040 |
| 222 | Ga0105239_10152069 | 3300010375 | Bacteria | 2583 |
| 223 | Ga0105239_10415271 | 3300010375 | Bacteria | 1524 |
| 224 | Ga0105239_11238379 | 3300010375 | Bacteria | 860 |
| 225 | Ga0105239_11718287 | 3300010375 | Bacteria | 726 |
| 226 | Ga0105246_11903516 | 3300011119 | Bacteria | 571 |
| 227 | Ga0157369_10253713 | 3300013105 | Bacteria | 1835 |
| 228 | Ga0157374_10479103 | 3300013296 | Bacteria | 1248 |
| 229 | Ga0157378_10001442 | 3300013297 | Bacteria | 21432 |
| 230 | Ga0157378_10156287 | 3300013297 | Bacteria | 2129 |
| 231 | Ga0163162_10002768 | 3300013306 | Bacteria | 16649 |
| 232 | Ga0163162_10078462 | 3300013306 | Bacteria | 3368 |
| 233 | Ga0163162_10121125 | 3300013306 | Bacteria | 2721 |
| 234 | Ga0163162_10706108 | 3300013306 | Bacteria | 1130 |
| 235 | Ga0163162_12288308 | 3300013306 | Bacteria | 621 |
| 236 | Ga0157372_10009077 | 3300013307 | Bacteria | 10565 |
| 237 | Ga0157375_10001272 | 3300013308 | Bacteria | 21812 |
| 238 | Ga0157375_12703309 | 3300013308 | Unclassified | 593 |
| 239 | Ga0163163_10010065 | 3300014325 | Bacteria | 8483 |
| 240 | Ga0163163_11008132 | 3300014325 | Bacteria | 896 |
| 241 | Ga0163163_11030660 | 3300014325 | Bacteria | 886 |
| 242 | Ga0157380_10000302 | 3300014326 | Bacteria | 29666 |
| 243 | Ga0157379_10009932 | 3300014968 | Bacteria | 8287 |
| 244 | Ga0157376_10193219 | 3300014969 | Bacteria | 1868 |
| 245 | Ga0157376_10305068 | 3300014969 | Bacteria | 1508 |
| 246 | Ga0157376_11565559 | 3300014969 | Bacteria | 693 |
| 247 | Ga0157376_11953511 | 3300014969 | Unclassified | 624 |
| 248 | Ga0163161_10000799 | 3300017792 | Bacteria | 24668 |
| 249 | Ga0163161_10294140 | 3300017792 | Bacteria | 1277 |
| 250 | Ga0213876_10003078 | 3300021384 | Bacteria | 9655 |
| 251 | Ga0213876_10129432 | 3300021384 | Bacteria | 1341 |
| 252 | Ga0213876_10156916 | 3300021384 | Bacteria | 1210 |
| 253 | Ga0213875_10041041 | 3300021388 | Bacteria | 2177 |
| 254 | Ga0213871_10118423 | 3300021441 | Bacteria | 788 |
| 255 | Ga0207696_1061230 | 3300025711 | Bacteria | 1058 |
| 256 | Ga0207682_10044059 | 3300025893 | Bacteria | 1828 |
| 257 | Ga0207692_10030153 | 3300025898 | Bacteria | 2583 |
| 258 | Ga0207642_10000143 | 3300025899 | Bacteria | 20251 |
| 259 | Ga0207642_10011054 | 3300025899 | Bacteria | 3206 |
| 260 | Ga0207710_10000028 | 3300025900 | Bacteria | 304525 |
| 261 | Ga0207710_10001961 | 3300025900 | Bacteria | 9831 |
| 262 | Ga0207688_10000090 | 3300025901 | Bacteria | 35199 |
| 263 | Ga0207680_10027001 | 3300025903 | Bacteria | 3190 |
| 264 | Ga0207647_10069287 | 3300025904 | Bacteria | 2132 |
| 265 | Ga0207685_10005331 | 3300025905 | Bacteria | 3383 |
| 266 | Ga0207685_10103693 | 3300025905 | Bacteria | 1221 |
| 267 | Ga0207699_10012071 | 3300025906 | Bacteria | 4386 |
| 268 | Ga0207699_10563510 | 3300025906 | Bacteria | 827 |
| 269 | Ga0207645_10027091 | 3300025907 | Bacteria | 3703 |
| 270 | Ga0207684_11349584 | 3300025910 | Bacteria | 585 |
| 271 | Ga0207707_10762461 | 3300025912 | Bacteria | 808 |
| 272 | Ga0207695_10017640 | 3300025913 | Bacteria | 8295 |
| 273 | Ga0207695_10133153 | 3300025913 | Bacteria | 2441 |
| 274 | Ga0207693_10000555 | 3300025915 | Bacteria | 33777 |
| 275 | Ga0207693_10002064 | 3300025915 | Bacteria | 17553 |
| 276 | Ga0207663_10002170 | 3300025916 | Bacteria | 9368 |
| 277 | Ga0207663_10016673 | 3300025916 | Bacteria | 4080 |
| 278 | Ga0207662_10354014 | 3300025918 | Bacteria | 987 |
| 279 | Ga0207681_10006072 | 3300025923 | Bacteria | 7406 |
| 280 | Ga0207681_10202684 | 3300025923 | Bacteria | 1524 |
| 281 | Ga0207681_11225151 | 3300025923 | Bacteria | 630 |
| 282 | Ga0207694_10023319 | 3300025924 | Bacteria | 4698 |
| 283 | Ga0207694_10459613 | 3300025924 | Bacteria | 1063 |
| 284 | Ga0207650_10539242 | 3300025925 | Bacteria | 978 |
| 285 | Ga0207659_10849746 | 3300025926 | Bacteria | 784 |
| 286 | Ga0207687_10012506 | 3300025927 | Bacteria | 5545 |
| 287 | Ga0207687_10158624 | 3300025927 | Bacteria | 1734 |
| 288 | Ga0207687_10640379 | 3300025927 | Bacteria | 899 |
| 289 | Ga0207700_10485984 | 3300025928 | Bacteria | 1091 |
| 290 | Ga0207700_10621914 | 3300025928 | Bacteria | 962 |
| 291 | Ga0207700_10909935 | 3300025928 | Bacteria | 787 |
| 292 | Ga0207664_10297450 | 3300025929 | Bacteria | 1419 |
| 293 | Ga0207664_11570252 | 3300025929 | Unclassified | 580 |
| 294 | Ga0207644_10100117 | 3300025931 | Bacteria | 2176 |
| 295 | Ga0207644_10117672 | 3300025931 | Bacteria | 2018 |
| 296 | Ga0207690_10032665 | 3300025932 | Bacteria | 3341 |
| 297 | Ga0207706_10005251 | 3300025933 | Bacteria | 12080 |
| 298 | Ga0207706_10016540 | 3300025933 | Bacteria | 6658 |
| 299 | Ga0207686_10001099 | 3300025934 | Bacteria | 15816 |
| 300 | Ga0207686_10006362 | 3300025934 | Bacteria | 6354 |
| 301 | Ga0207686_10065458 | 3300025934 | Bacteria | 2318 |
| 302 | Ga0207709_10002258 | 3300025935 | Bacteria | 12252 |
| 303 | Ga0207709_10700053 | 3300025935 | Bacteria | 811 |
| 304 | Ga0207670_10029755 | 3300025936 | Bacteria | 3482 |
| 305 | Ga0207669_10000752 | 3300025937 | Bacteria | 13994 |
| 306 | Ga0207704_10000393 | 3300025938 | Bacteria | 19943 |
| 307 | Ga0207704_10142440 | 3300025938 | Bacteria | 1679 |
| 308 | Ga0207665_10001801 | 3300025939 | Bacteria | 14436 |
| 309 | Ga0207665_10003000 | 3300025939 | Bacteria | 11326 |
| 310 | Ga0207665_10085661 | 3300025939 | Bacteria | 2176 |
| 311 | Ga0207665_10142723 | 3300025939 | Bacteria | 1709 |
| 312 | Ga0207691_10093942 | 3300025940 | Bacteria | 2684 |
| 313 | Ga0207691_10309885 | 3300025940 | Bacteria | 1355 |
| 314 | Ga0207711_10000069 | 3300025941 | Bacteria | 115038 |
| 315 | Ga0207711_10019795 | 3300025941 | Bacteria | 5609 |
| 316 | Ga0207689_10022958 | 3300025942 | Bacteria | 5240 |
| 317 | Ga0207661_10096794 | 3300025944 | Bacteria | 2470 |
| 318 | Ga0207661_11754810 | 3300025944 | Unclassified | 566 |
| 319 | Ga0207667_10082434 | 3300025949 | Bacteria | 3332 |
| 320 | Ga0207667_10380315 | 3300025949 | Bacteria | 1439 |
| 321 | Ga0207712_10000016 | 3300025961 | Bacteria | 343014 |
| 322 | Ga0207712_10046835 | 3300025961 | Bacteria | 3000 |
| 323 | Ga0207668_10002046 | 3300025972 | Bacteria | 11766 |
| 324 | Ga0207668_10005693 | 3300025972 | Bacteria | 7338 |
| 325 | Ga0207668_10178951 | 3300025972 | Bacteria | 1671 |
| 326 | Ga0207668_10276815 | 3300025972 | Bacteria | 1374 |
| 327 | Ga0207658_10000237 | 3300025986 | Bacteria | 58047 |
| 328 | Ga0207658_10002082 | 3300025986 | Bacteria | 14885 |
| 329 | Ga0207658_10024434 | 3300025986 | Bacteria | 4228 |
| 330 | Ga0207677_10003455 | 3300026023 | Bacteria | 8370 |
| 331 | Ga0207677_10105422 | 3300026023 | Bacteria | 2086 |
| 332 | Ga0207677_11401236 | 3300026023 | Bacteria | 644 |
| 333 | Ga0207703_10011384 | 3300026035 | Bacteria | 6920 |
| 334 | Ga0207703_10044415 | 3300026035 | Bacteria | 3571 |
| 335 | Ga0207703_11766733 | 3300026035 | Bacteria | 594 |
| 336 | Ga0207639_10003107 | 3300026041 | Bacteria | 11160 |
| 337 | Ga0207678_10011227 | 3300026067 | Bacteria | 7867 |
| 338 | Ga0207678_10013849 | 3300026067 | Bacteria | 7086 |
| 339 | Ga0207708_10006978 | 3300026075 | Bacteria | 8352 |
| 340 | Ga0207702_10005011 | 3300026078 | Bacteria | 11634 |
| 341 | Ga0207702_10266699 | 3300026078 | Bacteria | 1614 |
| 342 | Ga0207702_10724634 | 3300026078 | Bacteria | 981 |
| 343 | Ga0207702_10803924 | 3300026078 | Bacteria | 929 |
| 344 | Ga0207641_10025646 | 3300026088 | Bacteria | 4859 |
| 345 | Ga0207648_10000349 | 3300026089 | Bacteria | 50786 |
| 346 | Ga0207648_10027211 | 3300026089 | Bacteria | 5079 |
| 347 | Ga0207676_10094326 | 3300026095 | Bacteria | 2466 |
| 348 | Ga0207675_100006409 | 3300026118 | Bacteria | 11147 |
| 349 | Ga0207683_10000040 | 3300026121 | Bacteria | 95127 |
| 350 | Ga0207683_11097728 | 3300026121 | Bacteria | 738 |
| 351 | Ga0207698_12171651 | 3300026142 | Bacteria | 568 |
| 352 | Ga0268266_10002967 | 3300028379 | Bacteria | 17501 |
| 353 | Ga0268266_10005675 | 3300028379 | Bacteria | 11572 |
| 354 | Ga0268266_10036703 | 3300028379 | Bacteria | 4174 |
| 355 | Ga0268266_10189338 | 3300028379 | Bacteria | 1878 |
| 356 | Ga0268266_10681904 | 3300028379 | Bacteria | 990 |
| 357 | Ga0268265_10000056 | 3300028380 | Bacteria | 155720 |
| 358 | Ga0268265_10005589 | 3300028380 | Bacteria | 8582 |
| 359 | Ga0268265_10154149 | 3300028380 | Bacteria | 1942 |
| 360 | Ga0268265_10353054 | 3300028380 | Bacteria | 1343 |
| 361 | Ga0268264_10000053 | 3300028381 | Bacteria | 320368 |
| 362 | Ga0268264_10208375 | 3300028381 | Bacteria | 1793 |
| 363 | Ga0268264_10225825 | 3300028381 | Bacteria | 1726 |
| 364 | Ga0265336_10003716 | 3300028666 | Bacteria | 5921 |
| 365 | Ga0307517_10042614 | 3300028786 | Bacteria | 4861 |
| 366 | Ga0307515_10236659 | 3300028794 | Bacteria | 1606 |
| 367 | Ga0265338_10011151 | 3300028800 | Bacteria | 10419 |
| 368 | Ga0307513_10007598 | 3300031456 | Bacteria | 14012 |
| 369 | Ga0307509_10039018 | 3300031507 | Bacteria | 5176 |
| 370 | Ga0307408_100126425 | 3300031548 | Bacteria | 1989 |
| 371 | Ga0265314_10389809 | 3300031711 | Bacteria | 756 |
| 372 | Ga0307405_10175459 | 3300031731 | Bacteria | 1533 |
| 373 | Ga0307410_10534364 | 3300031852 | Bacteria | 969 |
| 374 | Ga0307410_10958689 | 3300031852 | Bacteria | 736 |
| 375 | Ga0307406_10029544 | 3300031901 | Bacteria | 3320 |
| 376 | Ga0307406_10177476 | 3300031901 | Bacteria | 1548 |
| 377 | Ga0307407_10069595 | 3300031903 | Bacteria | 2089 |
| 378 | Ga0307412_11089890 | 3300031911 | Bacteria | 710 |
| 379 | Ga0307409_101011214 | 3300031995 | Bacteria | 850 |
| 380 | Ga0307416_100019395 | 3300032002 | Bacteria | 4821 |
| 381 | Ga0307416_102929544 | 3300032002 | Bacteria | 571 |
| 382 | Ga0307415_100010281 | 3300032126 | Bacteria | 5291 |
| 383 | Ga0307415_102238496 | 3300032126 | Bacteria | 535 |
| 384 | Ga0307507_10058915 | 3300033179 | Bacteria | 3600 |
| 385 | Ga0373958_0005189 | 3300034819 | Bacteria | 1967 |
| 386 | Ga0373938_0163331 | 3300034957 | Bacteria | 599 |
| 387 | Ga0373949_0029246 | 3300035090 | Bacteria | 1304 |
| 388 | Ga0373949_0242939 | 3300035090 | Bacteria | 554 |
| 389 | Ga0373932_0317409 | 3300035112 | Bacteria | 585 |
| 390 | Ga0373939_0022264 | 3300035114 | Bacteria | 1745 |
| 391 | Ga0373941_0182084 | 3300035115 | Bacteria | 789 |
| 392 | Ga0373942_0082233 | 3300035207 | Bacteria | 958 |
| 393 | Ga0373931_0045619 | 3300035691 | Bacteria | 2315 |
| 394 | Ga0373931_0093273 | 3300035691 | Bacteria | 1681 |
| 395 | Ga0373935_0192513 | 3300035692 | Bacteria | 1405 |
| 396 | Ga0373925_0005890 | 3300037068 | Bacteria | 9085 |
| 397 | Ga0395900_0016131 | 3300037418 | Bacteria | 7610 |
| 398 | Ga0395900_0073852 | 3300037418 | Bacteria | 3507 |
| 399 | Ga0395898_0203199 | 3300037466 | Bacteria | 1891 |
| 400 | Ga0436364_0023947 | 3300037853 | Bacteria | 1583 |
| 401 | Ga0436364_0171371 | 3300037853 | Bacteria | 2262 |
| 402 | Ga0436364_0329205 | 3300037853 | Bacteria | 2715 |
| 403 | Ga0436364_0604589 | 3300037853 | Bacteria | 10148 |
| 404 | Ga0436364_0928958 | 3300037853 | Bacteria | 1521 |
| 405 | Ga0436365_0329583 | 3300039437 | Bacteria | 52503 |
| 406 | Ga0436365_0465547 | 3300039437 | Bacteria | 1875 |
| 407 | Ga0436365_1490253 | 3300039437 | Bacteria | 9196 |
| 408 | Ga0436360_0763556 | 3300039438 | Bacteria | 1239 |
| 409 | Ga0436363_0002351 | 3300039450 | Bacteria | 1483 |
| 410 | Ga0436363_1381948 | 3300039450 | Bacteria | 1109 |
| 411 | Ga0439466_0005991 | 3300041411 | Bacteria | 4627 |
| 412 | Ga0439466_0007929 | 3300041411 | Bacteria | 4005 |
| 413 | Ga0439465_0000439 | 3300041413 | Bacteria | 12169 |
| 414 | Ga0439465_0004076 | 3300041413 | Bacteria | 4756 |
| 415 | Ga0439465_0030810 | 3300041413 | Bacteria | 1707 |
| 416 | Ga0451797_0034473 | 3300041453 | Bacteria | 1281 |
| 417 | Ga0451851_0694353 | 3300041507 | Bacteria | 516 |
| 418 | Ga0451853_2289717 | 3300041512 | Bacteria | 747 |
| 419 | Ga0451853_3770463 | 3300041512 | Bacteria | 573 |
| 420 | Ga0439431_0001548 | 3300041997 | Bacteria | 5093 |
| 421 | Ga0439442_007871 | 3300042002 | Bacteria | 2151 |
| 422 | Ga0439434_0134917 | 3300042435 | Bacteria | 811 |
| 423 | Ga0439435_0059908 | 3300042436 | Bacteria | 1107 |
| 424 | Ga0466969_0208295 | 3300044656 | Bacteria | 891 |
| 425 | Ga0466972_0252989 | 3300044658 | Bacteria | 823 |
| 426 | Ga0466965_0034243 | 3300044683 | Bacteria | 2485 |
| 427 | Ga0466966_0031433 | 3300044684 | Bacteria | 3443 |
| 428 | Ga0466966_0276626 | 3300044684 | Bacteria | 1010 |
| 429 | Ga0466961_0094341 | 3300044693 | Bacteria | 1888 |
| 430 | Ga0466961_0296851 | 3300044693 | Bacteria | 987 |
| 431 | Ga0466963_0033323 | 3300044694 | Bacteria | 3343 |
| 432 | Ga0466963_0035750 | 3300044694 | Bacteria | 3237 |
| 433 | Ga0466963_0090128 | 3300044694 | Bacteria | 2087 |
| 434 | Ga0466963_0233391 | 3300044694 | Bacteria | 1289 |
| 435 | Ga0466964_0140355 | 3300044706 | Bacteria | 1110 |
| 436 | Ga0466971_0026763 | 3300044719 | Bacteria | 2580 |
| 437 | Ga0466971_0032310 | 3300044719 | Bacteria | 2345 |
| 438 | Ga0466971_0058338 | 3300044719 | Bacteria | 1742 |
| 439 | Ga0466968_0008896 | 3300044735 | Bacteria | 3853 |
| 440 | Ga0466968_0281793 | 3300044735 | Bacteria | 796 |
| 441 | Ga0466970_0078052 | 3300044765 | Bacteria | 1786 |
| 442 | Ga0466970_0160641 | 3300044765 | Bacteria | 1243 |
| 443 | Ga0466970_0423686 | 3300044765 | Bacteria | 761 |
| 444 | Ga0466970_0437885 | 3300044765 | Bacteria | 748 |
| 445 | Ga0466970_0547205 | 3300044765 | Bacteria | 669 |
| 446 | Ga0466957_0049815 | 3300044842 | Bacteria | 2547 |
| 447 | Ga0466957_0236789 | 3300044842 | Bacteria | 1210 |
| 448 | Ga0466960_0011745 | 3300044901 | Bacteria | 3676 |
| 449 | Ga0466960_0061867 | 3300044901 | Bacteria | 1839 |
| 450 | Ga0466959_0026324 | 3300045049 | Bacteria | 4311 |
| 451 | Ga0466959_0072859 | 3300045049 | Bacteria | 2485 |
| 452 | Ga0466959_0292387 | 3300045049 | Bacteria | 1117 |
| 453 | Ga0466958_0154332 | 3300045836 | Bacteria | 1449 |
| 454 | Ga0466958_0260122 | 3300045836 | Bacteria | 1111 |
| 455 | Ga0466958_0293888 | 3300045836 | Bacteria | 1042 |
| 456 | Ga0466958_0493153 | 3300045836 | Bacteria | 795 |
| 457 | Ga0466967_0003093 | 3300045976 | Bacteria | 10702 |
| 458 | Ga0466967_0013586 | 3300045976 | Bacteria | 6300 |
| 459 | Ga0466967_0023877 | 3300045976 | Bacteria | 5018 |
| 460 | Ga0466967_0301207 | 3300045976 | Bacteria | 1542 |
| 461 | Ga0466967_0409075 | 3300045976 | Bacteria | 1321 |
| 462 | Ga0466967_0600668 | 3300045976 | Bacteria | 1086 |
| 463 | Ga0466967_0805672 | 3300045976 | Bacteria | 933 |
| 464 | Ga0466967_0951721 | 3300045976 | Bacteria | 855 |
| 465 | Ga0466967_1045977 | 3300045976 | Bacteria | 813 |
| 466 | Ga0466967_1073442 | 3300045976 | Bacteria | 802 |
| 467 | Ga0466967_1252127 | 3300045976 | Unclassified | 739 |
| 468 | Ga0466967_1363013 | 3300045976 | Bacteria | 706 |
| 469 | Ga0466967_1432110 | 3300045976 | Bacteria | 688 |
| 470 | Ga0466967_1486107 | 3300045976 | Bacteria | 675 |
| 471 | Ga0466967_2186334 | 3300045976 | Bacteria | 549 |
| 472 | Ga0495603_0112621 | 3300046455 | Bacteria | 1586 |
| 473 | Ga0495638_0040373 | 3300046460 | Bacteria | 2957 |
| 474 | Ga0495651_0068995 | 3300046462 | Bacteria | 2694 |
| 475 | Ga0495653_0067089 | 3300046463 | Bacteria | 2696 |
| 476 | Ga0495653_0387296 | 3300046463 | Bacteria | 891 |
| 477 | Ga0495639_0176509 | 3300046475 | Bacteria | 1039 |
| 478 | Ga0495662_0163556 | 3300046476 | Bacteria | 1097 |
| 479 | Ga0495664_0206828 | 3300046477 | Bacteria | 1189 |
| 480 | Ga0495594_0361818 | 3300046499 | Bacteria | 826 |
| 481 | Ga0495608_0445525 | 3300046511 | Bacteria | 788 |
| 482 | Ga0495608_0649549 | 3300046511 | Unclassified | 630 |
| 483 | Ga0495618_0469655 | 3300046514 | Unclassified | 762 |
| 484 | Ga0495628_0300540 | 3300046516 | Bacteria | 1188 |
| 485 | Ga0495630_0742738 | 3300046517 | Unclassified | 750 |
| 486 | Ga0495648_0216946 | 3300046524 | Bacteria | 946 |
| 487 | Ga0495652_0160853 | 3300046529 | Bacteria | 1744 |
| 488 | Ga0495665_0080640 | 3300046531 | Bacteria | 1712 |
| 489 | Ga0495640_0175606 | 3300046533 | Bacteria | 1367 |
| 490 | Ga0495587_0303226 | 3300046536 | Bacteria | 893 |
| 491 | Ga0495667_0119815 | 3300046559 | Bacteria | 1700 |
| 492 | Ga0495634_0044910 | 3300046642 | Bacteria | 2989 |
| 493 | Ga0495635_0005944 | 3300046663 | Bacteria | 8515 |
| 494 | Ga0495657_0019023 | 3300046675 | Bacteria | 4962 |
| 495 | Ga0495657_0447062 | 3300046675 | Bacteria | 757 |
| 496 | Ga0495647_0032871 | 3300046681 | Bacteria | 1936 |
| 497 | Ga0495658_0742803 | 3300046683 | Bacteria | 629 |
| 498 | Ga0495613_0037167 | 3300046689 | Bacteria | 3610 |
| 499 | Ga0495624_0231630 | 3300046690 | Bacteria | 1119 |
| 500 | Ga0495649_0154879 | 3300046694 | Bacteria | 1203 |
| 501 | Ga0495600_0542182 | 3300046809 | Bacteria | 711 |
| 502 | Ga0495604_0162893 | 3300047317 | Bacteria | 1574 |
| 503 | Ga0495604_0725119 | 3300047317 | Bacteria | 630 |
| 504 | Ga0495674_0370676 | 3300047319 | Bacteria | 1160 |
| 505 | Ga0495672_0030035 | 3300047320 | Bacteria | 3415 |
| 506 | Ga0495672_0223884 | 3300047320 | Bacteria | 927 |
| 507 | Ga0495676_0027314 | 3300047321 | Bacteria | 4895 |
| 508 | Ga0495676_0852769 | 3300047321 | Bacteria | 585 |
| 509 | Ga0495684_0108829 | 3300047471 | Bacteria | 2093 |
| 510 | Ga0495602_0721107 | 3300048088 | Bacteria | 675 |
| 511 | Ga0496100_0005195 | 3300048903 | Bacteria | 6986 |
| 512 | Ga0496100_0142140 | 3300048903 | Bacteria | 1702 |
| 513 | Ga0496100_0384966 | 3300048903 | Bacteria | 1066 |
| 514 | Ga0496100_0403034 | 3300048903 | Bacteria | 1042 |
| 515 | Ga0496100_0476213 | 3300048903 | Bacteria | 960 |
| 516 | Ga0496100_0616133 | 3300048903 | Bacteria | 844 |
| 517 | Ga0496101_0002316 | 3300048904 | Bacteria | 11658 |
| 518 | Ga0496101_0060971 | 3300048904 | Bacteria | 2738 |
| 519 | Ga0496101_0132603 | 3300048904 | Bacteria | 1893 |
| 520 | Ga0496101_0157742 | 3300048904 | Bacteria | 1739 |
| 521 | Ga0496101_0422942 | 3300048904 | Bacteria | 1050 |
| 522 | Ga0496102_0000070 | 3300048905 | Bacteria | 155087 |
| 523 | Ga0496102_0000600 | 3300048905 | Bacteria | 37655 |
| 524 | Ga0496102_0004697 | 3300048905 | Bacteria | 11558 |
| 525 | Ga0496102_0008806 | 3300048905 | Bacteria | 8658 |
| 526 | Ga0496102_0023709 | 3300048905 | Bacteria | 5453 |
| 527 | Ga0496102_0037090 | 3300048905 | Bacteria | 4396 |
| 528 | Ga0496102_0076178 | 3300048905 | Bacteria | 3085 |
| 529 | Ga0496102_0146132 | 3300048905 | Bacteria | 2219 |
| 530 | Ga0496102_0152737 | 3300048905 | Bacteria | 2170 |
| 531 | Ga0496102_0409613 | 3300048905 | Bacteria | 1274 |
| 532 | Ga0496102_0865657 | 3300048905 | Bacteria | 826 |
| 533 | Ga0496102_1623856 | 3300048905 | Bacteria | 565 |
| 534 | Ga0496103_0000477 | 3300048906 | Bacteria | 33721 |
| 535 | Ga0496103_0000667 | 3300048906 | Bacteria | 25794 |
| 536 | Ga0496103_0023011 | 3300048906 | Bacteria | 3756 |
| 537 | Ga0496104_0000672 | 3300048907 | Bacteria | 29365 |
| 538 | Ga0496104_0078845 | 3300048907 | Bacteria | 3139 |
| 539 | Ga0496104_0215608 | 3300048907 | Bacteria | 1831 |
| 540 | Ga0496104_0358326 | 3300048907 | Bacteria | 1371 |
| 541 | Ga0496104_0455758 | 3300048907 | Bacteria | 1191 |
| 542 | Ga0496104_0470792 | 3300048907 | Bacteria | 1168 |
| 543 | Ga0496104_0777574 | 3300048907 | Bacteria | 864 |
| 544 | Ga0496104_0913417 | 3300048907 | Bacteria | 783 |
| 545 | Ga0496105_0049701 | 3300048908 | Bacteria | 3463 |
| 546 | Ga0496105_0070081 | 3300048908 | Bacteria | 2898 |
| 547 | Ga0496105_0696440 | 3300048908 | Bacteria | 780 |
| 548 | Ga0496106_0010257 | 3300048909 | Bacteria | 6926 |
| 549 | Ga0496106_0130136 | 3300048909 | Bacteria | 1973 |
| 550 | Ga0496106_0153804 | 3300048909 | Bacteria | 1815 |
| 551 | Ga0496107_0002661 | 3300048910 | Bacteria | 11698 |
| 552 | Ga0496107_0028337 | 3300048910 | Bacteria | 3979 |
| 553 | Ga0496107_0047928 | 3300048910 | Bacteria | 3077 |
| 554 | Ga0496107_0260312 | 3300048910 | Bacteria | 1291 |
| 555 | Ga0496108_0013001 | 3300048911 | Bacteria | 6781 |
| 556 | Ga0496108_0026492 | 3300048911 | Bacteria | 4782 |
| 557 | Ga0496108_0141874 | 3300048911 | Bacteria | 2070 |
| 558 | Ga0496108_0167033 | 3300048911 | Bacteria | 1903 |
| 559 | Ga0496108_0353081 | 3300048911 | Bacteria | 1283 |
| 560 | Ga0496108_0518759 | 3300048911 | Bacteria | 1040 |
| 561 | Ga0496109_0001605 | 3300048912 | Bacteria | 18874 |
| 562 | Ga0496109_0019118 | 3300048912 | Bacteria | 6034 |
| 563 | Ga0496109_0033495 | 3300048912 | Bacteria | 4622 |
| 564 | Ga0496109_0190134 | 3300048912 | Bacteria | 1929 |
| 565 | Ga0496109_0233339 | 3300048912 | Bacteria | 1731 |
| 566 | Ga0496109_0285342 | 3300048912 | Bacteria | 1556 |
| 567 | Ga0496109_1475156 | 3300048912 | Bacteria | 615 |
| 568 | Ga0496110_0003786 | 3300048913 | Bacteria | 11654 |
| 569 | Ga0496110_0056564 | 3300048913 | Bacteria | 3452 |
| 570 | Ga0496110_0100686 | 3300048913 | Bacteria | 2590 |
| 571 | Ga0496110_0130988 | 3300048913 | Bacteria | 2265 |
| 572 | Ga0496110_1421049 | 3300048913 | Bacteria | 603 |
| 573 | Ga0496111_0155726 | 3300048914 | Bacteria | 1695 |
| 574 | Ga0496111_0455696 | 3300048914 | Bacteria | 943 |
| 575 | Ga0496112_0003367 | 3300048915 | Bacteria | 13198 |
| 576 | Ga0496112_0104600 | 3300048915 | Bacteria | 2801 |
| 577 | Ga0496112_0262360 | 3300048915 | Bacteria | 1677 |
| 578 | Ga0496112_0444951 | 3300048915 | Bacteria | 1234 |
| 579 | Ga0496112_0532420 | 3300048915 | Bacteria | 1109 |
| 580 | Ga0496112_0564314 | 3300048915 | Bacteria | 1072 |
| 581 | Ga0496112_0763421 | 3300048915 | Bacteria | 893 |
| 582 | Ga0496113_0000481 | 3300048916 | Bacteria | 19604 |
| 583 | Ga0496113_0028291 | 3300048916 | Bacteria | 4030 |
| 584 | Ga0496113_0255357 | 3300048916 | Bacteria | 1400 |
| 585 | Ga0496113_0465287 | 3300048916 | Bacteria | 1016 |
| 586 | Ga0496114_0001610 | 3300048917 | Bacteria | 17143 |
| 587 | Ga0496114_0024763 | 3300048917 | Bacteria | 4900 |
| 588 | Ga0496114_0145542 | 3300048917 | Bacteria | 2054 |
| 589 | Ga0496115_0033380 | 3300048918 | Bacteria | 4064 |
| 590 | Ga0496115_0696981 | 3300048918 | Bacteria | 799 |
| 591 | Ga0496116_0023877 | 3300048919 | Bacteria | 4540 |
| 592 | Ga0496117_0001117 | 3300048920 | Bacteria | 40451 |
| 593 | Ga0496117_0097902 | 3300048920 | Bacteria | 1867 |
| 594 | Ga0496118_0000272 | 3300048921 | Bacteria | 91016 |
| 595 | Ga0496118_0004850 | 3300048921 | Bacteria | 15670 |
| 596 | Ga0496119_0001634 | 3300048922 | Bacteria | 26464 |
| 597 | Ga0496119_0016323 | 3300048922 | Bacteria | 5658 |
| 598 | Ga0496119_0439828 | 3300048922 | Bacteria | 616 |
| 599 | Ga0496120_0000203 | 3300048923 | Bacteria | 101935 |
| 600 | Ga0496120_0015370 | 3300048923 | Bacteria | 5054 |
| 601 | Ga0496121_0002543 | 3300048924 | Bacteria | 27647 |
| 602 | Ga0496124_0402552 | 3300048927 | Bacteria | 949 |
| 603 | Ga0496125_0010205 | 3300048928 | Bacteria | 9521 |
| 604 | Ga0496126_0035353 | 3300048929 | Bacteria | 4684 |
| 605 | Ga0496126_0104599 | 3300048929 | Bacteria | 2473 |
| 606 | Ga0496126_0158219 | 3300048929 | Bacteria | 1937 |
| 607 | Ga0496126_0867474 | 3300048929 | Bacteria | 687 |
| 608 | Ga0501031_0137044 | 3300049568 | Bacteria | 1599 |
| 609 | Ga0501032_0003933 | 3300049569 | Bacteria | 11273 |
| 610 | Ga0501032_0009488 | 3300049569 | Bacteria | 7053 |
| 611 | Ga0501033_0005242 | 3300049570 | Bacteria | 10291 |
| 612 | Ga0501033_0928843 | 3300049570 | Bacteria | 584 |
| 613 | Ga0501034_0015666 | 3300049571 | Bacteria | 7784 |
| 614 | Ga0501034_0021567 | 3300049571 | Bacteria | 6562 |
| 615 | Ga0501034_0285927 | 3300049571 | Bacteria | 1588 |
| 616 | Ga0501034_0457086 | 3300049571 | Bacteria | 1194 |
| 617 | Ga0501034_0576746 | 3300049571 | Bacteria | 1032 |
| 618 | Ga0501034_1350627 | 3300049571 | Bacteria | 588 |
| 619 | Ga0501036_0033912 | 3300049572 | Bacteria | 4318 |
| 620 | Ga0501037_0000099 | 3300049573 | Bacteria | 81092 |
| 621 | Ga0501037_0011193 | 3300049573 | Bacteria | 6603 |
| 622 | Ga0501039_0008540 | 3300049575 | Bacteria | 7808 |
| 623 | Ga0501040_0589116 | 3300049576 | Unclassified | 803 |
| 624 | Ga0501041_0666785 | 3300049577 | Bacteria | 665 |
| 625 | Ga0501043_0000228 | 3300049579 | Bacteria | 51127 |
| 626 | Ga0501043_0061911 | 3300049579 | Bacteria | 2938 |
| 627 | Ga0501046_0011358 | 3300049580 | Bacteria | 7620 |
| 628 | Ga0501047_0002023 | 3300049581 | Bacteria | 19406 |
| 629 | Ga0501047_0395108 | 3300049581 | Bacteria | 1216 |
| 630 | Ga0501048_0019214 | 3300049582 | Bacteria | 5017 |
| 631 | Ga0501067_0277294 | 3300049583 | Bacteria | 934 |
| 632 | Ga0501068_0142958 | 3300049584 | Bacteria | 1500 |
| 633 | Ga0501069_0042281 | 3300049585 | Bacteria | 2521 |
| 634 | Ga0501070_0006875 | 3300049586 | Bacteria | 9677 |
| 635 | Ga0501070_0020965 | 3300049586 | Bacteria | 5482 |
| 636 | Ga0501070_0197944 | 3300049586 | Bacteria | 1650 |
| 637 | Ga0501070_1180289 | 3300049586 | Bacteria | 588 |
| 638 | Ga0501071_0336612 | 3300049587 | Bacteria | 1147 |
| 639 | Ga0501073_0397299 | 3300049589 | Bacteria | 952 |
| 640 | Ga0501073_0506825 | 3300049589 | Bacteria | 834 |
| 641 | Ga0501080_0018162 | 3300049742 | Bacteria | 6510 |
| 642 | Ga0501083_0036359 | 3300049744 | Bacteria | 3359 |
| 643 | Ga0501035_0002184 | 3300049822 | Bacteria | 19411 |
| 644 | Ga0501044_0002158 | 3300049823 | Bacteria | 22557 |
| 645 | Ga0501044_0014552 | 3300049823 | Bacteria | 8488 |
| 646 | Ga0501044_0253972 | 3300049823 | Bacteria | 1698 |
| 647 | Ga0501044_0827104 | 3300049823 | Bacteria | 804 |
| 648 | nmdc:mga03683_439054_c1 | 3300050489 | Bacteria | 627 |
| 649 | nmdc:mga03683_6343_c1 | 3300050489 | Bacteria | 4043 |
| 650 | nmdc:mga03683_72136_c1 | 3300050489 | Bacteria | 1478 |
| 651 | nmdc:mga03n38_68444_c1 | 3300050490 | Bacteria | 1637 |
| 652 | nmdc:mga03n38_767172_c1 | 3300050490 | Bacteria | 560 |
| 653 | nmdc:mga03n38_78819_c1 | 3300050490 | Bacteria | 1543 |
| 654 | nmdc:mga03n38_866344_c1 | 3300050490 | Bacteria | 529 |
| 655 | nmdc:mga00v17_254310_c1 | 3300050491 | Bacteria | 1139 |
| 656 | nmdc:mga00v17_311709_c1 | 3300050491 | Unclassified | 1022 |
| 657 | nmdc:mga00v17_36772_c1 | 3300050491 | Bacteria | 2920 |
| 658 | nmdc:mga00v17_81190_c1 | 3300050491 | Bacteria | 2025 |
| 659 | nmdc:mga00v17_97515_c1 | 3300050491 | Bacteria | 1853 |
| 660 | nmdc:mga0yw44_113814_c1 | 3300050492 | Bacteria | 1736 |
| 661 | nmdc:mga0yw44_467099_c1 | 3300050492 | Bacteria | 855 |
| 662 | nmdc:mga0yw44_51090_c1 | 3300050492 | Bacteria | 1631 |
| 663 | nmdc:mga0yw44_818969_c1 | 3300050492 | Bacteria | 632 |
| 664 | nmdc:mga06z11_806305_c1 | 3300050494 | Bacteria | 572 |
| 665 | nmdc:mga06z11_830948_c1 | 3300050494 | Bacteria | 563 |
| 666 | nmdc:mga07m45_329260_c1 | 3300050496 | Bacteria | 888 |
| 667 | nmdc:mga09592_569056_c1 | 3300050508 | Bacteria | 972 |
| 668 | nmdc:mga0qj67_141345_c2 | 3300050509 | Bacteria | 1387 |
| 669 | nmdc:mga0qj67_28056_c1 | 3300050509 | Bacteria | 4367 |
| 670 | nmdc:mga06r32_5670_c1 | 3300050510 | Bacteria | 11237 |
| 671 | nmdc:mga08y16_388379_c1 | 3300050511 | Bacteria | 1430 |
| 672 | nmdc:mga0sz30_116573_c1 | 3300050516 | Bacteria | 1172 |
| 673 | nmdc:mga0sz30_165695_c1 | 3300050516 | Bacteria | 979 |
| 674 | nmdc:mga0sz30_169013_c1 | 3300050516 | Unclassified | 969 |
| 675 | nmdc:mga0sz30_1896_c2 | 3300050516 | Bacteria | 5690 |
| 676 | nmdc:mga0sz30_6965_c1 | 3300050516 | Bacteria | 4225 |
| 677 | nmdc:mga0sz30_97397_c1 | 3300050516 | Bacteria | 1283 |
| 678 | Ga0495612_0191720 | 3300053078 | Bacteria | 900 |
| 679 | Ga0500635_0045829 | 3300053080 | Bacteria | 1481 |
| 680 | Ga0495619_0255368 | 3300053085 | Unclassified | 1214 |
| 681 | Ga0500578_0659327 | 3300053086 | Bacteria | 568 |
| 682 | Ga0500604_0016559 | 3300053151 | Bacteria | 2032 |
| 683 | Ga0500616_0015627 | 3300053153 | Bacteria | 4334 |
| 684 | Ga0466962_0032975 | 3300061719 | Bacteria | 2478 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041453 | Ga0451797_0034473 | Ga0451797_0034473_225_647 | 128 |
| 2 | 3300031901 | Ga0307406_10177476 | Ga0307406_101774764 | 134 |
| 3 | 3300032126 | Ga0307415_102238496 | Ga0307415_1022384962 | 134 |
| 4 | 3300005457 | Ga0070662_101936736 | Ga0070662_1019367361 | 135 |
| 5 | 3300006028 | Ga0070717_10993873 | Ga0070717_109938732 | 135 |
| 6 | iso_pu_bacteria | 2751185782 | 2753264392 | 135 |
| 7 | 3300013308 | Ga0157375_12703309 | Ga0157375_127033091 | 136 |
| 8 | 3300050516 | nmdc:mga0sz30_116573_c1 | nmdc:mga0sz30_116573_c1_457_867 | 136 |
| 9 | 3300014969 | Ga0157376_11565559 | Ga0157376_115655592 | 137 |
| 10 | 3300003322 | rootL2_10132418 | rootL2_101324182 | 138 |
| 11 | 3300005335 | Ga0070666_10306095 | Ga0070666_103060952 | 138 |
| 12 | 3300005535 | Ga0070684_100168020 | Ga0070684_1001680203 | 138 |
| 13 | 3300005548 | Ga0070665_101103995 | Ga0070665_1011039951 | 138 |
| 14 | 3300005564 | Ga0070664_101951543 | Ga0070664_1019515431 | 138 |
| 15 | 3300005983 | Ga0081540_1044640 | Ga0081540_10446403 | 138 |
| 16 | 3300009551 | Ga0105238_12904706 | Ga0105238_129047061 | 138 |
| 17 | 3300026078 | Ga0207702_10266699 | Ga0207702_102666993 | 138 |
| 18 | 3300031507 | Ga0307509_10039018 | Ga0307509_100390185 | 138 |
| 19 | 3300033179 | Ga0307507_10058915 | Ga0307507_100589155 | 138 |
| 20 | 3300035692 | Ga0373935_0192513 | Ga0373935_0192513_52_498 | 138 |
| 21 | 3300005347 | Ga0070668_100003461 | Ga0070668_1000034619 | 141 |
| 22 | 3300005467 | Ga0070706_102006561 | Ga0070706_1020065611 | 141 |
| 23 | 3300005617 | Ga0068859_100065886 | Ga0068859_1000658865 | 141 |
| 24 | 3300005844 | Ga0068862_100021009 | Ga0068862_1000210094 | 141 |
| 25 | 3300006931 | Ga0097620_100065888 | Ga0097620_1000658885 | 141 |
| 26 | 3300009098 | Ga0105245_10015297 | Ga0105245_100152974 | 141 |
| 27 | 3300009174 | Ga0105241_10411288 | Ga0105241_104112882 | 141 |
| 28 | 3300009176 | Ga0105242_10120942 | Ga0105242_101209422 | 141 |
| 29 | 3300010375 | Ga0105239_10415271 | Ga0105239_104152712 | 141 |
| 30 | 3300013296 | Ga0157374_10479103 | Ga0157374_104791031 | 141 |
| 31 | 3300013297 | Ga0157378_10156287 | Ga0157378_101562872 | 141 |
| 32 | 3300014325 | Ga0163163_11030660 | Ga0163163_110306602 | 141 |
| 33 | 3300025910 | Ga0207684_11349584 | Ga0207684_113495841 | 141 |
| 34 | 3300025923 | Ga0207681_11225151 | Ga0207681_112251511 | 141 |
| 35 | 3300025927 | Ga0207687_10012506 | Ga0207687_100125062 | 141 |
| 36 | 3300025934 | Ga0207686_10065458 | Ga0207686_100654584 | 141 |
| 37 | 3300025972 | Ga0207668_10002046 | Ga0207668_100020464 | 141 |
| 38 | 3300031731 | Ga0307405_10175459 | Ga0307405_101754592 | 141 |
| 39 | 3300044765 | Ga0466970_0160641 | Ga0466970_0160641_95_520 | 141 |
| 40 | iso_pu_bacteria | 8055157932 | 8055158918 | 141 |
| 41 | 3300005327 | Ga0070658_11138118 | Ga0070658_111381181 | 142 |
| 42 | 3300009098 | Ga0105245_12331702 | Ga0105245_123317021 | 142 |
| 43 | 3300010375 | Ga0105239_11718287 | Ga0105239_117182871 | 142 |
| 44 | 3300025928 | Ga0207700_10621914 | Ga0207700_106219142 | 142 |
| 45 | 3300025949 | Ga0207667_10082434 | Ga0207667_100824343 | 142 |
| 46 | 3300026078 | Ga0207702_10803924 | Ga0207702_108039242 | 142 |
| 47 | 3300046463 | Ga0495653_0067089 | Ga0495653_0067089_985_1428 | 143 |
| 48 | 3300046514 | Ga0495618_0469655 | Ga0495618_0469655_248_691 | 143 |
| 49 | 3300046516 | Ga0495628_0300540 | Ga0495628_0300540_653_1096 | 143 |
| 50 | 3300046517 | Ga0495630_0742738 | Ga0495630_0742738_231_674 | 143 |
| 51 | 3300047319 | Ga0495674_0370676 | Ga0495674_0370676_112_555 | 143 |
| 52 | 3300047471 | Ga0495684_0108829 | Ga0495684_0108829_546_989 | 143 |
| 53 | 3300053085 | Ga0495619_0255368 | Ga0495619_0255368_633_1076 | 143 |
| 54 | 3300005364 | Ga0070673_100311897 | Ga0070673_1003118972 | 144 |
| 55 | 3300025924 | Ga0207694_10023319 | Ga0207694_100233193 | 144 |
| 56 | 3300037853 | Ga0436364_0023947 | Ga0436364_0023947_880_1314 | 144 |
| 57 | 3300045836 | Ga0466958_0493153 | Ga0466958_0493153_49_483 | 144 |
| 58 | 3300046475 | Ga0495639_0176509 | Ga0495639_0176509_536_976 | 144 |
| 59 | 3300046524 | Ga0495648_0216946 | Ga0495648_0216946_226_678 | 144 |
| 60 | 3300046681 | Ga0495647_0032871 | Ga0495647_0032871_152_592 | 144 |
| 61 | 3300048915 | Ga0496112_0763421 | Ga0496112_0763421_402_836 | 144 |
| 62 | 3300048916 | Ga0496113_0000481 | Ga0496113_0000481_18101_18535 | 144 |
| 63 | 3300005329 | Ga0070683_102131417 | Ga0070683_1021314171 | 145 |
| 64 | 3300005338 | Ga0068868_101280560 | Ga0068868_1012805601 | 145 |
| 65 | 3300005436 | Ga0070713_100357314 | Ga0070713_1003573141 | 145 |
| 66 | 3300005466 | Ga0070685_10474545 | Ga0070685_104745452 | 145 |
| 67 | 3300005548 | Ga0070665_100461108 | Ga0070665_1004611082 | 145 |
| 68 | 3300005577 | Ga0068857_100387988 | Ga0068857_1003879881 | 145 |
| 69 | 3300006038 | Ga0075365_10015619 | Ga0075365_100156193 | 145 |
| 70 | 3300006048 | Ga0075363_100941004 | Ga0075363_1009410041 | 145 |
| 71 | 3300006051 | Ga0075364_10071227 | Ga0075364_100712272 | 145 |
| 72 | 3300006186 | Ga0075369_10137154 | Ga0075369_101371542 | 145 |
| 73 | 3300009098 | Ga0105245_10123070 | Ga0105245_101230702 | 145 |
| 74 | 3300009101 | Ga0105247_10000178 | Ga0105247_1000017844 | 145 |
| 75 | 3300009174 | Ga0105241_10781865 | Ga0105241_107818652 | 145 |
| 76 | 3300009177 | Ga0105248_10007315 | Ga0105248_100073152 | 145 |
| 77 | 3300009551 | Ga0105238_11305256 | Ga0105238_113052561 | 145 |
| 78 | 3300011119 | Ga0105246_11903516 | Ga0105246_119035161 | 145 |
| 79 | 3300013306 | Ga0163162_10706108 | Ga0163162_107061082 | 145 |
| 80 | 3300014968 | Ga0157379_10009932 | Ga0157379_100099329 | 145 |
| 81 | 3300014969 | Ga0157376_10305068 | Ga0157376_103050681 | 145 |
| 82 | 3300025929 | Ga0207664_11570252 | Ga0207664_115702521 | 145 |
| 83 | 3300025944 | Ga0207661_11754810 | Ga0207661_117548102 | 145 |
| 84 | 3300026023 | Ga0207677_11401236 | Ga0207677_114012361 | 145 |
| 85 | 3300028666 | Ga0265336_10003716 | Ga0265336_100037163 | 145 |
| 86 | 3300028786 | Ga0307517_10042614 | Ga0307517_100426144 | 145 |
| 87 | 3300028794 | Ga0307515_10236659 | Ga0307515_102366592 | 145 |
| 88 | 3300028800 | Ga0265338_10011151 | Ga0265338_100111514 | 145 |
| 89 | 3300031456 | Ga0307513_10007598 | Ga0307513_100075987 | 145 |
| 90 | 3300031548 | Ga0307408_100126425 | Ga0307408_1001264254 | 145 |
| 91 | 3300031852 | Ga0307410_10534364 | Ga0307410_105343642 | 145 |
| 92 | 3300031901 | Ga0307406_10029544 | Ga0307406_100295444 | 145 |
| 93 | 3300031903 | Ga0307407_10069595 | Ga0307407_100695952 | 145 |
| 94 | 3300031911 | Ga0307412_11089890 | Ga0307412_110898901 | 145 |
| 95 | 3300032002 | Ga0307416_100019395 | Ga0307416_1000193954 | 145 |
| 96 | 3300032126 | Ga0307415_100010281 | Ga0307415_1000102816 | 145 |
| 97 | 3300041512 | Ga0451853_2289717 | Ga0451853_2289717_266_706 | 145 |
| 98 | 3300044656 | Ga0466969_0208295 | Ga0466969_0208295_172_612 | 145 |
| 99 | 3300044684 | Ga0466966_0031433 | Ga0466966_0031433_2375_2815 | 145 |
| 100 | 3300044694 | Ga0466963_0035750 | Ga0466963_0035750_1093_1533 | 145 |
| 101 | 3300044735 | Ga0466968_0281793 | Ga0466968_0281793_35_472 | 145 |
| 102 | 3300045976 | Ga0466967_0013586 | Ga0466967_0013586_2823_3263 | 145 |
| 103 | 3300045976 | Ga0466967_0409075 | Ga0466967_0409075_25_462 | 145 |
| 104 | 3300045976 | Ga0466967_0805672 | Ga0466967_0805672_179_616 | 145 |
| 105 | 3300045976 | Ga0466967_1252127 | Ga0466967_1252127_52_489 | 145 |
| 106 | 3300046460 | Ga0495638_0040373 | Ga0495638_0040373_330_767 | 145 |
| 107 | 3300046476 | Ga0495662_0163556 | Ga0495662_0163556_206_643 | 145 |
| 108 | 3300046511 | Ga0495608_0445525 | Ga0495608_0445525_205_642 | 145 |
| 109 | 3300046531 | Ga0495665_0080640 | Ga0495665_0080640_725_1162 | 145 |
| 110 | 3300046536 | Ga0495587_0303226 | Ga0495587_0303226_109_546 | 145 |
| 111 | 3300046683 | Ga0495658_0742803 | Ga0495658_0742803_135_572 | 145 |
| 112 | 3300047317 | Ga0495604_0725119 | Ga0495604_0725119_12_449 | 145 |
| 113 | 3300048088 | Ga0495602_0721107 | Ga0495602_0721107_134_661 | 145 |
| 114 | 3300048903 | Ga0496100_0384966 | Ga0496100_0384966_294_731 | 145 |
| 115 | 3300048903 | Ga0496100_0476213 | Ga0496100_0476213_475_912 | 145 |
| 116 | 3300048903 | Ga0496100_0616133 | Ga0496100_0616133_94_531 | 145 |
| 117 | 3300048904 | Ga0496101_0422942 | Ga0496101_0422942_153_590 | 145 |
| 118 | 3300048905 | Ga0496102_0037090 | Ga0496102_0037090_3635_4072 | 145 |
| 119 | 3300048905 | Ga0496102_1623856 | Ga0496102_1623856_54_500 | 145 |
| 120 | 3300048907 | Ga0496104_0000672 | Ga0496104_0000672_26655_27092 | 145 |
| 121 | 3300048907 | Ga0496104_0215608 | Ga0496104_0215608_60_500 | 145 |
| 122 | 3300048907 | Ga0496104_0455758 | Ga0496104_0455758_196_633 | 145 |
| 123 | 3300048907 | Ga0496104_0470792 | Ga0496104_0470792_699_1136 | 145 |
| 124 | 3300048907 | Ga0496104_0913417 | Ga0496104_0913417_189_626 | 145 |
| 125 | 3300048908 | Ga0496105_0070081 | Ga0496105_0070081_2320_2757 | 145 |
| 126 | 3300048911 | Ga0496108_0013001 | Ga0496108_0013001_169_606 | 145 |
| 127 | 3300048911 | Ga0496108_0026492 | Ga0496108_0026492_4130_4570 | 145 |
| 128 | 3300048911 | Ga0496108_0141874 | Ga0496108_0141874_1079_1516 | 145 |
| 129 | 3300048911 | Ga0496108_0167033 | Ga0496108_0167033_355_792 | 145 |
| 130 | 3300048912 | Ga0496109_0001605 | Ga0496109_0001605_4007_4444 | 145 |
| 131 | 3300048912 | Ga0496109_0033495 | Ga0496109_0033495_158_598 | 145 |
| 132 | 3300048912 | Ga0496109_0190134 | Ga0496109_0190134_523_960 | 145 |
| 133 | 3300048912 | Ga0496109_0285342 | Ga0496109_0285342_1024_1461 | 145 |
| 134 | 3300048913 | Ga0496110_0003786 | Ga0496110_0003786_10934_11371 | 145 |
| 135 | 3300048913 | Ga0496110_0056564 | Ga0496110_0056564_2339_2776 | 145 |
| 136 | 3300048913 | Ga0496110_0100686 | Ga0496110_0100686_1883_2323 | 145 |
| 137 | 3300048914 | Ga0496111_0155726 | Ga0496111_0155726_300_737 | 145 |
| 138 | 3300048914 | Ga0496111_0455696 | Ga0496111_0455696_188_628 | 145 |
| 139 | 3300048915 | Ga0496112_0003367 | Ga0496112_0003367_9281_9721 | 145 |
| 140 | 3300048915 | Ga0496112_0532420 | Ga0496112_0532420_503_940 | 145 |
| 141 | 3300048916 | Ga0496113_0028291 | Ga0496113_0028291_3229_3669 | 145 |
| 142 | 3300048916 | Ga0496113_0465287 | Ga0496113_0465287_563_1000 | 145 |
| 143 | 3300048917 | Ga0496114_0024763 | Ga0496114_0024763_861_1298 | 145 |
| 144 | 3300048917 | Ga0496114_0145542 | Ga0496114_0145542_373_810 | 145 |
| 145 | 3300048918 | Ga0496115_0033380 | Ga0496115_0033380_2780_3217 | 145 |
| 146 | 3300048918 | Ga0496115_0696981 | Ga0496115_0696981_347_784 | 145 |
| 147 | 3300048922 | Ga0496119_0001634 | Ga0496119_0001634_8966_9526 | 145 |
| 148 | 3300048922 | Ga0496119_0439828 | Ga0496119_0439828_34_471 | 145 |
| 149 | 3300048923 | Ga0496120_0000203 | Ga0496120_0000203_92410_92970 | 145 |
| 150 | 3300048929 | Ga0496126_0104599 | Ga0496126_0104599_894_1331 | 145 |
| 151 | 3300048929 | Ga0496126_0867474 | Ga0496126_0867474_23_460 | 145 |
| 152 | 3300049586 | Ga0501070_0197944 | Ga0501070_0197944_933_1370 | 145 |
| 153 | 3300050490 | nmdc:mga03n38_866344_c1 | nmdc:mga03n38_866344_c1_55_504 | 145 |
| 154 | 3300050491 | nmdc:mga00v17_311709_c1 | nmdc:mga00v17_311709_c1_350_799 | 145 |
| 155 | 3300050491 | nmdc:mga00v17_36772_c1 | nmdc:mga00v17_36772_c1_2034_2483 | 145 |
| 156 | 3300050492 | nmdc:mga0yw44_113814_c1 | nmdc:mga0yw44_113814_c1_1070_1519 | 145 |
| 157 | 3300053078 | Ga0495612_0191720 | Ga0495612_0191720_317_754 | 145 |
| 158 | 3300053151 | Ga0500604_0016559 | Ga0500604_0016559_62_499 | 145 |
| 159 | 3300053153 | Ga0500616_0015627 | Ga0500616_0015627_49_486 | 145 |
| 160 | iso_pu_bacteria | 2579778521 | 2579852529 | 145 |
| 161 | iso_pu_bacteria | 2619618881 | 2619856392 | 145 |
| 162 | iso_pu_bacteria | 2619619003 | 2620347999 | 145 |
| 163 | iso_pu_bacteria | 2626541554 | 2626638527 | 145 |
| 164 | iso_pu_bacteria | 8054913762 | 8054920599 | 145 |
| 165 | iso_pu_bacteria | 8054920844 | 8054926578 | 145 |
| 166 | 3300005365 | Ga0070688_100540868 | Ga0070688_1005408681 | 146 |
| 167 | 3300005467 | Ga0070706_100587810 | Ga0070706_1005878102 | 146 |
| 168 | 3300005471 | Ga0070698_101685308 | Ga0070698_1016853082 | 146 |
| 169 | 3300005548 | Ga0070665_100059533 | Ga0070665_1000595333 | 146 |
| 170 | 3300005614 | Ga0068856_100004865 | Ga0068856_1000048656 | 146 |
| 171 | 3300005616 | Ga0068852_101771922 | Ga0068852_1017719221 | 146 |
| 172 | 3300006038 | Ga0075365_10227436 | Ga0075365_102274361 | 146 |
| 173 | 3300006038 | Ga0075365_10567653 | Ga0075365_105676532 | 146 |
| 174 | 3300009093 | Ga0105240_10017249 | Ga0105240_100172499 | 146 |
| 175 | 3300009093 | Ga0105240_11631791 | Ga0105240_116317912 | 146 |
| 176 | 3300009545 | Ga0105237_10005813 | Ga0105237_100058134 | 146 |
| 177 | 3300010375 | Ga0105239_10013580 | Ga0105239_100135805 | 146 |
| 178 | 3300014969 | Ga0157376_10193219 | Ga0157376_101932191 | 146 |
| 179 | 3300025913 | Ga0207695_10017640 | Ga0207695_100176404 | 146 |
| 180 | 3300025913 | Ga0207695_10133153 | Ga0207695_101331532 | 146 |
| 181 | 3300026078 | Ga0207702_10005011 | Ga0207702_100050116 | 146 |
| 182 | 3300028379 | Ga0268266_10189338 | Ga0268266_101893382 | 146 |
| 183 | 3300031711 | Ga0265314_10389809 | Ga0265314_103898091 | 146 |
| 184 | 3300037068 | Ga0373925_0005890 | Ga0373925_0005890_8241_8681 | 146 |
| 185 | 3300045976 | Ga0466967_1363013 | Ga0466967_1363013_133_582 | 146 |
| 186 | 3300046455 | Ga0495603_0112621 | Ga0495603_0112621_623_1063 | 146 |
| 187 | 3300046462 | Ga0495651_0068995 | Ga0495651_0068995_1520_1960 | 146 |
| 188 | 3300046463 | Ga0495653_0387296 | Ga0495653_0387296_410_850 | 146 |
| 189 | 3300046477 | Ga0495664_0206828 | Ga0495664_0206828_446_886 | 146 |
| 190 | 3300046499 | Ga0495594_0361818 | Ga0495594_0361818_348_788 | 146 |
| 191 | 3300046511 | Ga0495608_0649549 | Ga0495608_0649549_175_615 | 146 |
| 192 | 3300046529 | Ga0495652_0160853 | Ga0495652_0160853_1226_1666 | 146 |
| 193 | 3300046533 | Ga0495640_0175606 | Ga0495640_0175606_188_628 | 146 |
| 194 | 3300046559 | Ga0495667_0119815 | Ga0495667_0119815_836_1276 | 146 |
| 195 | 3300046642 | Ga0495634_0044910 | Ga0495634_0044910_1814_2254 | 146 |
| 196 | 3300046663 | Ga0495635_0005944 | Ga0495635_0005944_1245_1685 | 146 |
| 197 | 3300046675 | Ga0495657_0019023 | Ga0495657_0019023_3644_4084 | 146 |
| 198 | 3300046675 | Ga0495657_0447062 | Ga0495657_0447062_258_698 | 146 |
| 199 | 3300046689 | Ga0495613_0037167 | Ga0495613_0037167_2549_2989 | 146 |
| 200 | 3300046690 | Ga0495624_0231630 | Ga0495624_0231630_621_1061 | 146 |
| 201 | 3300046809 | Ga0495600_0542182 | Ga0495600_0542182_221_661 | 146 |
| 202 | 3300047317 | Ga0495604_0162893 | Ga0495604_0162893_144_584 | 146 |
| 203 | 3300047321 | Ga0495676_0027314 | Ga0495676_0027314_1893_2333 | 146 |
| 204 | 3300047321 | Ga0495676_0852769 | Ga0495676_0852769_80_523 | 146 |
| 205 | 3300048905 | Ga0496102_0865657 | Ga0496102_0865657_192_632 | 146 |
| 206 | 3300048913 | Ga0496110_1421049 | Ga0496110_1421049_120_563 | 146 |
| 207 | 3300048915 | Ga0496112_0444951 | Ga0496112_0444951_282_752 | 146 |
| 208 | 3300049569 | Ga0501032_0003933 | Ga0501032_0003933_2606_3046 | 146 |
| 209 | 3300049570 | Ga0501033_0928843 | Ga0501033_0928843_59_499 | 146 |
| 210 | 3300049571 | Ga0501034_0021567 | Ga0501034_0021567_3952_4392 | 146 |
| 211 | 3300049571 | Ga0501034_0576746 | Ga0501034_0576746_104_556 | 146 |
| 212 | 3300049572 | Ga0501036_0033912 | Ga0501036_0033912_1188_1628 | 146 |
| 213 | 3300049573 | Ga0501037_0000099 | Ga0501037_0000099_73693_74133 | 146 |
| 214 | 3300049575 | Ga0501039_0008540 | Ga0501039_0008540_4382_4822 | 146 |
| 215 | 3300049576 | Ga0501040_0589116 | Ga0501040_0589116_122_565 | 146 |
| 216 | 3300049577 | Ga0501041_0666785 | Ga0501041_0666785_87_527 | 146 |
| 217 | 3300049579 | Ga0501043_0000228 | Ga0501043_0000228_35189_35629 | 146 |
| 218 | 3300049583 | Ga0501067_0277294 | Ga0501067_0277294_71_511 | 146 |
| 219 | 3300049584 | Ga0501068_0142958 | Ga0501068_0142958_1036_1476 | 146 |
| 220 | 3300049586 | Ga0501070_0020965 | Ga0501070_0020965_4487_4927 | 146 |
| 221 | 3300049587 | Ga0501071_0336612 | Ga0501071_0336612_313_753 | 146 |
| 222 | 3300049589 | Ga0501073_0397299 | Ga0501073_0397299_239_679 | 146 |
| 223 | 3300049823 | Ga0501044_0014552 | Ga0501044_0014552_7439_7879 | 146 |
| 224 | 3300050492 | nmdc:mga0yw44_818969_c1 | nmdc:mga0yw44_818969_c1_171_614 | 146 |
| 225 | 3300050516 | nmdc:mga0sz30_169013_c1 | nmdc:mga0sz30_169013_c1_160_603 | 146 |
| 226 | 3300002067 | JGI24735J21928_10140460 | JGI24735J21928_101404602 | 147 |
| 227 | 3300002070 | JGI24750J21931_1032422 | JGI24750J21931_10324222 | 147 |
| 228 | 3300002075 | JGI24738J21930_10012597 | JGI24738J21930_100125972 | 147 |
| 229 | 3300002076 | JGI24749J21850_1030398 | JGI24749J21850_10303982 | 147 |
| 230 | 3300002077 | JGI24744J21845_10000053 | JGI24744J21845_100000537 | 147 |
| 231 | 3300002077 | JGI24744J21845_10006220 | JGI24744J21845_100062202 | 147 |
| 232 | 3300002239 | JGI24034J26672_10003514 | JGI24034J26672_100035142 | 147 |
| 233 | 3300002244 | JGI24742J22300_10001182 | JGI24742J22300_100011823 | 147 |
| 234 | 3300002459 | JGI24751J29686_10061108 | JGI24751J29686_100611081 | 147 |
| 235 | 3300005328 | Ga0070676_10222942 | Ga0070676_102229422 | 147 |
| 236 | 3300005330 | Ga0070690_100001292 | Ga0070690_1000012928 | 147 |
| 237 | 3300005334 | Ga0068869_100012633 | Ga0068869_1000126333 | 147 |
| 238 | 3300005336 | Ga0070680_100651411 | Ga0070680_1006514111 | 147 |
| 239 | 3300005337 | Ga0070682_100001916 | Ga0070682_1000019169 | 147 |
| 240 | 3300005337 | Ga0070682_100199624 | Ga0070682_1001996242 | 147 |
| 241 | 3300005337 | Ga0070682_101893979 | Ga0070682_1018939791 | 147 |
| 242 | 3300005338 | Ga0068868_100009639 | Ga0068868_1000096397 | 147 |
| 243 | 3300005338 | Ga0068868_100101718 | Ga0068868_1001017182 | 147 |
| 244 | 3300005340 | Ga0070689_100018207 | Ga0070689_1000182075 | 147 |
| 245 | 3300005341 | Ga0070691_10001466 | Ga0070691_100014665 | 147 |
| 246 | 3300005343 | Ga0070687_100889533 | Ga0070687_1008895331 | 147 |
| 247 | 3300005347 | Ga0070668_100000358 | Ga0070668_10000035821 | 147 |
| 248 | 3300005347 | Ga0070668_100364680 | Ga0070668_1003646802 | 147 |
| 249 | 3300005347 | Ga0070668_101893035 | Ga0070668_1018930351 | 147 |
| 250 | 3300005353 | Ga0070669_100001662 | Ga0070669_1000016625 | 147 |
| 251 | 3300005353 | Ga0070669_100008249 | Ga0070669_1000082492 | 147 |
| 252 | 3300005353 | Ga0070669_100168239 | Ga0070669_1001682392 | 147 |
| 253 | 3300005356 | Ga0070674_100003807 | Ga0070674_1000038079 | 147 |
| 254 | 3300005356 | Ga0070674_100995792 | Ga0070674_1009957921 | 147 |
| 255 | 3300005365 | Ga0070688_100002128 | Ga0070688_1000021287 | 147 |
| 256 | 3300005365 | Ga0070688_100027921 | Ga0070688_1000279213 | 147 |
| 257 | 3300005365 | Ga0070688_101148189 | Ga0070688_1011481891 | 147 |
| 258 | 3300005365 | Ga0070688_101408464 | Ga0070688_1014084641 | 147 |
| 259 | 3300005366 | Ga0070659_100063532 | Ga0070659_1000635321 | 147 |
| 260 | 3300005367 | Ga0070667_100000075 | Ga0070667_10000007537 | 147 |
| 261 | 3300005367 | Ga0070667_100004048 | Ga0070667_1000040489 | 147 |
| 262 | 3300005367 | Ga0070667_100012854 | Ga0070667_1000128545 | 147 |
| 263 | 3300005367 | Ga0070667_100164775 | Ga0070667_1001647754 | 147 |
| 264 | 3300005434 | Ga0070709_10005095 | Ga0070709_100050951 | 147 |
| 265 | 3300005434 | Ga0070709_10046065 | Ga0070709_100460654 | 147 |
| 266 | 3300005434 | Ga0070709_10345451 | Ga0070709_103454512 | 147 |
| 267 | 3300005436 | Ga0070713_100552816 | Ga0070713_1005528161 | 147 |
| 268 | 3300005436 | Ga0070713_100601013 | Ga0070713_1006010132 | 147 |
| 269 | 3300005437 | Ga0070710_10001540 | Ga0070710_100015402 | 147 |
| 270 | 3300005438 | Ga0070701_10004264 | Ga0070701_100042646 | 147 |
| 271 | 3300005439 | Ga0070711_100001591 | Ga0070711_1000015918 | 147 |
| 272 | 3300005439 | Ga0070711_100063796 | Ga0070711_1000637963 | 147 |
| 273 | 3300005440 | Ga0070705_100025323 | Ga0070705_1000253232 | 147 |
| 274 | 3300005440 | Ga0070705_100087384 | Ga0070705_1000873842 | 147 |
| 275 | 3300005441 | Ga0070700_100014110 | Ga0070700_1000141105 | 147 |
| 276 | 3300005441 | Ga0070700_100022565 | Ga0070700_1000225654 | 147 |
| 277 | 3300005444 | Ga0070694_100018714 | Ga0070694_1000187147 | 147 |
| 278 | 3300005445 | Ga0070708_100981774 | Ga0070708_1009817742 | 147 |
| 279 | 3300005455 | Ga0070663_100002640 | Ga0070663_1000026407 | 147 |
| 280 | 3300005455 | Ga0070663_101339023 | Ga0070663_1013390231 | 147 |
| 281 | 3300005456 | Ga0070678_100001197 | Ga0070678_1000011973 | 147 |
| 282 | 3300005457 | Ga0070662_100010769 | Ga0070662_1000107697 | 147 |
| 283 | 3300005457 | Ga0070662_100297193 | Ga0070662_1002971932 | 147 |
| 284 | 3300005458 | Ga0070681_10885179 | Ga0070681_108851792 | 147 |
| 285 | 3300005459 | Ga0068867_100006287 | Ga0068867_1000062873 | 147 |
| 286 | 3300005459 | Ga0068867_100199654 | Ga0068867_1001996542 | 147 |
| 287 | 3300005466 | Ga0070685_10057771 | Ga0070685_100577713 | 147 |
| 288 | 3300005535 | Ga0070684_100272673 | Ga0070684_1002726732 | 147 |
| 289 | 3300005539 | Ga0068853_100051687 | Ga0068853_1000516875 | 147 |
| 290 | 3300005539 | Ga0068853_100064641 | Ga0068853_1000646413 | 147 |
| 291 | 3300005543 | Ga0070672_100188078 | Ga0070672_1001880783 | 147 |
| 292 | 3300005545 | Ga0070695_100040554 | Ga0070695_1000405544 | 147 |
| 293 | 3300005546 | Ga0070696_100003435 | Ga0070696_1000034357 | 147 |
| 294 | 3300005547 | Ga0070693_100032667 | Ga0070693_1000326675 | 147 |
| 295 | 3300005547 | Ga0070693_100122157 | Ga0070693_1001221572 | 147 |
| 296 | 3300005548 | Ga0070665_100005474 | Ga0070665_1000054748 | 147 |
| 297 | 3300005548 | Ga0070665_100006380 | Ga0070665_1000063807 | 147 |
| 298 | 3300005548 | Ga0070665_100259269 | Ga0070665_1002592693 | 147 |
| 299 | 3300005549 | Ga0070704_100000391 | Ga0070704_10000039115 | 147 |
| 300 | 3300005549 | Ga0070704_100036324 | Ga0070704_1000363244 | 147 |
| 301 | 3300005563 | Ga0068855_100113289 | Ga0068855_1001132893 | 147 |
| 302 | 3300005578 | Ga0068854_100004672 | Ga0068854_1000046728 | 147 |
| 303 | 3300005615 | Ga0070702_100001144 | Ga0070702_10000114410 | 147 |
| 304 | 3300005615 | Ga0070702_100073894 | Ga0070702_1000738941 | 147 |
| 305 | 3300005616 | Ga0068852_101437779 | Ga0068852_1014377791 | 147 |
| 306 | 3300005617 | Ga0068859_100000606 | Ga0068859_10000060617 | 147 |
| 307 | 3300005617 | Ga0068859_100003251 | Ga0068859_1000032517 | 147 |
| 308 | 3300005617 | Ga0068859_100571564 | Ga0068859_1005715642 | 147 |
| 309 | 3300005617 | Ga0068859_100859037 | Ga0068859_1008590372 | 147 |
| 310 | 3300005618 | Ga0068864_100622399 | Ga0068864_1006223992 | 147 |
| 311 | 3300005718 | Ga0068866_10002931 | Ga0068866_100029312 | 147 |
| 312 | 3300005718 | Ga0068866_10069786 | Ga0068866_100697863 | 147 |
| 313 | 3300005719 | Ga0068861_100120570 | Ga0068861_1001205702 | 147 |
| 314 | 3300005719 | Ga0068861_100374854 | Ga0068861_1003748541 | 147 |
| 315 | 3300005841 | Ga0068863_100465112 | Ga0068863_1004651122 | 147 |
| 316 | 3300005842 | Ga0068858_100001109 | Ga0068858_1000011097 | 147 |
| 317 | 3300005842 | Ga0068858_100073000 | Ga0068858_1000730003 | 147 |
| 318 | 3300005842 | Ga0068858_101752370 | Ga0068858_1017523701 | 147 |
| 319 | 3300005843 | Ga0068860_100000025 | Ga0068860_100000025152 | 147 |
| 320 | 3300005843 | Ga0068860_100012429 | Ga0068860_1000124299 | 147 |
| 321 | 3300005843 | Ga0068860_100801985 | Ga0068860_1008019852 | 147 |
| 322 | 3300005844 | Ga0068862_100000045 | Ga0068862_100000045152 | 147 |
| 323 | 3300005844 | Ga0068862_100001869 | Ga0068862_10000186912 | 147 |
| 324 | 3300005844 | Ga0068862_100186010 | Ga0068862_1001860103 | 147 |
| 325 | 3300005844 | Ga0068862_100290319 | Ga0068862_1002903192 | 147 |
| 326 | 3300005844 | Ga0068862_102535226 | Ga0068862_1025352261 | 147 |
| 327 | 3300005937 | Ga0081455_10039741 | Ga0081455_100397415 | 147 |
| 328 | 3300005937 | Ga0081455_10093207 | Ga0081455_100932073 | 147 |
| 329 | 3300005981 | Ga0081538_10043770 | Ga0081538_100437703 | 147 |
| 330 | 3300005981 | Ga0081538_10185021 | Ga0081538_101850212 | 147 |
| 331 | 3300005983 | Ga0081540_1119893 | Ga0081540_11198931 | 147 |
| 332 | 3300006038 | Ga0075365_10531100 | Ga0075365_105311002 | 147 |
| 333 | 3300006042 | Ga0075368_10392240 | Ga0075368_103922402 | 147 |
| 334 | 3300006048 | Ga0075363_100030212 | Ga0075363_1000302122 | 147 |
| 335 | 3300006048 | Ga0075363_100184374 | Ga0075363_1001843742 | 147 |
| 336 | 3300006051 | Ga0075364_10004468 | Ga0075364_100044683 | 147 |
| 337 | 3300006051 | Ga0075364_10005113 | Ga0075364_100051132 | 147 |
| 338 | 3300006051 | Ga0075364_10018231 | Ga0075364_100182316 | 147 |
| 339 | 3300006051 | Ga0075364_10240055 | Ga0075364_102400552 | 147 |
| 340 | 3300006051 | Ga0075364_10433492 | Ga0075364_104334921 | 147 |
| 341 | 3300006173 | Ga0070716_100001115 | Ga0070716_1000011157 | 147 |
| 342 | 3300006173 | Ga0070716_100013982 | Ga0070716_1000139823 | 147 |
| 343 | 3300006173 | Ga0070716_100047642 | Ga0070716_1000476424 | 147 |
| 344 | 3300006173 | Ga0070716_100575181 | Ga0070716_1005751812 | 147 |
| 345 | 3300006175 | Ga0070712_100003721 | Ga0070712_1000037212 | 147 |
| 346 | 3300006175 | Ga0070712_100040073 | Ga0070712_1000400732 | 147 |
| 347 | 3300006177 | Ga0075362_10008504 | Ga0075362_100085042 | 147 |
| 348 | 3300006177 | Ga0075362_10279148 | Ga0075362_102791481 | 147 |
| 349 | 3300006178 | Ga0075367_10360500 | Ga0075367_103605002 | 147 |
| 350 | 3300006186 | Ga0075369_10004473 | Ga0075369_100044734 | 147 |
| 351 | 3300006186 | Ga0075369_10013887 | Ga0075369_100138874 | 147 |
| 352 | 3300006186 | Ga0075369_10058110 | Ga0075369_100581102 | 147 |
| 353 | 3300006186 | Ga0075369_10112024 | Ga0075369_101120242 | 147 |
| 354 | 3300006186 | Ga0075369_10138554 | Ga0075369_101385543 | 147 |
| 355 | 3300006237 | Ga0097621_100190034 | Ga0097621_1001900342 | 147 |
| 356 | 3300006353 | Ga0075370_10002478 | Ga0075370_100024788 | 147 |
| 357 | 3300006353 | Ga0075370_10206688 | Ga0075370_102066882 | 147 |
| 358 | 3300006353 | Ga0075370_10443772 | Ga0075370_104437722 | 147 |
| 359 | 3300006358 | Ga0068871_100174587 | Ga0068871_1001745873 | 147 |
| 360 | 3300006358 | Ga0068871_100205001 | Ga0068871_1002050012 | 147 |
| 361 | 3300006844 | Ga0075428_100004846 | Ga0075428_1000048466 | 147 |
| 362 | 3300006846 | Ga0075430_100280293 | Ga0075430_1002802932 | 147 |
| 363 | 3300006847 | Ga0075431_100009857 | Ga0075431_1000098572 | 147 |
| 364 | 3300006880 | Ga0075429_100156557 | Ga0075429_1001565573 | 147 |
| 365 | 3300006881 | Ga0068865_100172714 | Ga0068865_1001727143 | 147 |
| 366 | 3300006931 | Ga0097620_100000606 | Ga0097620_10000060617 | 147 |
| 367 | 3300006931 | Ga0097620_100003251 | Ga0097620_1000032517 | 147 |
| 368 | 3300006931 | Ga0097620_100571680 | Ga0097620_1005716802 | 147 |
| 369 | 3300006931 | Ga0097620_100859134 | Ga0097620_1008591342 | 147 |
| 370 | 3300007788 | Ga0099795_10007788 | Ga0099795_100077882 | 147 |
| 371 | 3300009011 | Ga0105251_10180661 | Ga0105251_101806612 | 147 |
| 372 | 3300009036 | Ga0105244_10252061 | Ga0105244_102520612 | 147 |
| 373 | 3300009092 | Ga0105250_10056101 | Ga0105250_100561013 | 147 |
| 374 | 3300009093 | Ga0105240_12743192 | Ga0105240_127431921 | 147 |
| 375 | 3300009094 | Ga0111539_10498934 | Ga0111539_104989342 | 147 |
| 376 | 3300009094 | Ga0111539_11906128 | Ga0111539_119061282 | 147 |
| 377 | 3300009098 | Ga0105245_10002903 | Ga0105245_1000290315 | 147 |
| 378 | 3300009098 | Ga0105245_10692525 | Ga0105245_106925251 | 147 |
| 379 | 3300009098 | Ga0105245_11198151 | Ga0105245_111981512 | 147 |
| 380 | 3300009101 | Ga0105247_10000010 | Ga0105247_10000010182 | 147 |
| 381 | 3300009101 | Ga0105247_10000366 | Ga0105247_1000036632 | 147 |
| 382 | 3300009101 | Ga0105247_10825515 | Ga0105247_108255151 | 147 |
| 383 | 3300009147 | Ga0114129_10005689 | Ga0114129_1000568916 | 147 |
| 384 | 3300009147 | Ga0114129_10261011 | Ga0114129_102610112 | 147 |
| 385 | 3300009148 | Ga0105243_10001450 | Ga0105243_1000145014 | 147 |
| 386 | 3300009148 | Ga0105243_10060285 | Ga0105243_100602854 | 147 |
| 387 | 3300009174 | Ga0105241_10214778 | Ga0105241_102147781 | 147 |
| 388 | 3300009176 | Ga0105242_10004714 | Ga0105242_100047143 | 147 |
| 389 | 3300009176 | Ga0105242_10149393 | Ga0105242_101493933 | 147 |
| 390 | 3300009177 | Ga0105248_10000145 | Ga0105248_1000014550 | 147 |
| 391 | 3300009177 | Ga0105248_10002194 | Ga0105248_1000219412 | 147 |
| 392 | 3300009177 | Ga0105248_10772473 | Ga0105248_107724732 | 147 |
| 393 | 3300009545 | Ga0105237_10025835 | Ga0105237_100258356 | 147 |
| 394 | 3300009545 | Ga0105237_10513643 | Ga0105237_105136431 | 147 |
| 395 | 3300009551 | Ga0105238_10611824 | Ga0105238_106118242 | 147 |
| 396 | 3300009553 | Ga0105249_10000010 | Ga0105249_10000010177 | 147 |
| 397 | 3300009553 | Ga0105249_10007809 | Ga0105249_100078098 | 147 |
| 398 | 3300009553 | Ga0105249_10699719 | Ga0105249_106997192 | 147 |
| 399 | 3300010159 | Ga0099796_10009296 | Ga0099796_100092961 | 147 |
| 400 | 3300010375 | Ga0105239_10152069 | Ga0105239_101520693 | 147 |
| 401 | 3300010375 | Ga0105239_11238379 | Ga0105239_112383792 | 147 |
| 402 | 3300013105 | Ga0157369_10253713 | Ga0157369_102537132 | 147 |
| 403 | 3300013297 | Ga0157378_10001442 | Ga0157378_1000144211 | 147 |
| 404 | 3300013306 | Ga0163162_10002768 | Ga0163162_100027689 | 147 |
| 405 | 3300013306 | Ga0163162_10078462 | Ga0163162_100784624 | 147 |
| 406 | 3300013306 | Ga0163162_10121125 | Ga0163162_101211251 | 147 |
| 407 | 3300013306 | Ga0163162_12288308 | Ga0163162_122883081 | 147 |
| 408 | 3300013307 | Ga0157372_10009077 | Ga0157372_100090777 | 147 |
| 409 | 3300013308 | Ga0157375_10001272 | Ga0157375_1000127215 | 147 |
| 410 | 3300014325 | Ga0163163_10010065 | Ga0163163_100100658 | 147 |
| 411 | 3300014325 | Ga0163163_11008132 | Ga0163163_110081322 | 147 |
| 412 | 3300014326 | Ga0157380_10000302 | Ga0157380_1000030222 | 147 |
| 413 | 3300014969 | Ga0157376_11953511 | Ga0157376_119535111 | 147 |
| 414 | 3300017792 | Ga0163161_10000799 | Ga0163161_1000079912 | 147 |
| 415 | 3300017792 | Ga0163161_10294140 | Ga0163161_102941402 | 147 |
| 416 | 3300021384 | Ga0213876_10003078 | Ga0213876_100030782 | 147 |
| 417 | 3300021384 | Ga0213876_10129432 | Ga0213876_101294322 | 147 |
| 418 | 3300021384 | Ga0213876_10156916 | Ga0213876_101569162 | 147 |
| 419 | 3300021388 | Ga0213875_10041041 | Ga0213875_100410413 | 147 |
| 420 | 3300021441 | Ga0213871_10118423 | Ga0213871_101184232 | 147 |
| 421 | 3300025711 | Ga0207696_1061230 | Ga0207696_10612302 | 147 |
| 422 | 3300025893 | Ga0207682_10044059 | Ga0207682_100440592 | 147 |
| 423 | 3300025898 | Ga0207692_10030153 | Ga0207692_100301532 | 147 |
| 424 | 3300025899 | Ga0207642_10000143 | Ga0207642_1000014314 | 147 |
| 425 | 3300025899 | Ga0207642_10011054 | Ga0207642_100110544 | 147 |
| 426 | 3300025900 | Ga0207710_10000028 | Ga0207710_10000028184 | 147 |
| 427 | 3300025900 | Ga0207710_10001961 | Ga0207710_100019619 | 147 |
| 428 | 3300025901 | Ga0207688_10000090 | Ga0207688_1000009028 | 147 |
| 429 | 3300025903 | Ga0207680_10027001 | Ga0207680_100270014 | 147 |
| 430 | 3300025904 | Ga0207647_10069287 | Ga0207647_100692874 | 147 |
| 431 | 3300025905 | Ga0207685_10005331 | Ga0207685_100053313 | 147 |
| 432 | 3300025905 | Ga0207685_10103693 | Ga0207685_101036932 | 147 |
| 433 | 3300025906 | Ga0207699_10012071 | Ga0207699_100120714 | 147 |
| 434 | 3300025906 | Ga0207699_10563510 | Ga0207699_105635102 | 147 |
| 435 | 3300025907 | Ga0207645_10027091 | Ga0207645_100270912 | 147 |
| 436 | 3300025912 | Ga0207707_10762461 | Ga0207707_107624612 | 147 |
| 437 | 3300025915 | Ga0207693_10000555 | Ga0207693_100005557 | 147 |
| 438 | 3300025915 | Ga0207693_10002064 | Ga0207693_100020648 | 147 |
| 439 | 3300025916 | Ga0207663_10002170 | Ga0207663_100021709 | 147 |
| 440 | 3300025916 | Ga0207663_10016673 | Ga0207663_100166734 | 147 |
| 441 | 3300025918 | Ga0207662_10354014 | Ga0207662_103540142 | 147 |
| 442 | 3300025923 | Ga0207681_10006072 | Ga0207681_100060726 | 147 |
| 443 | 3300025923 | Ga0207681_10202684 | Ga0207681_102026843 | 147 |
| 444 | 3300025924 | Ga0207694_10459613 | Ga0207694_104596132 | 147 |
| 445 | 3300025925 | Ga0207650_10539242 | Ga0207650_105392422 | 147 |
| 446 | 3300025926 | Ga0207659_10849746 | Ga0207659_108497462 | 147 |
| 447 | 3300025927 | Ga0207687_10158624 | Ga0207687_101586242 | 147 |
| 448 | 3300025927 | Ga0207687_10640379 | Ga0207687_106403791 | 147 |
| 449 | 3300025928 | Ga0207700_10485984 | Ga0207700_104859842 | 147 |
| 450 | 3300025928 | Ga0207700_10909935 | Ga0207700_109099352 | 147 |
| 451 | 3300025929 | Ga0207664_10297450 | Ga0207664_102974503 | 147 |
| 452 | 3300025931 | Ga0207644_10100117 | Ga0207644_101001173 | 147 |
| 453 | 3300025931 | Ga0207644_10117672 | Ga0207644_101176723 | 147 |
| 454 | 3300025932 | Ga0207690_10032665 | Ga0207690_100326655 | 147 |
| 455 | 3300025933 | Ga0207706_10005251 | Ga0207706_100052517 | 147 |
| 456 | 3300025933 | Ga0207706_10016540 | Ga0207706_100165405 | 147 |
| 457 | 3300025934 | Ga0207686_10001099 | Ga0207686_100010999 | 147 |
| 458 | 3300025934 | Ga0207686_10006362 | Ga0207686_100063627 | 147 |
| 459 | 3300025935 | Ga0207709_10002258 | Ga0207709_100022589 | 147 |
| 460 | 3300025935 | Ga0207709_10700053 | Ga0207709_107000532 | 147 |
| 461 | 3300025936 | Ga0207670_10029755 | Ga0207670_100297553 | 147 |
| 462 | 3300025937 | Ga0207669_10000752 | Ga0207669_1000075210 | 147 |
| 463 | 3300025938 | Ga0207704_10000393 | Ga0207704_100003936 | 147 |
| 464 | 3300025938 | Ga0207704_10142440 | Ga0207704_101424401 | 147 |
| 465 | 3300025939 | Ga0207665_10001801 | Ga0207665_1000180110 | 147 |
| 466 | 3300025939 | Ga0207665_10003000 | Ga0207665_100030007 | 147 |
| 467 | 3300025939 | Ga0207665_10085661 | Ga0207665_100856612 | 147 |
| 468 | 3300025939 | Ga0207665_10142723 | Ga0207665_101427232 | 147 |
| 469 | 3300025940 | Ga0207691_10093942 | Ga0207691_100939425 | 147 |
| 470 | 3300025940 | Ga0207691_10309885 | Ga0207691_103098852 | 147 |
| 471 | 3300025941 | Ga0207711_10000069 | Ga0207711_1000006922 | 147 |
| 472 | 3300025941 | Ga0207711_10019795 | Ga0207711_100197952 | 147 |
| 473 | 3300025942 | Ga0207689_10022958 | Ga0207689_100229582 | 147 |
| 474 | 3300025944 | Ga0207661_10096794 | Ga0207661_100967944 | 147 |
| 475 | 3300025949 | Ga0207667_10380315 | Ga0207667_103803152 | 147 |
| 476 | 3300025961 | Ga0207712_10000016 | Ga0207712_10000016178 | 147 |
| 477 | 3300025961 | Ga0207712_10046835 | Ga0207712_100468355 | 147 |
| 478 | 3300025972 | Ga0207668_10005693 | Ga0207668_100056934 | 147 |
| 479 | 3300025972 | Ga0207668_10178951 | Ga0207668_101789512 | 147 |
| 480 | 3300025972 | Ga0207668_10276815 | Ga0207668_102768153 | 147 |
| 481 | 3300025986 | Ga0207658_10000237 | Ga0207658_1000023719 | 147 |
| 482 | 3300025986 | Ga0207658_10002082 | Ga0207658_1000208210 | 147 |
| 483 | 3300025986 | Ga0207658_10024434 | Ga0207658_100244347 | 147 |
| 484 | 3300026023 | Ga0207677_10003455 | Ga0207677_100034553 | 147 |
| 485 | 3300026023 | Ga0207677_10105422 | Ga0207677_101054224 | 147 |
| 486 | 3300026035 | Ga0207703_10011384 | Ga0207703_100113842 | 147 |
| 487 | 3300026035 | Ga0207703_10044415 | Ga0207703_100444153 | 147 |
| 488 | 3300026035 | Ga0207703_11766733 | Ga0207703_117667332 | 147 |
| 489 | 3300026041 | Ga0207639_10003107 | Ga0207639_100031075 | 147 |
| 490 | 3300026067 | Ga0207678_10011227 | Ga0207678_100112276 | 147 |
| 491 | 3300026067 | Ga0207678_10013849 | Ga0207678_100138493 | 147 |
| 492 | 3300026075 | Ga0207708_10006978 | Ga0207708_100069788 | 147 |
| 493 | 3300026078 | Ga0207702_10724634 | Ga0207702_107246342 | 147 |
| 494 | 3300026088 | Ga0207641_10025646 | Ga0207641_100256462 | 147 |
| 495 | 3300026089 | Ga0207648_10000349 | Ga0207648_1000034925 | 147 |
| 496 | 3300026089 | Ga0207648_10027211 | Ga0207648_100272116 | 147 |
| 497 | 3300026095 | Ga0207676_10094326 | Ga0207676_100943263 | 147 |
| 498 | 3300026118 | Ga0207675_100006409 | Ga0207675_10000640910 | 147 |
| 499 | 3300026121 | Ga0207683_10000040 | Ga0207683_1000004056 | 147 |
| 500 | 3300026121 | Ga0207683_11097728 | Ga0207683_110977281 | 147 |
| 501 | 3300026142 | Ga0207698_12171651 | Ga0207698_121716511 | 147 |
| 502 | 3300028379 | Ga0268266_10002967 | Ga0268266_100029672 | 147 |
| 503 | 3300028379 | Ga0268266_10005675 | Ga0268266_100056757 | 147 |
| 504 | 3300028379 | Ga0268266_10036703 | Ga0268266_100367035 | 147 |
| 505 | 3300028379 | Ga0268266_10681904 | Ga0268266_106819041 | 147 |
| 506 | 3300028380 | Ga0268265_10000056 | Ga0268265_10000056146 | 147 |
| 507 | 3300028380 | Ga0268265_10005589 | Ga0268265_100055895 | 147 |
| 508 | 3300028380 | Ga0268265_10154149 | Ga0268265_101541492 | 147 |
| 509 | 3300028380 | Ga0268265_10353054 | Ga0268265_103530542 | 147 |
| 510 | 3300028381 | Ga0268264_10000053 | Ga0268264_10000053176 | 147 |
| 511 | 3300028381 | Ga0268264_10208375 | Ga0268264_102083752 | 147 |
| 512 | 3300028381 | Ga0268264_10225825 | Ga0268264_102258252 | 147 |
| 513 | 3300031852 | Ga0307410_10958689 | Ga0307410_109586892 | 147 |
| 514 | 3300031995 | Ga0307409_101011214 | Ga0307409_1010112141 | 147 |
| 515 | 3300032002 | Ga0307416_102929544 | Ga0307416_1029295441 | 147 |
| 516 | 3300034819 | Ga0373958_0005189 | Ga0373958_0005189_1159_1602 | 147 |
| 517 | 3300034957 | Ga0373938_0163331 | Ga0373938_0163331_21_464 | 147 |
| 518 | 3300035090 | Ga0373949_0029246 | Ga0373949_0029246_220_663 | 147 |
| 519 | 3300035090 | Ga0373949_0242939 | Ga0373949_0242939_86_529 | 147 |
| 520 | 3300035112 | Ga0373932_0317409 | Ga0373932_0317409_38_481 | 147 |
| 521 | 3300035114 | Ga0373939_0022264 | Ga0373939_0022264_269_712 | 147 |
| 522 | 3300035115 | Ga0373941_0182084 | Ga0373941_0182084_97_540 | 147 |
| 523 | 3300035207 | Ga0373942_0082233 | Ga0373942_0082233_424_867 | 147 |
| 524 | 3300035691 | Ga0373931_0045619 | Ga0373931_0045619_128_571 | 147 |
| 525 | 3300035691 | Ga0373931_0093273 | Ga0373931_0093273_1081_1524 | 147 |
| 526 | 3300037418 | Ga0395900_0016131 | Ga0395900_0016131_350_796 | 147 |
| 527 | 3300037418 | Ga0395900_0073852 | Ga0395900_0073852_2628_3071 | 147 |
| 528 | 3300037466 | Ga0395898_0203199 | Ga0395898_0203199_1092_1538 | 147 |
| 529 | 3300037853 | Ga0436364_0171371 | Ga0436364_0171371_676_1119 | 147 |
| 530 | 3300037853 | Ga0436364_0329205 | Ga0436364_0329205_1407_1850 | 147 |
| 531 | 3300037853 | Ga0436364_0604589 | Ga0436364_0604589_5402_5845 | 147 |
| 532 | 3300037853 | Ga0436364_0928958 | Ga0436364_0928958_566_1009 | 147 |
| 533 | 3300039437 | Ga0436365_0329583 | Ga0436365_0329583_33098_33541 | 147 |
| 534 | 3300039437 | Ga0436365_0465547 | Ga0436365_0465547_1082_1525 | 147 |
| 535 | 3300039437 | Ga0436365_1490253 | Ga0436365_1490253_2051_2494 | 147 |
| 536 | 3300039438 | Ga0436360_0763556 | Ga0436360_0763556_367_810 | 147 |
| 537 | 3300039450 | Ga0436363_0002351 | Ga0436363_0002351_13_456 | 147 |
| 538 | 3300039450 | Ga0436363_1381948 | Ga0436363_1381948_452_895 | 147 |
| 539 | 3300041411 | Ga0439466_0005991 | Ga0439466_0005991_876_1319 | 147 |
| 540 | 3300041411 | Ga0439466_0007929 | Ga0439466_0007929_913_1356 | 147 |
| 541 | 3300041413 | Ga0439465_0000439 | Ga0439465_0000439_7786_8229 | 147 |
| 542 | 3300041413 | Ga0439465_0004076 | Ga0439465_0004076_1531_1974 | 147 |
| 543 | 3300041413 | Ga0439465_0030810 | Ga0439465_0030810_541_984 | 147 |
| 544 | 3300041507 | Ga0451851_0694353 | Ga0451851_0694353_33_476 | 147 |
| 545 | 3300041512 | Ga0451853_3770463 | Ga0451853_3770463_75_518 | 147 |
| 546 | 3300041997 | Ga0439431_0001548 | Ga0439431_0001548_2147_2590 | 147 |
| 547 | 3300042002 | Ga0439442_007871 | Ga0439442_007871_276_719 | 147 |
| 548 | 3300042435 | Ga0439434_0134917 | Ga0439434_0134917_17_460 | 147 |
| 549 | 3300042436 | Ga0439435_0059908 | Ga0439435_0059908_205_648 | 147 |
| 550 | 3300044658 | Ga0466972_0252989 | Ga0466972_0252989_205_648 | 147 |
| 551 | 3300044683 | Ga0466965_0034243 | Ga0466965_0034243_592_1035 | 147 |
| 552 | 3300044684 | Ga0466966_0276626 | Ga0466966_0276626_345_788 | 147 |
| 553 | 3300044693 | Ga0466961_0094341 | Ga0466961_0094341_868_1311 | 147 |
| 554 | 3300044693 | Ga0466961_0296851 | Ga0466961_0296851_333_776 | 147 |
| 555 | 3300044694 | Ga0466963_0033323 | Ga0466963_0033323_96_539 | 147 |
| 556 | 3300044694 | Ga0466963_0090128 | Ga0466963_0090128_913_1356 | 147 |
| 557 | 3300044694 | Ga0466963_0233391 | Ga0466963_0233391_466_942 | 147 |
| 558 | 3300044706 | Ga0466964_0140355 | Ga0466964_0140355_595_1038 | 147 |
| 559 | 3300044719 | Ga0466971_0026763 | Ga0466971_0026763_982_1425 | 147 |
| 560 | 3300044719 | Ga0466971_0032310 | Ga0466971_0032310_1018_1461 | 147 |
| 561 | 3300044719 | Ga0466971_0058338 | Ga0466971_0058338_955_1398 | 147 |
| 562 | 3300044735 | Ga0466968_0008896 | Ga0466968_0008896_1383_1826 | 147 |
| 563 | 3300044765 | Ga0466970_0078052 | Ga0466970_0078052_1181_1624 | 147 |
| 564 | 3300044765 | Ga0466970_0423686 | Ga0466970_0423686_223_666 | 147 |
| 565 | 3300044765 | Ga0466970_0437885 | Ga0466970_0437885_180_635 | 147 |
| 566 | 3300044765 | Ga0466970_0547205 | Ga0466970_0547205_117_560 | 147 |
| 567 | 3300044842 | Ga0466957_0049815 | Ga0466957_0049815_616_1059 | 147 |
| 568 | 3300044842 | Ga0466957_0236789 | Ga0466957_0236789_120_563 | 147 |
| 569 | 3300044901 | Ga0466960_0011745 | Ga0466960_0011745_3097_3540 | 147 |
| 570 | 3300044901 | Ga0466960_0061867 | Ga0466960_0061867_346_789 | 147 |
| 571 | 3300045049 | Ga0466959_0026324 | Ga0466959_0026324_3445_3888 | 147 |
| 572 | 3300045049 | Ga0466959_0072859 | Ga0466959_0072859_1796_2239 | 147 |
| 573 | 3300045049 | Ga0466959_0292387 | Ga0466959_0292387_565_1020 | 147 |
| 574 | 3300045836 | Ga0466958_0154332 | Ga0466958_0154332_219_740 | 147 |
| 575 | 3300045836 | Ga0466958_0260122 | Ga0466958_0260122_426_869 | 147 |
| 576 | 3300045836 | Ga0466958_0293888 | Ga0466958_0293888_559_1002 | 147 |
| 577 | 3300045976 | Ga0466967_0003093 | Ga0466967_0003093_1734_2177 | 147 |
| 578 | 3300045976 | Ga0466967_0023877 | Ga0466967_0023877_1438_1881 | 147 |
| 579 | 3300045976 | Ga0466967_0301207 | Ga0466967_0301207_749_1192 | 147 |
| 580 | 3300045976 | Ga0466967_0600668 | Ga0466967_0600668_611_1054 | 147 |
| 581 | 3300045976 | Ga0466967_0951721 | Ga0466967_0951721_102_545 | 147 |
| 582 | 3300045976 | Ga0466967_1045977 | Ga0466967_1045977_148_591 | 147 |
| 583 | 3300045976 | Ga0466967_1073442 | Ga0466967_1073442_28_471 | 147 |
| 584 | 3300045976 | Ga0466967_1432110 | Ga0466967_1432110_149_592 | 147 |
| 585 | 3300045976 | Ga0466967_1486107 | Ga0466967_1486107_49_504 | 147 |
| 586 | 3300045976 | Ga0466967_2186334 | Ga0466967_2186334_95_538 | 147 |
| 587 | 3300046694 | Ga0495649_0154879 | Ga0495649_0154879_543_986 | 147 |
| 588 | 3300047320 | Ga0495672_0030035 | Ga0495672_0030035_387_830 | 147 |
| 589 | 3300047320 | Ga0495672_0223884 | Ga0495672_0223884_462_905 | 147 |
| 590 | 3300048903 | Ga0496100_0005195 | Ga0496100_0005195_2004_2447 | 147 |
| 591 | 3300048903 | Ga0496100_0142140 | Ga0496100_0142140_1011_1454 | 147 |
| 592 | 3300048903 | Ga0496100_0403034 | Ga0496100_0403034_523_966 | 147 |
| 593 | 3300048904 | Ga0496101_0002316 | Ga0496101_0002316_4530_4973 | 147 |
| 594 | 3300048904 | Ga0496101_0060971 | Ga0496101_0060971_357_800 | 147 |
| 595 | 3300048904 | Ga0496101_0132603 | Ga0496101_0132603_399_842 | 147 |
| 596 | 3300048904 | Ga0496101_0157742 | Ga0496101_0157742_791_1234 | 147 |
| 597 | 3300048905 | Ga0496102_0000070 | Ga0496102_0000070_80654_81097 | 147 |
| 598 | 3300048905 | Ga0496102_0000600 | Ga0496102_0000600_5434_5877 | 147 |
| 599 | 3300048905 | Ga0496102_0004697 | Ga0496102_0004697_5865_6308 | 147 |
| 600 | 3300048905 | Ga0496102_0008806 | Ga0496102_0008806_2731_3174 | 147 |
| 601 | 3300048905 | Ga0496102_0023709 | Ga0496102_0023709_338_781 | 147 |
| 602 | 3300048905 | Ga0496102_0076178 | Ga0496102_0076178_2456_2899 | 147 |
| 603 | 3300048905 | Ga0496102_0146132 | Ga0496102_0146132_891_1334 | 147 |
| 604 | 3300048905 | Ga0496102_0152737 | Ga0496102_0152737_445_888 | 147 |
| 605 | 3300048905 | Ga0496102_0409613 | Ga0496102_0409613_509_952 | 147 |
| 606 | 3300048906 | Ga0496103_0000477 | Ga0496103_0000477_22088_22531 | 147 |
| 607 | 3300048906 | Ga0496103_0000667 | Ga0496103_0000667_12384_12827 | 147 |
| 608 | 3300048906 | Ga0496103_0023011 | Ga0496103_0023011_880_1323 | 147 |
| 609 | 3300048907 | Ga0496104_0078845 | Ga0496104_0078845_1353_1796 | 147 |
| 610 | 3300048907 | Ga0496104_0358326 | Ga0496104_0358326_626_1069 | 147 |
| 611 | 3300048907 | Ga0496104_0777574 | Ga0496104_0777574_73_516 | 147 |
| 612 | 3300048908 | Ga0496105_0049701 | Ga0496105_0049701_212_655 | 147 |
| 613 | 3300048908 | Ga0496105_0696440 | Ga0496105_0696440_229_672 | 147 |
| 614 | 3300048909 | Ga0496106_0010257 | Ga0496106_0010257_6075_6518 | 147 |
| 615 | 3300048909 | Ga0496106_0130136 | Ga0496106_0130136_1030_1473 | 147 |
| 616 | 3300048909 | Ga0496106_0153804 | Ga0496106_0153804_173_616 | 147 |
| 617 | 3300048910 | Ga0496107_0002661 | Ga0496107_0002661_3125_3568 | 147 |
| 618 | 3300048910 | Ga0496107_0028337 | Ga0496107_0028337_404_847 | 147 |
| 619 | 3300048910 | Ga0496107_0047928 | Ga0496107_0047928_1956_2399 | 147 |
| 620 | 3300048910 | Ga0496107_0260312 | Ga0496107_0260312_136_579 | 147 |
| 621 | 3300048911 | Ga0496108_0353081 | Ga0496108_0353081_654_1097 | 147 |
| 622 | 3300048911 | Ga0496108_0518759 | Ga0496108_0518759_320_763 | 147 |
| 623 | 3300048912 | Ga0496109_0019118 | Ga0496109_0019118_5516_5959 | 147 |
| 624 | 3300048912 | Ga0496109_0233339 | Ga0496109_0233339_1105_1548 | 147 |
| 625 | 3300048912 | Ga0496109_1475156 | Ga0496109_1475156_51_494 | 147 |
| 626 | 3300048913 | Ga0496110_0130988 | Ga0496110_0130988_140_583 | 147 |
| 627 | 3300048915 | Ga0496112_0104600 | Ga0496112_0104600_327_770 | 147 |
| 628 | 3300048915 | Ga0496112_0262360 | Ga0496112_0262360_651_1094 | 147 |
| 629 | 3300048915 | Ga0496112_0564314 | Ga0496112_0564314_532_975 | 147 |
| 630 | 3300048916 | Ga0496113_0255357 | Ga0496113_0255357_526_969 | 147 |
| 631 | 3300048917 | Ga0496114_0001610 | Ga0496114_0001610_1512_1955 | 147 |
| 632 | 3300048919 | Ga0496116_0023877 | Ga0496116_0023877_558_1001 | 147 |
| 633 | 3300048920 | Ga0496117_0001117 | Ga0496117_0001117_18020_18463 | 147 |
| 634 | 3300048920 | Ga0496117_0097902 | Ga0496117_0097902_474_917 | 147 |
| 635 | 3300048921 | Ga0496118_0000272 | Ga0496118_0000272_57778_58221 | 147 |
| 636 | 3300048921 | Ga0496118_0004850 | Ga0496118_0004850_11423_11866 | 147 |
| 637 | 3300048922 | Ga0496119_0016323 | Ga0496119_0016323_875_1318 | 147 |
| 638 | 3300048923 | Ga0496120_0015370 | Ga0496120_0015370_1149_1592 | 147 |
| 639 | 3300048924 | Ga0496121_0002543 | Ga0496121_0002543_23258_23701 | 147 |
| 640 | 3300048927 | Ga0496124_0402552 | Ga0496124_0402552_349_792 | 147 |
| 641 | 3300048928 | Ga0496125_0010205 | Ga0496125_0010205_6242_6685 | 147 |
| 642 | 3300048929 | Ga0496126_0035353 | Ga0496126_0035353_2115_2558 | 147 |
| 643 | 3300048929 | Ga0496126_0158219 | Ga0496126_0158219_1387_1839 | 147 |
| 644 | 3300049568 | Ga0501031_0137044 | Ga0501031_0137044_1107_1550 | 147 |
| 645 | 3300049569 | Ga0501032_0009488 | Ga0501032_0009488_2954_3397 | 147 |
| 646 | 3300049570 | Ga0501033_0005242 | Ga0501033_0005242_4634_5077 | 147 |
| 647 | 3300049571 | Ga0501034_0015666 | Ga0501034_0015666_6244_6687 | 147 |
| 648 | 3300049571 | Ga0501034_0285927 | Ga0501034_0285927_240_683 | 147 |
| 649 | 3300049571 | Ga0501034_0457086 | Ga0501034_0457086_59_547 | 147 |
| 650 | 3300049571 | Ga0501034_1350627 | Ga0501034_1350627_105_548 | 147 |
| 651 | 3300049573 | Ga0501037_0011193 | Ga0501037_0011193_5864_6307 | 147 |
| 652 | 3300049579 | Ga0501043_0061911 | Ga0501043_0061911_76_519 | 147 |
| 653 | 3300049580 | Ga0501046_0011358 | Ga0501046_0011358_4707_5150 | 147 |
| 654 | 3300049581 | Ga0501047_0002023 | Ga0501047_0002023_16767_17210 | 147 |
| 655 | 3300049581 | Ga0501047_0395108 | Ga0501047_0395108_243_686 | 147 |
| 656 | 3300049582 | Ga0501048_0019214 | Ga0501048_0019214_1673_2116 | 147 |
| 657 | 3300049585 | Ga0501069_0042281 | Ga0501069_0042281_1974_2417 | 147 |
| 658 | 3300049586 | Ga0501070_0006875 | Ga0501070_0006875_3052_3495 | 147 |
| 659 | 3300049586 | Ga0501070_1180289 | Ga0501070_1180289_63_506 | 147 |
| 660 | 3300049589 | Ga0501073_0506825 | Ga0501073_0506825_197_640 | 147 |
| 661 | 3300049742 | Ga0501080_0018162 | Ga0501080_0018162_3772_4215 | 147 |
| 662 | 3300049744 | Ga0501083_0036359 | Ga0501083_0036359_1824_2267 | 147 |
| 663 | 3300049822 | Ga0501035_0002184 | Ga0501035_0002184_13048_13491 | 147 |
| 664 | 3300049823 | Ga0501044_0002158 | Ga0501044_0002158_16759_17202 | 147 |
| 665 | 3300049823 | Ga0501044_0253972 | Ga0501044_0253972_651_1094 | 147 |
| 666 | 3300049823 | Ga0501044_0827104 | Ga0501044_0827104_86_529 | 147 |
| 667 | 3300050489 | nmdc:mga03683_439054_c1 | nmdc:mga03683_439054_c1_174_617 | 147 |
| 668 | 3300050489 | nmdc:mga03683_6343_c1 | nmdc:mga03683_6343_c1_78_521 | 147 |
| 669 | 3300050489 | nmdc:mga03683_72136_c1 | nmdc:mga03683_72136_c1_83_526 | 147 |
| 670 | 3300050490 | nmdc:mga03n38_68444_c1 | nmdc:mga03n38_68444_c1_838_1281 | 147 |
| 671 | 3300050490 | nmdc:mga03n38_767172_c1 | nmdc:mga03n38_767172_c1_78_521 | 147 |
| 672 | 3300050490 | nmdc:mga03n38_78819_c1 | nmdc:mga03n38_78819_c1_54_497 | 147 |
| 673 | 3300050491 | nmdc:mga00v17_254310_c1 | nmdc:mga00v17_254310_c1_406_849 | 147 |
| 674 | 3300050491 | nmdc:mga00v17_81190_c1 | nmdc:mga00v17_81190_c1_335_778 | 147 |
| 675 | 3300050491 | nmdc:mga00v17_97515_c1 | nmdc:mga00v17_97515_c1_344_787 | 147 |
| 676 | 3300050492 | nmdc:mga0yw44_467099_c1 | nmdc:mga0yw44_467099_c1_89_532 | 147 |
| 677 | 3300050492 | nmdc:mga0yw44_51090_c1 | nmdc:mga0yw44_51090_c1_427_870 | 147 |
| 678 | 3300050494 | nmdc:mga06z11_806305_c1 | nmdc:mga06z11_806305_c1_99_542 | 147 |
| 679 | 3300050494 | nmdc:mga06z11_830948_c1 | nmdc:mga06z11_830948_c1_34_477 | 147 |
| 680 | 3300050496 | nmdc:mga07m45_329260_c1 | nmdc:mga07m45_329260_c1_151_594 | 147 |
| 681 | 3300050508 | nmdc:mga09592_569056_c1 | nmdc:mga09592_569056_c1_497_940 | 147 |
| 682 | 3300050509 | nmdc:mga0qj67_141345_c2 | nmdc:mga0qj67_141345_c2_611_1054 | 147 |
| 683 | 3300050509 | nmdc:mga0qj67_28056_c1 | nmdc:mga0qj67_28056_c1_2860_3303 | 147 |
| 684 | 3300050510 | nmdc:mga06r32_5670_c1 | nmdc:mga06r32_5670_c1_3668_4111 | 147 |
| 685 | 3300050511 | nmdc:mga08y16_388379_c1 | nmdc:mga08y16_388379_c1_685_1128 | 147 |
| 686 | 3300050516 | nmdc:mga0sz30_165695_c1 | nmdc:mga0sz30_165695_c1_188_631 | 147 |
| 687 | 3300050516 | nmdc:mga0sz30_1896_c2 | nmdc:mga0sz30_1896_c2_3343_3786 | 147 |
| 688 | 3300050516 | nmdc:mga0sz30_6965_c1 | nmdc:mga0sz30_6965_c1_2697_3140 | 147 |
| 689 | 3300050516 | nmdc:mga0sz30_97397_c1 | nmdc:mga0sz30_97397_c1_584_1027 | 147 |
| 690 | 3300053080 | Ga0500635_0045829 | Ga0500635_0045829_917_1360 | 147 |
| 691 | 3300053086 | Ga0500578_0659327 | Ga0500578_0659327_63_506 | 147 |
| 692 | 3300061719 | Ga0466962_0032975 | Ga0466962_0032975_1848_2291 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1eje-assembly1.cif.gz_A-2 | crystal structure of an fmn-binding protein | 0.7776 | 16 | 71 |
| 1wv4-assembly1.cif.gz_A | x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form | 0.7743 | 16 | 88 |
| 2aq6-assembly1.cif.gz_B | x-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution | 0.7541 | 3 | 145 |
| 2re7-assembly1.cif.gz_A-2 | crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution | 0.7435 | 1 | 145 |
| 2i02-assembly1.cif.gz_A | crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution | 0.7432 | 13 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O07754_2_147_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9925 | 2 | 147 | 2.30.110.10 |
| af_O07754_2_147_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9858 | 2 | 147 | 2.30.110.10 |
| 1ejeA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7776 | 16 | 71 | 2.30.110.10 |
| 2iabB01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.751 | 12 | 145 | 2.30.110.10 |
| 2asfA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7376 | 5 | 147 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1X1AUJ9-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase | 0.9926 | 3 | 146 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A1B1KHP5-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein | 0.985 | 1 | 147 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A7I7LGM3-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein | 0.9762 | 1 | 93 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A1B1KHP5-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein | 0.9719 | 1 | 147 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A7I7LGM3-F1-model_v4 | Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein | 0.9661 | 1 | 93 |
GO:0005829
GO:0016627 GO:0070967 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar