F475575

General Info

Members Datasets Scaffolds Average Seq Length
692 343 684 147

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10825515|Ga0105247_108255151
Length 175
Sequence VAGSGAFAAHQNGVIVLNAIPYEPGGTPMTTLNDAVALAADDNGLAVVSTLRADGTIQASLVNAGAMTHPATGQQVLAFVTYGKVKLGNLRVRPQLAATFRRGWMWATVEGRAELAGPDDRQPWLTDADQLRLLLREVFTAAGGTHDNWDEYDRVMAEQRRTVVLVAPTRVYSNG

Samples

Sample ID Description Type Environment
1 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
2 2619618881 Frankia sp. ACN1ag Isolate Unclassified
3 2619619003 Frankia sp. CpI1-P Isolate Nodule
4 2626541554 Frankia sp. AvcI.1 Isolate Nodule
5 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
190 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
202 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
219 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
220 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
221 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
224 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
314 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
330 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
331 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
332 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
333 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
334 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
335 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
338 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
341 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
342 8054920844 Frankia tisae Agncl-8 Isolate Nodule
343 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0
Isolates 1.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.95
Nodule 0.72
Rhizoplane 11.71
Rhizosphere 73.55
Stem 0
Stem Tuber 0
Unclassified 6.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10140460 3300002067 Bacteria 697
2 JGI24750J21931_1032422 3300002070 Bacteria 771
3 JGI24738J21930_10012597 3300002075 Bacteria 1845
4 JGI24749J21850_1030398 3300002076 Bacteria 775
5 JGI24744J21845_10000053 3300002077 Bacteria 13445
6 JGI24744J21845_10006220 3300002077 Bacteria 2479
7 JGI24034J26672_10003514 3300002239 Bacteria 2187
8 JGI24742J22300_10001182 3300002244 Bacteria 4071
9 JGI24751J29686_10061108 3300002459 Bacteria 776
10 rootL2_10132418 3300003322 Bacteria 1354
11 Ga0070658_11138118 3300005327 Bacteria 679
12 Ga0070676_10222942 3300005328 Bacteria 1246
13 Ga0070683_102131417 3300005329 Unclassified 538
14 Ga0070690_100001292 3300005330 Bacteria 13002
15 Ga0068869_100012633 3300005334 Bacteria 5586
16 Ga0070666_10306095 3300005335 Bacteria 1132
17 Ga0070680_100651411 3300005336 Bacteria 905
18 Ga0070682_100001916 3300005337 Bacteria 11610
19 Ga0070682_100199624 3300005337 Bacteria 1410
20 Ga0070682_101893979 3300005337 Bacteria 522
21 Ga0068868_100009639 3300005338 Bacteria 6966
22 Ga0068868_100101718 3300005338 Bacteria 2326
23 Ga0068868_101280560 3300005338 Bacteria 680
24 Ga0070689_100018207 3300005340 Bacteria 5171
25 Ga0070691_10001466 3300005341 Bacteria 10121
26 Ga0070687_100889533 3300005343 Bacteria 638
27 Ga0070668_100000358 3300005347 Bacteria 30164
28 Ga0070668_100003461 3300005347 Bacteria 11653
29 Ga0070668_100364680 3300005347 Bacteria 1226
30 Ga0070668_101893035 3300005347 Bacteria 549
31 Ga0070669_100001662 3300005353 Bacteria 16093
32 Ga0070669_100008249 3300005353 Bacteria 7439
33 Ga0070669_100168239 3300005353 Bacteria 1707
34 Ga0070674_100003807 3300005356 Bacteria 8528
35 Ga0070674_100995792 3300005356 Bacteria 735
36 Ga0070673_100311897 3300005364 Bacteria 1388
37 Ga0070688_100002128 3300005365 Bacteria 9979
38 Ga0070688_100027921 3300005365 Bacteria 3363
39 Ga0070688_100540868 3300005365 Bacteria 884
40 Ga0070688_101148189 3300005365 Bacteria 622
41 Ga0070688_101408464 3300005365 Bacteria 565
42 Ga0070659_100063532 3300005366 Bacteria 2921
43 Ga0070667_100000075 3300005367 Bacteria 120953
44 Ga0070667_100004048 3300005367 Bacteria 12396
45 Ga0070667_100012854 3300005367 Bacteria 6917
46 Ga0070667_100164775 3300005367 Bacteria 1954
47 Ga0070709_10005095 3300005434 Bacteria 7102
48 Ga0070709_10046065 3300005434 Bacteria 2710
49 Ga0070709_10345451 3300005434 Bacteria 1098
50 Ga0070713_100357314 3300005436 Bacteria 1356
51 Ga0070713_100552816 3300005436 Bacteria 1090
52 Ga0070713_100601013 3300005436 Bacteria 1045
53 Ga0070710_10001540 3300005437 Bacteria 10899
54 Ga0070701_10004264 3300005438 Bacteria 5766
55 Ga0070711_100001591 3300005439 Bacteria 12506
56 Ga0070711_100063796 3300005439 Bacteria 2572
57 Ga0070705_100025323 3300005440 Bacteria 3216
58 Ga0070705_100087384 3300005440 Bacteria 1932
59 Ga0070700_100014110 3300005441 Bacteria 4507
60 Ga0070700_100022565 3300005441 Bacteria 3673
61 Ga0070694_100018714 3300005444 Bacteria 4399
62 Ga0070708_100981774 3300005445 Bacteria 792
63 Ga0070663_100002640 3300005455 Bacteria 10142
64 Ga0070663_101339023 3300005455 Bacteria 633
65 Ga0070678_100001197 3300005456 Bacteria 13803
66 Ga0070662_100010769 3300005457 Bacteria 6019
67 Ga0070662_100297193 3300005457 Bacteria 1311
68 Ga0070662_101936736 3300005457 Bacteria 509
69 Ga0070681_10885179 3300005458 Bacteria 811
70 Ga0068867_100006287 3300005459 Bacteria 8400
71 Ga0068867_100199654 3300005459 Bacteria 1600
72 Ga0070685_10057771 3300005466 Bacteria 2259
73 Ga0070685_10474545 3300005466 Bacteria 881
74 Ga0070706_100587810 3300005467 Bacteria 1035
75 Ga0070706_102006561 3300005467 Bacteria 524
76 Ga0070698_101685308 3300005471 Bacteria 586
77 Ga0070684_100168020 3300005535 Bacteria 1992
78 Ga0070684_100272673 3300005535 Bacteria 1549
79 Ga0068853_100051687 3300005539 Bacteria 3538
80 Ga0068853_100064641 3300005539 Bacteria 3173
81 Ga0070672_100188078 3300005543 Bacteria 1723
82 Ga0070695_100040554 3300005545 Bacteria 2948
83 Ga0070696_100003435 3300005546 Bacteria 10555
84 Ga0070693_100032667 3300005547 Bacteria 2864
85 Ga0070693_100122157 3300005547 Bacteria 1617
86 Ga0070665_100005474 3300005548 Bacteria 13089
87 Ga0070665_100006380 3300005548 Bacteria 12021
88 Ga0070665_100059533 3300005548 Bacteria 3829
89 Ga0070665_100259269 3300005548 Bacteria 1740
90 Ga0070665_100461108 3300005548 Bacteria 1281
91 Ga0070665_101103995 3300005548 Bacteria 805
92 Ga0070704_100000391 3300005549 Bacteria 20083
93 Ga0070704_100036324 3300005549 Bacteria 3357
94 Ga0068855_100113289 3300005563 Bacteria 3111
95 Ga0070664_101951543 3300005564 Bacteria 557
96 Ga0068857_100387988 3300005577 Bacteria 1298
97 Ga0068854_100004672 3300005578 Bacteria 8636
98 Ga0068856_100004865 3300005614 Bacteria 13303
99 Ga0070702_100001144 3300005615 Bacteria 10661
100 Ga0070702_100073894 3300005615 Bacteria 2021
101 Ga0068852_101437779 3300005616 Bacteria 712
102 Ga0068852_101771922 3300005616 Bacteria 640
103 Ga0068859_100000606 3300005617 Bacteria 35852
104 Ga0068859_100003251 3300005617 Bacteria 16545
105 Ga0068859_100065886 3300005617 Bacteria 3656
106 Ga0068859_100571564 3300005617 Bacteria 1224
107 Ga0068859_100859037 3300005617 Bacteria 993
108 Ga0068864_100622399 3300005618 Bacteria 1049
109 Ga0068866_10002931 3300005718 Bacteria 7038
110 Ga0068866_10069786 3300005718 Bacteria 1852
111 Ga0068861_100120570 3300005719 Bacteria 2115
112 Ga0068861_100374854 3300005719 Bacteria 1255
113 Ga0068863_100465112 3300005841 Bacteria 1242
114 Ga0068858_100001109 3300005842 Bacteria 27859
115 Ga0068858_100073000 3300005842 Bacteria 3185
116 Ga0068858_101752370 3300005842 Bacteria 613
117 Ga0068860_100000025 3300005843 Bacteria 271553
118 Ga0068860_100012429 3300005843 Bacteria 8385
119 Ga0068860_100801985 3300005843 Bacteria 955
120 Ga0068862_100000045 3300005844 Bacteria 155641
121 Ga0068862_100001869 3300005844 Bacteria 19086
122 Ga0068862_100021009 3300005844 Bacteria 5455
123 Ga0068862_100186010 3300005844 Bacteria 1866
124 Ga0068862_100290319 3300005844 Bacteria 1502
125 Ga0068862_102535226 3300005844 Bacteria 524
126 Ga0081455_10039741 3300005937 Bacteria 4154
127 Ga0081455_10093207 3300005937 Bacteria 2435
128 Ga0081538_10043770 3300005981 Bacteria 2804
129 Ga0081538_10185021 3300005981 Bacteria 884
130 Ga0081540_1044640 3300005983 Bacteria 2260
131 Ga0081540_1119893 3300005983 Bacteria 1094
132 Ga0070717_10993873 3300006028 Bacteria 764
133 Ga0075365_10015619 3300006038 Bacteria 4596
134 Ga0075365_10227436 3300006038 Bacteria 1309
135 Ga0075365_10531100 3300006038 Bacteria 832
136 Ga0075365_10567653 3300006038 Bacteria 802
137 Ga0075368_10392240 3300006042 Bacteria 609
138 Ga0075363_100030212 3300006048 Bacteria 2803
139 Ga0075363_100184374 3300006048 Bacteria 1188
140 Ga0075363_100941004 3300006048 Bacteria 530
141 Ga0075364_10004468 3300006051 Bacteria 8052
142 Ga0075364_10005113 3300006051 Bacteria 7602
143 Ga0075364_10018231 3300006051 Bacteria 4392
144 Ga0075364_10071227 3300006051 Bacteria 2290
145 Ga0075364_10240055 3300006051 Bacteria 1231
146 Ga0075364_10433492 3300006051 Bacteria 898
147 Ga0070716_100001115 3300006173 Bacteria 11831
148 Ga0070716_100013982 3300006173 Bacteria 4104
149 Ga0070716_100047642 3300006173 Bacteria 2419
150 Ga0070716_100575181 3300006173 Bacteria 844
151 Ga0070712_100003721 3300006175 Bacteria 9391
152 Ga0070712_100040073 3300006175 Bacteria 3209
153 Ga0075362_10008504 3300006177 Bacteria 3927
154 Ga0075362_10279148 3300006177 Bacteria 826
155 Ga0075367_10360500 3300006178 Bacteria 918
156 Ga0075369_10004473 3300006186 Bacteria 5168
157 Ga0075369_10013887 3300006186 Bacteria 3207
158 Ga0075369_10058110 3300006186 Bacteria 1684
159 Ga0075369_10112024 3300006186 Bacteria 1230
160 Ga0075369_10137154 3300006186 Bacteria 1114
161 Ga0075369_10138554 3300006186 Bacteria 1108
162 Ga0097621_100190034 3300006237 Bacteria 1778
163 Ga0075370_10002478 3300006353 Bacteria 8558
164 Ga0075370_10206688 3300006353 Bacteria 1159
165 Ga0075370_10443772 3300006353 Bacteria 780
166 Ga0068871_100174587 3300006358 Bacteria 1844
167 Ga0068871_100205001 3300006358 Bacteria 1704
168 Ga0075428_100004846 3300006844 Bacteria 14930
169 Ga0075430_100280293 3300006846 Bacteria 1379
170 Ga0075431_100009857 3300006847 Bacteria 9591
171 Ga0075429_100156557 3300006880 Bacteria 1995
172 Ga0068865_100172714 3300006881 Bacteria 1658
173 Ga0097620_100000606 3300006931 Bacteria 35852
174 Ga0097620_100003251 3300006931 Bacteria 16545
175 Ga0097620_100065888 3300006931 Bacteria 3656
176 Ga0097620_100571680 3300006931 Bacteria 1224
177 Ga0097620_100859134 3300006931 Bacteria 993
178 Ga0099795_10007788 3300007788 Bacteria 3016
179 Ga0105251_10180661 3300009011 Bacteria 950
180 Ga0105244_10252061 3300009036 Bacteria 823
181 Ga0105250_10056101 3300009092 Bacteria 1581
182 Ga0105240_10017249 3300009093 Bacteria 9739
183 Ga0105240_11631791 3300009093 Bacteria 674
184 Ga0105240_12743192 3300009093 Bacteria 507
185 Ga0111539_10498934 3300009094 Bacteria 1418
186 Ga0111539_11906128 3300009094 Bacteria 689
187 Ga0105245_10002903 3300009098 Bacteria 15381
188 Ga0105245_10015297 3300009098 Bacteria 6686
189 Ga0105245_10123070 3300009098 Bacteria 2425
190 Ga0105245_10692525 3300009098 Bacteria 1052
191 Ga0105245_11198151 3300009098 Bacteria 807
192 Ga0105245_12331702 3300009098 Unclassified 589
193 Ga0105247_10000010 3300009101 Bacteria 302475
194 Ga0105247_10000178 3300009101 Bacteria 61996
195 Ga0105247_10000366 3300009101 Bacteria 38409
196 Ga0105247_10825515 3300009101 Bacteria 709
197 Ga0114129_10005689 3300009147 Bacteria 17652
198 Ga0114129_10261011 3300009147 Bacteria 2322
199 Ga0105243_10001450 3300009148 Bacteria 20829
200 Ga0105243_10060285 3300009148 Bacteria 3031
201 Ga0105241_10214778 3300009174 Bacteria 1613
202 Ga0105241_10411288 3300009174 Bacteria 1189
203 Ga0105241_10781865 3300009174 Bacteria 878
204 Ga0105242_10004714 3300009176 Bacteria 10558
205 Ga0105242_10120942 3300009176 Bacteria 2247
206 Ga0105242_10149393 3300009176 Bacteria 2036
207 Ga0105248_10000145 3300009177 Bacteria 81917
208 Ga0105248_10002194 3300009177 Bacteria 21610
209 Ga0105248_10007315 3300009177 Bacteria 12115
210 Ga0105248_10772473 3300009177 Bacteria 1084
211 Ga0105237_10005813 3300009545 Bacteria 13836
212 Ga0105237_10025835 3300009545 Bacteria 6004
213 Ga0105237_10513643 3300009545 Bacteria 1205
214 Ga0105238_10611824 3300009551 Bacteria 1098
215 Ga0105238_11305256 3300009551 Bacteria 752
216 Ga0105238_12904706 3300009551 Bacteria 515
217 Ga0105249_10000010 3300009553 Bacteria 306939
218 Ga0105249_10007809 3300009553 Bacteria 9318
219 Ga0105249_10699719 3300009553 Bacteria 1073
220 Ga0099796_10009296 3300010159 Bacteria 2655
221 Ga0105239_10013580 3300010375 Bacteria 9040
222 Ga0105239_10152069 3300010375 Bacteria 2583
223 Ga0105239_10415271 3300010375 Bacteria 1524
224 Ga0105239_11238379 3300010375 Bacteria 860
225 Ga0105239_11718287 3300010375 Bacteria 726
226 Ga0105246_11903516 3300011119 Bacteria 571
227 Ga0157369_10253713 3300013105 Bacteria 1835
228 Ga0157374_10479103 3300013296 Bacteria 1248
229 Ga0157378_10001442 3300013297 Bacteria 21432
230 Ga0157378_10156287 3300013297 Bacteria 2129
231 Ga0163162_10002768 3300013306 Bacteria 16649
232 Ga0163162_10078462 3300013306 Bacteria 3368
233 Ga0163162_10121125 3300013306 Bacteria 2721
234 Ga0163162_10706108 3300013306 Bacteria 1130
235 Ga0163162_12288308 3300013306 Bacteria 621
236 Ga0157372_10009077 3300013307 Bacteria 10565
237 Ga0157375_10001272 3300013308 Bacteria 21812
238 Ga0157375_12703309 3300013308 Unclassified 593
239 Ga0163163_10010065 3300014325 Bacteria 8483
240 Ga0163163_11008132 3300014325 Bacteria 896
241 Ga0163163_11030660 3300014325 Bacteria 886
242 Ga0157380_10000302 3300014326 Bacteria 29666
243 Ga0157379_10009932 3300014968 Bacteria 8287
244 Ga0157376_10193219 3300014969 Bacteria 1868
245 Ga0157376_10305068 3300014969 Bacteria 1508
246 Ga0157376_11565559 3300014969 Bacteria 693
247 Ga0157376_11953511 3300014969 Unclassified 624
248 Ga0163161_10000799 3300017792 Bacteria 24668
249 Ga0163161_10294140 3300017792 Bacteria 1277
250 Ga0213876_10003078 3300021384 Bacteria 9655
251 Ga0213876_10129432 3300021384 Bacteria 1341
252 Ga0213876_10156916 3300021384 Bacteria 1210
253 Ga0213875_10041041 3300021388 Bacteria 2177
254 Ga0213871_10118423 3300021441 Bacteria 788
255 Ga0207696_1061230 3300025711 Bacteria 1058
256 Ga0207682_10044059 3300025893 Bacteria 1828
257 Ga0207692_10030153 3300025898 Bacteria 2583
258 Ga0207642_10000143 3300025899 Bacteria 20251
259 Ga0207642_10011054 3300025899 Bacteria 3206
260 Ga0207710_10000028 3300025900 Bacteria 304525
261 Ga0207710_10001961 3300025900 Bacteria 9831
262 Ga0207688_10000090 3300025901 Bacteria 35199
263 Ga0207680_10027001 3300025903 Bacteria 3190
264 Ga0207647_10069287 3300025904 Bacteria 2132
265 Ga0207685_10005331 3300025905 Bacteria 3383
266 Ga0207685_10103693 3300025905 Bacteria 1221
267 Ga0207699_10012071 3300025906 Bacteria 4386
268 Ga0207699_10563510 3300025906 Bacteria 827
269 Ga0207645_10027091 3300025907 Bacteria 3703
270 Ga0207684_11349584 3300025910 Bacteria 585
271 Ga0207707_10762461 3300025912 Bacteria 808
272 Ga0207695_10017640 3300025913 Bacteria 8295
273 Ga0207695_10133153 3300025913 Bacteria 2441
274 Ga0207693_10000555 3300025915 Bacteria 33777
275 Ga0207693_10002064 3300025915 Bacteria 17553
276 Ga0207663_10002170 3300025916 Bacteria 9368
277 Ga0207663_10016673 3300025916 Bacteria 4080
278 Ga0207662_10354014 3300025918 Bacteria 987
279 Ga0207681_10006072 3300025923 Bacteria 7406
280 Ga0207681_10202684 3300025923 Bacteria 1524
281 Ga0207681_11225151 3300025923 Bacteria 630
282 Ga0207694_10023319 3300025924 Bacteria 4698
283 Ga0207694_10459613 3300025924 Bacteria 1063
284 Ga0207650_10539242 3300025925 Bacteria 978
285 Ga0207659_10849746 3300025926 Bacteria 784
286 Ga0207687_10012506 3300025927 Bacteria 5545
287 Ga0207687_10158624 3300025927 Bacteria 1734
288 Ga0207687_10640379 3300025927 Bacteria 899
289 Ga0207700_10485984 3300025928 Bacteria 1091
290 Ga0207700_10621914 3300025928 Bacteria 962
291 Ga0207700_10909935 3300025928 Bacteria 787
292 Ga0207664_10297450 3300025929 Bacteria 1419
293 Ga0207664_11570252 3300025929 Unclassified 580
294 Ga0207644_10100117 3300025931 Bacteria 2176
295 Ga0207644_10117672 3300025931 Bacteria 2018
296 Ga0207690_10032665 3300025932 Bacteria 3341
297 Ga0207706_10005251 3300025933 Bacteria 12080
298 Ga0207706_10016540 3300025933 Bacteria 6658
299 Ga0207686_10001099 3300025934 Bacteria 15816
300 Ga0207686_10006362 3300025934 Bacteria 6354
301 Ga0207686_10065458 3300025934 Bacteria 2318
302 Ga0207709_10002258 3300025935 Bacteria 12252
303 Ga0207709_10700053 3300025935 Bacteria 811
304 Ga0207670_10029755 3300025936 Bacteria 3482
305 Ga0207669_10000752 3300025937 Bacteria 13994
306 Ga0207704_10000393 3300025938 Bacteria 19943
307 Ga0207704_10142440 3300025938 Bacteria 1679
308 Ga0207665_10001801 3300025939 Bacteria 14436
309 Ga0207665_10003000 3300025939 Bacteria 11326
310 Ga0207665_10085661 3300025939 Bacteria 2176
311 Ga0207665_10142723 3300025939 Bacteria 1709
312 Ga0207691_10093942 3300025940 Bacteria 2684
313 Ga0207691_10309885 3300025940 Bacteria 1355
314 Ga0207711_10000069 3300025941 Bacteria 115038
315 Ga0207711_10019795 3300025941 Bacteria 5609
316 Ga0207689_10022958 3300025942 Bacteria 5240
317 Ga0207661_10096794 3300025944 Bacteria 2470
318 Ga0207661_11754810 3300025944 Unclassified 566
319 Ga0207667_10082434 3300025949 Bacteria 3332
320 Ga0207667_10380315 3300025949 Bacteria 1439
321 Ga0207712_10000016 3300025961 Bacteria 343014
322 Ga0207712_10046835 3300025961 Bacteria 3000
323 Ga0207668_10002046 3300025972 Bacteria 11766
324 Ga0207668_10005693 3300025972 Bacteria 7338
325 Ga0207668_10178951 3300025972 Bacteria 1671
326 Ga0207668_10276815 3300025972 Bacteria 1374
327 Ga0207658_10000237 3300025986 Bacteria 58047
328 Ga0207658_10002082 3300025986 Bacteria 14885
329 Ga0207658_10024434 3300025986 Bacteria 4228
330 Ga0207677_10003455 3300026023 Bacteria 8370
331 Ga0207677_10105422 3300026023 Bacteria 2086
332 Ga0207677_11401236 3300026023 Bacteria 644
333 Ga0207703_10011384 3300026035 Bacteria 6920
334 Ga0207703_10044415 3300026035 Bacteria 3571
335 Ga0207703_11766733 3300026035 Bacteria 594
336 Ga0207639_10003107 3300026041 Bacteria 11160
337 Ga0207678_10011227 3300026067 Bacteria 7867
338 Ga0207678_10013849 3300026067 Bacteria 7086
339 Ga0207708_10006978 3300026075 Bacteria 8352
340 Ga0207702_10005011 3300026078 Bacteria 11634
341 Ga0207702_10266699 3300026078 Bacteria 1614
342 Ga0207702_10724634 3300026078 Bacteria 981
343 Ga0207702_10803924 3300026078 Bacteria 929
344 Ga0207641_10025646 3300026088 Bacteria 4859
345 Ga0207648_10000349 3300026089 Bacteria 50786
346 Ga0207648_10027211 3300026089 Bacteria 5079
347 Ga0207676_10094326 3300026095 Bacteria 2466
348 Ga0207675_100006409 3300026118 Bacteria 11147
349 Ga0207683_10000040 3300026121 Bacteria 95127
350 Ga0207683_11097728 3300026121 Bacteria 738
351 Ga0207698_12171651 3300026142 Bacteria 568
352 Ga0268266_10002967 3300028379 Bacteria 17501
353 Ga0268266_10005675 3300028379 Bacteria 11572
354 Ga0268266_10036703 3300028379 Bacteria 4174
355 Ga0268266_10189338 3300028379 Bacteria 1878
356 Ga0268266_10681904 3300028379 Bacteria 990
357 Ga0268265_10000056 3300028380 Bacteria 155720
358 Ga0268265_10005589 3300028380 Bacteria 8582
359 Ga0268265_10154149 3300028380 Bacteria 1942
360 Ga0268265_10353054 3300028380 Bacteria 1343
361 Ga0268264_10000053 3300028381 Bacteria 320368
362 Ga0268264_10208375 3300028381 Bacteria 1793
363 Ga0268264_10225825 3300028381 Bacteria 1726
364 Ga0265336_10003716 3300028666 Bacteria 5921
365 Ga0307517_10042614 3300028786 Bacteria 4861
366 Ga0307515_10236659 3300028794 Bacteria 1606
367 Ga0265338_10011151 3300028800 Bacteria 10419
368 Ga0307513_10007598 3300031456 Bacteria 14012
369 Ga0307509_10039018 3300031507 Bacteria 5176
370 Ga0307408_100126425 3300031548 Bacteria 1989
371 Ga0265314_10389809 3300031711 Bacteria 756
372 Ga0307405_10175459 3300031731 Bacteria 1533
373 Ga0307410_10534364 3300031852 Bacteria 969
374 Ga0307410_10958689 3300031852 Bacteria 736
375 Ga0307406_10029544 3300031901 Bacteria 3320
376 Ga0307406_10177476 3300031901 Bacteria 1548
377 Ga0307407_10069595 3300031903 Bacteria 2089
378 Ga0307412_11089890 3300031911 Bacteria 710
379 Ga0307409_101011214 3300031995 Bacteria 850
380 Ga0307416_100019395 3300032002 Bacteria 4821
381 Ga0307416_102929544 3300032002 Bacteria 571
382 Ga0307415_100010281 3300032126 Bacteria 5291
383 Ga0307415_102238496 3300032126 Bacteria 535
384 Ga0307507_10058915 3300033179 Bacteria 3600
385 Ga0373958_0005189 3300034819 Bacteria 1967
386 Ga0373938_0163331 3300034957 Bacteria 599
387 Ga0373949_0029246 3300035090 Bacteria 1304
388 Ga0373949_0242939 3300035090 Bacteria 554
389 Ga0373932_0317409 3300035112 Bacteria 585
390 Ga0373939_0022264 3300035114 Bacteria 1745
391 Ga0373941_0182084 3300035115 Bacteria 789
392 Ga0373942_0082233 3300035207 Bacteria 958
393 Ga0373931_0045619 3300035691 Bacteria 2315
394 Ga0373931_0093273 3300035691 Bacteria 1681
395 Ga0373935_0192513 3300035692 Bacteria 1405
396 Ga0373925_0005890 3300037068 Bacteria 9085
397 Ga0395900_0016131 3300037418 Bacteria 7610
398 Ga0395900_0073852 3300037418 Bacteria 3507
399 Ga0395898_0203199 3300037466 Bacteria 1891
400 Ga0436364_0023947 3300037853 Bacteria 1583
401 Ga0436364_0171371 3300037853 Bacteria 2262
402 Ga0436364_0329205 3300037853 Bacteria 2715
403 Ga0436364_0604589 3300037853 Bacteria 10148
404 Ga0436364_0928958 3300037853 Bacteria 1521
405 Ga0436365_0329583 3300039437 Bacteria 52503
406 Ga0436365_0465547 3300039437 Bacteria 1875
407 Ga0436365_1490253 3300039437 Bacteria 9196
408 Ga0436360_0763556 3300039438 Bacteria 1239
409 Ga0436363_0002351 3300039450 Bacteria 1483
410 Ga0436363_1381948 3300039450 Bacteria 1109
411 Ga0439466_0005991 3300041411 Bacteria 4627
412 Ga0439466_0007929 3300041411 Bacteria 4005
413 Ga0439465_0000439 3300041413 Bacteria 12169
414 Ga0439465_0004076 3300041413 Bacteria 4756
415 Ga0439465_0030810 3300041413 Bacteria 1707
416 Ga0451797_0034473 3300041453 Bacteria 1281
417 Ga0451851_0694353 3300041507 Bacteria 516
418 Ga0451853_2289717 3300041512 Bacteria 747
419 Ga0451853_3770463 3300041512 Bacteria 573
420 Ga0439431_0001548 3300041997 Bacteria 5093
421 Ga0439442_007871 3300042002 Bacteria 2151
422 Ga0439434_0134917 3300042435 Bacteria 811
423 Ga0439435_0059908 3300042436 Bacteria 1107
424 Ga0466969_0208295 3300044656 Bacteria 891
425 Ga0466972_0252989 3300044658 Bacteria 823
426 Ga0466965_0034243 3300044683 Bacteria 2485
427 Ga0466966_0031433 3300044684 Bacteria 3443
428 Ga0466966_0276626 3300044684 Bacteria 1010
429 Ga0466961_0094341 3300044693 Bacteria 1888
430 Ga0466961_0296851 3300044693 Bacteria 987
431 Ga0466963_0033323 3300044694 Bacteria 3343
432 Ga0466963_0035750 3300044694 Bacteria 3237
433 Ga0466963_0090128 3300044694 Bacteria 2087
434 Ga0466963_0233391 3300044694 Bacteria 1289
435 Ga0466964_0140355 3300044706 Bacteria 1110
436 Ga0466971_0026763 3300044719 Bacteria 2580
437 Ga0466971_0032310 3300044719 Bacteria 2345
438 Ga0466971_0058338 3300044719 Bacteria 1742
439 Ga0466968_0008896 3300044735 Bacteria 3853
440 Ga0466968_0281793 3300044735 Bacteria 796
441 Ga0466970_0078052 3300044765 Bacteria 1786
442 Ga0466970_0160641 3300044765 Bacteria 1243
443 Ga0466970_0423686 3300044765 Bacteria 761
444 Ga0466970_0437885 3300044765 Bacteria 748
445 Ga0466970_0547205 3300044765 Bacteria 669
446 Ga0466957_0049815 3300044842 Bacteria 2547
447 Ga0466957_0236789 3300044842 Bacteria 1210
448 Ga0466960_0011745 3300044901 Bacteria 3676
449 Ga0466960_0061867 3300044901 Bacteria 1839
450 Ga0466959_0026324 3300045049 Bacteria 4311
451 Ga0466959_0072859 3300045049 Bacteria 2485
452 Ga0466959_0292387 3300045049 Bacteria 1117
453 Ga0466958_0154332 3300045836 Bacteria 1449
454 Ga0466958_0260122 3300045836 Bacteria 1111
455 Ga0466958_0293888 3300045836 Bacteria 1042
456 Ga0466958_0493153 3300045836 Bacteria 795
457 Ga0466967_0003093 3300045976 Bacteria 10702
458 Ga0466967_0013586 3300045976 Bacteria 6300
459 Ga0466967_0023877 3300045976 Bacteria 5018
460 Ga0466967_0301207 3300045976 Bacteria 1542
461 Ga0466967_0409075 3300045976 Bacteria 1321
462 Ga0466967_0600668 3300045976 Bacteria 1086
463 Ga0466967_0805672 3300045976 Bacteria 933
464 Ga0466967_0951721 3300045976 Bacteria 855
465 Ga0466967_1045977 3300045976 Bacteria 813
466 Ga0466967_1073442 3300045976 Bacteria 802
467 Ga0466967_1252127 3300045976 Unclassified 739
468 Ga0466967_1363013 3300045976 Bacteria 706
469 Ga0466967_1432110 3300045976 Bacteria 688
470 Ga0466967_1486107 3300045976 Bacteria 675
471 Ga0466967_2186334 3300045976 Bacteria 549
472 Ga0495603_0112621 3300046455 Bacteria 1586
473 Ga0495638_0040373 3300046460 Bacteria 2957
474 Ga0495651_0068995 3300046462 Bacteria 2694
475 Ga0495653_0067089 3300046463 Bacteria 2696
476 Ga0495653_0387296 3300046463 Bacteria 891
477 Ga0495639_0176509 3300046475 Bacteria 1039
478 Ga0495662_0163556 3300046476 Bacteria 1097
479 Ga0495664_0206828 3300046477 Bacteria 1189
480 Ga0495594_0361818 3300046499 Bacteria 826
481 Ga0495608_0445525 3300046511 Bacteria 788
482 Ga0495608_0649549 3300046511 Unclassified 630
483 Ga0495618_0469655 3300046514 Unclassified 762
484 Ga0495628_0300540 3300046516 Bacteria 1188
485 Ga0495630_0742738 3300046517 Unclassified 750
486 Ga0495648_0216946 3300046524 Bacteria 946
487 Ga0495652_0160853 3300046529 Bacteria 1744
488 Ga0495665_0080640 3300046531 Bacteria 1712
489 Ga0495640_0175606 3300046533 Bacteria 1367
490 Ga0495587_0303226 3300046536 Bacteria 893
491 Ga0495667_0119815 3300046559 Bacteria 1700
492 Ga0495634_0044910 3300046642 Bacteria 2989
493 Ga0495635_0005944 3300046663 Bacteria 8515
494 Ga0495657_0019023 3300046675 Bacteria 4962
495 Ga0495657_0447062 3300046675 Bacteria 757
496 Ga0495647_0032871 3300046681 Bacteria 1936
497 Ga0495658_0742803 3300046683 Bacteria 629
498 Ga0495613_0037167 3300046689 Bacteria 3610
499 Ga0495624_0231630 3300046690 Bacteria 1119
500 Ga0495649_0154879 3300046694 Bacteria 1203
501 Ga0495600_0542182 3300046809 Bacteria 711
502 Ga0495604_0162893 3300047317 Bacteria 1574
503 Ga0495604_0725119 3300047317 Bacteria 630
504 Ga0495674_0370676 3300047319 Bacteria 1160
505 Ga0495672_0030035 3300047320 Bacteria 3415
506 Ga0495672_0223884 3300047320 Bacteria 927
507 Ga0495676_0027314 3300047321 Bacteria 4895
508 Ga0495676_0852769 3300047321 Bacteria 585
509 Ga0495684_0108829 3300047471 Bacteria 2093
510 Ga0495602_0721107 3300048088 Bacteria 675
511 Ga0496100_0005195 3300048903 Bacteria 6986
512 Ga0496100_0142140 3300048903 Bacteria 1702
513 Ga0496100_0384966 3300048903 Bacteria 1066
514 Ga0496100_0403034 3300048903 Bacteria 1042
515 Ga0496100_0476213 3300048903 Bacteria 960
516 Ga0496100_0616133 3300048903 Bacteria 844
517 Ga0496101_0002316 3300048904 Bacteria 11658
518 Ga0496101_0060971 3300048904 Bacteria 2738
519 Ga0496101_0132603 3300048904 Bacteria 1893
520 Ga0496101_0157742 3300048904 Bacteria 1739
521 Ga0496101_0422942 3300048904 Bacteria 1050
522 Ga0496102_0000070 3300048905 Bacteria 155087
523 Ga0496102_0000600 3300048905 Bacteria 37655
524 Ga0496102_0004697 3300048905 Bacteria 11558
525 Ga0496102_0008806 3300048905 Bacteria 8658
526 Ga0496102_0023709 3300048905 Bacteria 5453
527 Ga0496102_0037090 3300048905 Bacteria 4396
528 Ga0496102_0076178 3300048905 Bacteria 3085
529 Ga0496102_0146132 3300048905 Bacteria 2219
530 Ga0496102_0152737 3300048905 Bacteria 2170
531 Ga0496102_0409613 3300048905 Bacteria 1274
532 Ga0496102_0865657 3300048905 Bacteria 826
533 Ga0496102_1623856 3300048905 Bacteria 565
534 Ga0496103_0000477 3300048906 Bacteria 33721
535 Ga0496103_0000667 3300048906 Bacteria 25794
536 Ga0496103_0023011 3300048906 Bacteria 3756
537 Ga0496104_0000672 3300048907 Bacteria 29365
538 Ga0496104_0078845 3300048907 Bacteria 3139
539 Ga0496104_0215608 3300048907 Bacteria 1831
540 Ga0496104_0358326 3300048907 Bacteria 1371
541 Ga0496104_0455758 3300048907 Bacteria 1191
542 Ga0496104_0470792 3300048907 Bacteria 1168
543 Ga0496104_0777574 3300048907 Bacteria 864
544 Ga0496104_0913417 3300048907 Bacteria 783
545 Ga0496105_0049701 3300048908 Bacteria 3463
546 Ga0496105_0070081 3300048908 Bacteria 2898
547 Ga0496105_0696440 3300048908 Bacteria 780
548 Ga0496106_0010257 3300048909 Bacteria 6926
549 Ga0496106_0130136 3300048909 Bacteria 1973
550 Ga0496106_0153804 3300048909 Bacteria 1815
551 Ga0496107_0002661 3300048910 Bacteria 11698
552 Ga0496107_0028337 3300048910 Bacteria 3979
553 Ga0496107_0047928 3300048910 Bacteria 3077
554 Ga0496107_0260312 3300048910 Bacteria 1291
555 Ga0496108_0013001 3300048911 Bacteria 6781
556 Ga0496108_0026492 3300048911 Bacteria 4782
557 Ga0496108_0141874 3300048911 Bacteria 2070
558 Ga0496108_0167033 3300048911 Bacteria 1903
559 Ga0496108_0353081 3300048911 Bacteria 1283
560 Ga0496108_0518759 3300048911 Bacteria 1040
561 Ga0496109_0001605 3300048912 Bacteria 18874
562 Ga0496109_0019118 3300048912 Bacteria 6034
563 Ga0496109_0033495 3300048912 Bacteria 4622
564 Ga0496109_0190134 3300048912 Bacteria 1929
565 Ga0496109_0233339 3300048912 Bacteria 1731
566 Ga0496109_0285342 3300048912 Bacteria 1556
567 Ga0496109_1475156 3300048912 Bacteria 615
568 Ga0496110_0003786 3300048913 Bacteria 11654
569 Ga0496110_0056564 3300048913 Bacteria 3452
570 Ga0496110_0100686 3300048913 Bacteria 2590
571 Ga0496110_0130988 3300048913 Bacteria 2265
572 Ga0496110_1421049 3300048913 Bacteria 603
573 Ga0496111_0155726 3300048914 Bacteria 1695
574 Ga0496111_0455696 3300048914 Bacteria 943
575 Ga0496112_0003367 3300048915 Bacteria 13198
576 Ga0496112_0104600 3300048915 Bacteria 2801
577 Ga0496112_0262360 3300048915 Bacteria 1677
578 Ga0496112_0444951 3300048915 Bacteria 1234
579 Ga0496112_0532420 3300048915 Bacteria 1109
580 Ga0496112_0564314 3300048915 Bacteria 1072
581 Ga0496112_0763421 3300048915 Bacteria 893
582 Ga0496113_0000481 3300048916 Bacteria 19604
583 Ga0496113_0028291 3300048916 Bacteria 4030
584 Ga0496113_0255357 3300048916 Bacteria 1400
585 Ga0496113_0465287 3300048916 Bacteria 1016
586 Ga0496114_0001610 3300048917 Bacteria 17143
587 Ga0496114_0024763 3300048917 Bacteria 4900
588 Ga0496114_0145542 3300048917 Bacteria 2054
589 Ga0496115_0033380 3300048918 Bacteria 4064
590 Ga0496115_0696981 3300048918 Bacteria 799
591 Ga0496116_0023877 3300048919 Bacteria 4540
592 Ga0496117_0001117 3300048920 Bacteria 40451
593 Ga0496117_0097902 3300048920 Bacteria 1867
594 Ga0496118_0000272 3300048921 Bacteria 91016
595 Ga0496118_0004850 3300048921 Bacteria 15670
596 Ga0496119_0001634 3300048922 Bacteria 26464
597 Ga0496119_0016323 3300048922 Bacteria 5658
598 Ga0496119_0439828 3300048922 Bacteria 616
599 Ga0496120_0000203 3300048923 Bacteria 101935
600 Ga0496120_0015370 3300048923 Bacteria 5054
601 Ga0496121_0002543 3300048924 Bacteria 27647
602 Ga0496124_0402552 3300048927 Bacteria 949
603 Ga0496125_0010205 3300048928 Bacteria 9521
604 Ga0496126_0035353 3300048929 Bacteria 4684
605 Ga0496126_0104599 3300048929 Bacteria 2473
606 Ga0496126_0158219 3300048929 Bacteria 1937
607 Ga0496126_0867474 3300048929 Bacteria 687
608 Ga0501031_0137044 3300049568 Bacteria 1599
609 Ga0501032_0003933 3300049569 Bacteria 11273
610 Ga0501032_0009488 3300049569 Bacteria 7053
611 Ga0501033_0005242 3300049570 Bacteria 10291
612 Ga0501033_0928843 3300049570 Bacteria 584
613 Ga0501034_0015666 3300049571 Bacteria 7784
614 Ga0501034_0021567 3300049571 Bacteria 6562
615 Ga0501034_0285927 3300049571 Bacteria 1588
616 Ga0501034_0457086 3300049571 Bacteria 1194
617 Ga0501034_0576746 3300049571 Bacteria 1032
618 Ga0501034_1350627 3300049571 Bacteria 588
619 Ga0501036_0033912 3300049572 Bacteria 4318
620 Ga0501037_0000099 3300049573 Bacteria 81092
621 Ga0501037_0011193 3300049573 Bacteria 6603
622 Ga0501039_0008540 3300049575 Bacteria 7808
623 Ga0501040_0589116 3300049576 Unclassified 803
624 Ga0501041_0666785 3300049577 Bacteria 665
625 Ga0501043_0000228 3300049579 Bacteria 51127
626 Ga0501043_0061911 3300049579 Bacteria 2938
627 Ga0501046_0011358 3300049580 Bacteria 7620
628 Ga0501047_0002023 3300049581 Bacteria 19406
629 Ga0501047_0395108 3300049581 Bacteria 1216
630 Ga0501048_0019214 3300049582 Bacteria 5017
631 Ga0501067_0277294 3300049583 Bacteria 934
632 Ga0501068_0142958 3300049584 Bacteria 1500
633 Ga0501069_0042281 3300049585 Bacteria 2521
634 Ga0501070_0006875 3300049586 Bacteria 9677
635 Ga0501070_0020965 3300049586 Bacteria 5482
636 Ga0501070_0197944 3300049586 Bacteria 1650
637 Ga0501070_1180289 3300049586 Bacteria 588
638 Ga0501071_0336612 3300049587 Bacteria 1147
639 Ga0501073_0397299 3300049589 Bacteria 952
640 Ga0501073_0506825 3300049589 Bacteria 834
641 Ga0501080_0018162 3300049742 Bacteria 6510
642 Ga0501083_0036359 3300049744 Bacteria 3359
643 Ga0501035_0002184 3300049822 Bacteria 19411
644 Ga0501044_0002158 3300049823 Bacteria 22557
645 Ga0501044_0014552 3300049823 Bacteria 8488
646 Ga0501044_0253972 3300049823 Bacteria 1698
647 Ga0501044_0827104 3300049823 Bacteria 804
648 nmdc:mga03683_439054_c1 3300050489 Bacteria 627
649 nmdc:mga03683_6343_c1 3300050489 Bacteria 4043
650 nmdc:mga03683_72136_c1 3300050489 Bacteria 1478
651 nmdc:mga03n38_68444_c1 3300050490 Bacteria 1637
652 nmdc:mga03n38_767172_c1 3300050490 Bacteria 560
653 nmdc:mga03n38_78819_c1 3300050490 Bacteria 1543
654 nmdc:mga03n38_866344_c1 3300050490 Bacteria 529
655 nmdc:mga00v17_254310_c1 3300050491 Bacteria 1139
656 nmdc:mga00v17_311709_c1 3300050491 Unclassified 1022
657 nmdc:mga00v17_36772_c1 3300050491 Bacteria 2920
658 nmdc:mga00v17_81190_c1 3300050491 Bacteria 2025
659 nmdc:mga00v17_97515_c1 3300050491 Bacteria 1853
660 nmdc:mga0yw44_113814_c1 3300050492 Bacteria 1736
661 nmdc:mga0yw44_467099_c1 3300050492 Bacteria 855
662 nmdc:mga0yw44_51090_c1 3300050492 Bacteria 1631
663 nmdc:mga0yw44_818969_c1 3300050492 Bacteria 632
664 nmdc:mga06z11_806305_c1 3300050494 Bacteria 572
665 nmdc:mga06z11_830948_c1 3300050494 Bacteria 563
666 nmdc:mga07m45_329260_c1 3300050496 Bacteria 888
667 nmdc:mga09592_569056_c1 3300050508 Bacteria 972
668 nmdc:mga0qj67_141345_c2 3300050509 Bacteria 1387
669 nmdc:mga0qj67_28056_c1 3300050509 Bacteria 4367
670 nmdc:mga06r32_5670_c1 3300050510 Bacteria 11237
671 nmdc:mga08y16_388379_c1 3300050511 Bacteria 1430
672 nmdc:mga0sz30_116573_c1 3300050516 Bacteria 1172
673 nmdc:mga0sz30_165695_c1 3300050516 Bacteria 979
674 nmdc:mga0sz30_169013_c1 3300050516 Unclassified 969
675 nmdc:mga0sz30_1896_c2 3300050516 Bacteria 5690
676 nmdc:mga0sz30_6965_c1 3300050516 Bacteria 4225
677 nmdc:mga0sz30_97397_c1 3300050516 Bacteria 1283
678 Ga0495612_0191720 3300053078 Bacteria 900
679 Ga0500635_0045829 3300053080 Bacteria 1481
680 Ga0495619_0255368 3300053085 Unclassified 1214
681 Ga0500578_0659327 3300053086 Bacteria 568
682 Ga0500604_0016559 3300053151 Bacteria 2032
683 Ga0500616_0015627 3300053153 Bacteria 4334
684 Ga0466962_0032975 3300061719 Bacteria 2478

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041453 Ga0451797_0034473 Ga0451797_0034473_225_647 128
2 3300031901 Ga0307406_10177476 Ga0307406_101774764 134
3 3300032126 Ga0307415_102238496 Ga0307415_1022384962 134
4 3300005457 Ga0070662_101936736 Ga0070662_1019367361 135
5 3300006028 Ga0070717_10993873 Ga0070717_109938732 135
6 iso_pu_bacteria 2751185782 2753264392 135
7 3300013308 Ga0157375_12703309 Ga0157375_127033091 136
8 3300050516 nmdc:mga0sz30_116573_c1 nmdc:mga0sz30_116573_c1_457_867 136
9 3300014969 Ga0157376_11565559 Ga0157376_115655592 137
10 3300003322 rootL2_10132418 rootL2_101324182 138
11 3300005335 Ga0070666_10306095 Ga0070666_103060952 138
12 3300005535 Ga0070684_100168020 Ga0070684_1001680203 138
13 3300005548 Ga0070665_101103995 Ga0070665_1011039951 138
14 3300005564 Ga0070664_101951543 Ga0070664_1019515431 138
15 3300005983 Ga0081540_1044640 Ga0081540_10446403 138
16 3300009551 Ga0105238_12904706 Ga0105238_129047061 138
17 3300026078 Ga0207702_10266699 Ga0207702_102666993 138
18 3300031507 Ga0307509_10039018 Ga0307509_100390185 138
19 3300033179 Ga0307507_10058915 Ga0307507_100589155 138
20 3300035692 Ga0373935_0192513 Ga0373935_0192513_52_498 138
21 3300005347 Ga0070668_100003461 Ga0070668_1000034619 141
22 3300005467 Ga0070706_102006561 Ga0070706_1020065611 141
23 3300005617 Ga0068859_100065886 Ga0068859_1000658865 141
24 3300005844 Ga0068862_100021009 Ga0068862_1000210094 141
25 3300006931 Ga0097620_100065888 Ga0097620_1000658885 141
26 3300009098 Ga0105245_10015297 Ga0105245_100152974 141
27 3300009174 Ga0105241_10411288 Ga0105241_104112882 141
28 3300009176 Ga0105242_10120942 Ga0105242_101209422 141
29 3300010375 Ga0105239_10415271 Ga0105239_104152712 141
30 3300013296 Ga0157374_10479103 Ga0157374_104791031 141
31 3300013297 Ga0157378_10156287 Ga0157378_101562872 141
32 3300014325 Ga0163163_11030660 Ga0163163_110306602 141
33 3300025910 Ga0207684_11349584 Ga0207684_113495841 141
34 3300025923 Ga0207681_11225151 Ga0207681_112251511 141
35 3300025927 Ga0207687_10012506 Ga0207687_100125062 141
36 3300025934 Ga0207686_10065458 Ga0207686_100654584 141
37 3300025972 Ga0207668_10002046 Ga0207668_100020464 141
38 3300031731 Ga0307405_10175459 Ga0307405_101754592 141
39 3300044765 Ga0466970_0160641 Ga0466970_0160641_95_520 141
40 iso_pu_bacteria 8055157932 8055158918 141
41 3300005327 Ga0070658_11138118 Ga0070658_111381181 142
42 3300009098 Ga0105245_12331702 Ga0105245_123317021 142
43 3300010375 Ga0105239_11718287 Ga0105239_117182871 142
44 3300025928 Ga0207700_10621914 Ga0207700_106219142 142
45 3300025949 Ga0207667_10082434 Ga0207667_100824343 142
46 3300026078 Ga0207702_10803924 Ga0207702_108039242 142
47 3300046463 Ga0495653_0067089 Ga0495653_0067089_985_1428 143
48 3300046514 Ga0495618_0469655 Ga0495618_0469655_248_691 143
49 3300046516 Ga0495628_0300540 Ga0495628_0300540_653_1096 143
50 3300046517 Ga0495630_0742738 Ga0495630_0742738_231_674 143
51 3300047319 Ga0495674_0370676 Ga0495674_0370676_112_555 143
52 3300047471 Ga0495684_0108829 Ga0495684_0108829_546_989 143
53 3300053085 Ga0495619_0255368 Ga0495619_0255368_633_1076 143
54 3300005364 Ga0070673_100311897 Ga0070673_1003118972 144
55 3300025924 Ga0207694_10023319 Ga0207694_100233193 144
56 3300037853 Ga0436364_0023947 Ga0436364_0023947_880_1314 144
57 3300045836 Ga0466958_0493153 Ga0466958_0493153_49_483 144
58 3300046475 Ga0495639_0176509 Ga0495639_0176509_536_976 144
59 3300046524 Ga0495648_0216946 Ga0495648_0216946_226_678 144
60 3300046681 Ga0495647_0032871 Ga0495647_0032871_152_592 144
61 3300048915 Ga0496112_0763421 Ga0496112_0763421_402_836 144
62 3300048916 Ga0496113_0000481 Ga0496113_0000481_18101_18535 144
63 3300005329 Ga0070683_102131417 Ga0070683_1021314171 145
64 3300005338 Ga0068868_101280560 Ga0068868_1012805601 145
65 3300005436 Ga0070713_100357314 Ga0070713_1003573141 145
66 3300005466 Ga0070685_10474545 Ga0070685_104745452 145
67 3300005548 Ga0070665_100461108 Ga0070665_1004611082 145
68 3300005577 Ga0068857_100387988 Ga0068857_1003879881 145
69 3300006038 Ga0075365_10015619 Ga0075365_100156193 145
70 3300006048 Ga0075363_100941004 Ga0075363_1009410041 145
71 3300006051 Ga0075364_10071227 Ga0075364_100712272 145
72 3300006186 Ga0075369_10137154 Ga0075369_101371542 145
73 3300009098 Ga0105245_10123070 Ga0105245_101230702 145
74 3300009101 Ga0105247_10000178 Ga0105247_1000017844 145
75 3300009174 Ga0105241_10781865 Ga0105241_107818652 145
76 3300009177 Ga0105248_10007315 Ga0105248_100073152 145
77 3300009551 Ga0105238_11305256 Ga0105238_113052561 145
78 3300011119 Ga0105246_11903516 Ga0105246_119035161 145
79 3300013306 Ga0163162_10706108 Ga0163162_107061082 145
80 3300014968 Ga0157379_10009932 Ga0157379_100099329 145
81 3300014969 Ga0157376_10305068 Ga0157376_103050681 145
82 3300025929 Ga0207664_11570252 Ga0207664_115702521 145
83 3300025944 Ga0207661_11754810 Ga0207661_117548102 145
84 3300026023 Ga0207677_11401236 Ga0207677_114012361 145
85 3300028666 Ga0265336_10003716 Ga0265336_100037163 145
86 3300028786 Ga0307517_10042614 Ga0307517_100426144 145
87 3300028794 Ga0307515_10236659 Ga0307515_102366592 145
88 3300028800 Ga0265338_10011151 Ga0265338_100111514 145
89 3300031456 Ga0307513_10007598 Ga0307513_100075987 145
90 3300031548 Ga0307408_100126425 Ga0307408_1001264254 145
91 3300031852 Ga0307410_10534364 Ga0307410_105343642 145
92 3300031901 Ga0307406_10029544 Ga0307406_100295444 145
93 3300031903 Ga0307407_10069595 Ga0307407_100695952 145
94 3300031911 Ga0307412_11089890 Ga0307412_110898901 145
95 3300032002 Ga0307416_100019395 Ga0307416_1000193954 145
96 3300032126 Ga0307415_100010281 Ga0307415_1000102816 145
97 3300041512 Ga0451853_2289717 Ga0451853_2289717_266_706 145
98 3300044656 Ga0466969_0208295 Ga0466969_0208295_172_612 145
99 3300044684 Ga0466966_0031433 Ga0466966_0031433_2375_2815 145
100 3300044694 Ga0466963_0035750 Ga0466963_0035750_1093_1533 145
101 3300044735 Ga0466968_0281793 Ga0466968_0281793_35_472 145
102 3300045976 Ga0466967_0013586 Ga0466967_0013586_2823_3263 145
103 3300045976 Ga0466967_0409075 Ga0466967_0409075_25_462 145
104 3300045976 Ga0466967_0805672 Ga0466967_0805672_179_616 145
105 3300045976 Ga0466967_1252127 Ga0466967_1252127_52_489 145
106 3300046460 Ga0495638_0040373 Ga0495638_0040373_330_767 145
107 3300046476 Ga0495662_0163556 Ga0495662_0163556_206_643 145
108 3300046511 Ga0495608_0445525 Ga0495608_0445525_205_642 145
109 3300046531 Ga0495665_0080640 Ga0495665_0080640_725_1162 145
110 3300046536 Ga0495587_0303226 Ga0495587_0303226_109_546 145
111 3300046683 Ga0495658_0742803 Ga0495658_0742803_135_572 145
112 3300047317 Ga0495604_0725119 Ga0495604_0725119_12_449 145
113 3300048088 Ga0495602_0721107 Ga0495602_0721107_134_661 145
114 3300048903 Ga0496100_0384966 Ga0496100_0384966_294_731 145
115 3300048903 Ga0496100_0476213 Ga0496100_0476213_475_912 145
116 3300048903 Ga0496100_0616133 Ga0496100_0616133_94_531 145
117 3300048904 Ga0496101_0422942 Ga0496101_0422942_153_590 145
118 3300048905 Ga0496102_0037090 Ga0496102_0037090_3635_4072 145
119 3300048905 Ga0496102_1623856 Ga0496102_1623856_54_500 145
120 3300048907 Ga0496104_0000672 Ga0496104_0000672_26655_27092 145
121 3300048907 Ga0496104_0215608 Ga0496104_0215608_60_500 145
122 3300048907 Ga0496104_0455758 Ga0496104_0455758_196_633 145
123 3300048907 Ga0496104_0470792 Ga0496104_0470792_699_1136 145
124 3300048907 Ga0496104_0913417 Ga0496104_0913417_189_626 145
125 3300048908 Ga0496105_0070081 Ga0496105_0070081_2320_2757 145
126 3300048911 Ga0496108_0013001 Ga0496108_0013001_169_606 145
127 3300048911 Ga0496108_0026492 Ga0496108_0026492_4130_4570 145
128 3300048911 Ga0496108_0141874 Ga0496108_0141874_1079_1516 145
129 3300048911 Ga0496108_0167033 Ga0496108_0167033_355_792 145
130 3300048912 Ga0496109_0001605 Ga0496109_0001605_4007_4444 145
131 3300048912 Ga0496109_0033495 Ga0496109_0033495_158_598 145
132 3300048912 Ga0496109_0190134 Ga0496109_0190134_523_960 145
133 3300048912 Ga0496109_0285342 Ga0496109_0285342_1024_1461 145
134 3300048913 Ga0496110_0003786 Ga0496110_0003786_10934_11371 145
135 3300048913 Ga0496110_0056564 Ga0496110_0056564_2339_2776 145
136 3300048913 Ga0496110_0100686 Ga0496110_0100686_1883_2323 145
137 3300048914 Ga0496111_0155726 Ga0496111_0155726_300_737 145
138 3300048914 Ga0496111_0455696 Ga0496111_0455696_188_628 145
139 3300048915 Ga0496112_0003367 Ga0496112_0003367_9281_9721 145
140 3300048915 Ga0496112_0532420 Ga0496112_0532420_503_940 145
141 3300048916 Ga0496113_0028291 Ga0496113_0028291_3229_3669 145
142 3300048916 Ga0496113_0465287 Ga0496113_0465287_563_1000 145
143 3300048917 Ga0496114_0024763 Ga0496114_0024763_861_1298 145
144 3300048917 Ga0496114_0145542 Ga0496114_0145542_373_810 145
145 3300048918 Ga0496115_0033380 Ga0496115_0033380_2780_3217 145
146 3300048918 Ga0496115_0696981 Ga0496115_0696981_347_784 145
147 3300048922 Ga0496119_0001634 Ga0496119_0001634_8966_9526 145
148 3300048922 Ga0496119_0439828 Ga0496119_0439828_34_471 145
149 3300048923 Ga0496120_0000203 Ga0496120_0000203_92410_92970 145
150 3300048929 Ga0496126_0104599 Ga0496126_0104599_894_1331 145
151 3300048929 Ga0496126_0867474 Ga0496126_0867474_23_460 145
152 3300049586 Ga0501070_0197944 Ga0501070_0197944_933_1370 145
153 3300050490 nmdc:mga03n38_866344_c1 nmdc:mga03n38_866344_c1_55_504 145
154 3300050491 nmdc:mga00v17_311709_c1 nmdc:mga00v17_311709_c1_350_799 145
155 3300050491 nmdc:mga00v17_36772_c1 nmdc:mga00v17_36772_c1_2034_2483 145
156 3300050492 nmdc:mga0yw44_113814_c1 nmdc:mga0yw44_113814_c1_1070_1519 145
157 3300053078 Ga0495612_0191720 Ga0495612_0191720_317_754 145
158 3300053151 Ga0500604_0016559 Ga0500604_0016559_62_499 145
159 3300053153 Ga0500616_0015627 Ga0500616_0015627_49_486 145
160 iso_pu_bacteria 2579778521 2579852529 145
161 iso_pu_bacteria 2619618881 2619856392 145
162 iso_pu_bacteria 2619619003 2620347999 145
163 iso_pu_bacteria 2626541554 2626638527 145
164 iso_pu_bacteria 8054913762 8054920599 145
165 iso_pu_bacteria 8054920844 8054926578 145
166 3300005365 Ga0070688_100540868 Ga0070688_1005408681 146
167 3300005467 Ga0070706_100587810 Ga0070706_1005878102 146
168 3300005471 Ga0070698_101685308 Ga0070698_1016853082 146
169 3300005548 Ga0070665_100059533 Ga0070665_1000595333 146
170 3300005614 Ga0068856_100004865 Ga0068856_1000048656 146
171 3300005616 Ga0068852_101771922 Ga0068852_1017719221 146
172 3300006038 Ga0075365_10227436 Ga0075365_102274361 146
173 3300006038 Ga0075365_10567653 Ga0075365_105676532 146
174 3300009093 Ga0105240_10017249 Ga0105240_100172499 146
175 3300009093 Ga0105240_11631791 Ga0105240_116317912 146
176 3300009545 Ga0105237_10005813 Ga0105237_100058134 146
177 3300010375 Ga0105239_10013580 Ga0105239_100135805 146
178 3300014969 Ga0157376_10193219 Ga0157376_101932191 146
179 3300025913 Ga0207695_10017640 Ga0207695_100176404 146
180 3300025913 Ga0207695_10133153 Ga0207695_101331532 146
181 3300026078 Ga0207702_10005011 Ga0207702_100050116 146
182 3300028379 Ga0268266_10189338 Ga0268266_101893382 146
183 3300031711 Ga0265314_10389809 Ga0265314_103898091 146
184 3300037068 Ga0373925_0005890 Ga0373925_0005890_8241_8681 146
185 3300045976 Ga0466967_1363013 Ga0466967_1363013_133_582 146
186 3300046455 Ga0495603_0112621 Ga0495603_0112621_623_1063 146
187 3300046462 Ga0495651_0068995 Ga0495651_0068995_1520_1960 146
188 3300046463 Ga0495653_0387296 Ga0495653_0387296_410_850 146
189 3300046477 Ga0495664_0206828 Ga0495664_0206828_446_886 146
190 3300046499 Ga0495594_0361818 Ga0495594_0361818_348_788 146
191 3300046511 Ga0495608_0649549 Ga0495608_0649549_175_615 146
192 3300046529 Ga0495652_0160853 Ga0495652_0160853_1226_1666 146
193 3300046533 Ga0495640_0175606 Ga0495640_0175606_188_628 146
194 3300046559 Ga0495667_0119815 Ga0495667_0119815_836_1276 146
195 3300046642 Ga0495634_0044910 Ga0495634_0044910_1814_2254 146
196 3300046663 Ga0495635_0005944 Ga0495635_0005944_1245_1685 146
197 3300046675 Ga0495657_0019023 Ga0495657_0019023_3644_4084 146
198 3300046675 Ga0495657_0447062 Ga0495657_0447062_258_698 146
199 3300046689 Ga0495613_0037167 Ga0495613_0037167_2549_2989 146
200 3300046690 Ga0495624_0231630 Ga0495624_0231630_621_1061 146
201 3300046809 Ga0495600_0542182 Ga0495600_0542182_221_661 146
202 3300047317 Ga0495604_0162893 Ga0495604_0162893_144_584 146
203 3300047321 Ga0495676_0027314 Ga0495676_0027314_1893_2333 146
204 3300047321 Ga0495676_0852769 Ga0495676_0852769_80_523 146
205 3300048905 Ga0496102_0865657 Ga0496102_0865657_192_632 146
206 3300048913 Ga0496110_1421049 Ga0496110_1421049_120_563 146
207 3300048915 Ga0496112_0444951 Ga0496112_0444951_282_752 146
208 3300049569 Ga0501032_0003933 Ga0501032_0003933_2606_3046 146
209 3300049570 Ga0501033_0928843 Ga0501033_0928843_59_499 146
210 3300049571 Ga0501034_0021567 Ga0501034_0021567_3952_4392 146
211 3300049571 Ga0501034_0576746 Ga0501034_0576746_104_556 146
212 3300049572 Ga0501036_0033912 Ga0501036_0033912_1188_1628 146
213 3300049573 Ga0501037_0000099 Ga0501037_0000099_73693_74133 146
214 3300049575 Ga0501039_0008540 Ga0501039_0008540_4382_4822 146
215 3300049576 Ga0501040_0589116 Ga0501040_0589116_122_565 146
216 3300049577 Ga0501041_0666785 Ga0501041_0666785_87_527 146
217 3300049579 Ga0501043_0000228 Ga0501043_0000228_35189_35629 146
218 3300049583 Ga0501067_0277294 Ga0501067_0277294_71_511 146
219 3300049584 Ga0501068_0142958 Ga0501068_0142958_1036_1476 146
220 3300049586 Ga0501070_0020965 Ga0501070_0020965_4487_4927 146
221 3300049587 Ga0501071_0336612 Ga0501071_0336612_313_753 146
222 3300049589 Ga0501073_0397299 Ga0501073_0397299_239_679 146
223 3300049823 Ga0501044_0014552 Ga0501044_0014552_7439_7879 146
224 3300050492 nmdc:mga0yw44_818969_c1 nmdc:mga0yw44_818969_c1_171_614 146
225 3300050516 nmdc:mga0sz30_169013_c1 nmdc:mga0sz30_169013_c1_160_603 146
226 3300002067 JGI24735J21928_10140460 JGI24735J21928_101404602 147
227 3300002070 JGI24750J21931_1032422 JGI24750J21931_10324222 147
228 3300002075 JGI24738J21930_10012597 JGI24738J21930_100125972 147
229 3300002076 JGI24749J21850_1030398 JGI24749J21850_10303982 147
230 3300002077 JGI24744J21845_10000053 JGI24744J21845_100000537 147
231 3300002077 JGI24744J21845_10006220 JGI24744J21845_100062202 147
232 3300002239 JGI24034J26672_10003514 JGI24034J26672_100035142 147
233 3300002244 JGI24742J22300_10001182 JGI24742J22300_100011823 147
234 3300002459 JGI24751J29686_10061108 JGI24751J29686_100611081 147
235 3300005328 Ga0070676_10222942 Ga0070676_102229422 147
236 3300005330 Ga0070690_100001292 Ga0070690_1000012928 147
237 3300005334 Ga0068869_100012633 Ga0068869_1000126333 147
238 3300005336 Ga0070680_100651411 Ga0070680_1006514111 147
239 3300005337 Ga0070682_100001916 Ga0070682_1000019169 147
240 3300005337 Ga0070682_100199624 Ga0070682_1001996242 147
241 3300005337 Ga0070682_101893979 Ga0070682_1018939791 147
242 3300005338 Ga0068868_100009639 Ga0068868_1000096397 147
243 3300005338 Ga0068868_100101718 Ga0068868_1001017182 147
244 3300005340 Ga0070689_100018207 Ga0070689_1000182075 147
245 3300005341 Ga0070691_10001466 Ga0070691_100014665 147
246 3300005343 Ga0070687_100889533 Ga0070687_1008895331 147
247 3300005347 Ga0070668_100000358 Ga0070668_10000035821 147
248 3300005347 Ga0070668_100364680 Ga0070668_1003646802 147
249 3300005347 Ga0070668_101893035 Ga0070668_1018930351 147
250 3300005353 Ga0070669_100001662 Ga0070669_1000016625 147
251 3300005353 Ga0070669_100008249 Ga0070669_1000082492 147
252 3300005353 Ga0070669_100168239 Ga0070669_1001682392 147
253 3300005356 Ga0070674_100003807 Ga0070674_1000038079 147
254 3300005356 Ga0070674_100995792 Ga0070674_1009957921 147
255 3300005365 Ga0070688_100002128 Ga0070688_1000021287 147
256 3300005365 Ga0070688_100027921 Ga0070688_1000279213 147
257 3300005365 Ga0070688_101148189 Ga0070688_1011481891 147
258 3300005365 Ga0070688_101408464 Ga0070688_1014084641 147
259 3300005366 Ga0070659_100063532 Ga0070659_1000635321 147
260 3300005367 Ga0070667_100000075 Ga0070667_10000007537 147
261 3300005367 Ga0070667_100004048 Ga0070667_1000040489 147
262 3300005367 Ga0070667_100012854 Ga0070667_1000128545 147
263 3300005367 Ga0070667_100164775 Ga0070667_1001647754 147
264 3300005434 Ga0070709_10005095 Ga0070709_100050951 147
265 3300005434 Ga0070709_10046065 Ga0070709_100460654 147
266 3300005434 Ga0070709_10345451 Ga0070709_103454512 147
267 3300005436 Ga0070713_100552816 Ga0070713_1005528161 147
268 3300005436 Ga0070713_100601013 Ga0070713_1006010132 147
269 3300005437 Ga0070710_10001540 Ga0070710_100015402 147
270 3300005438 Ga0070701_10004264 Ga0070701_100042646 147
271 3300005439 Ga0070711_100001591 Ga0070711_1000015918 147
272 3300005439 Ga0070711_100063796 Ga0070711_1000637963 147
273 3300005440 Ga0070705_100025323 Ga0070705_1000253232 147
274 3300005440 Ga0070705_100087384 Ga0070705_1000873842 147
275 3300005441 Ga0070700_100014110 Ga0070700_1000141105 147
276 3300005441 Ga0070700_100022565 Ga0070700_1000225654 147
277 3300005444 Ga0070694_100018714 Ga0070694_1000187147 147
278 3300005445 Ga0070708_100981774 Ga0070708_1009817742 147
279 3300005455 Ga0070663_100002640 Ga0070663_1000026407 147
280 3300005455 Ga0070663_101339023 Ga0070663_1013390231 147
281 3300005456 Ga0070678_100001197 Ga0070678_1000011973 147
282 3300005457 Ga0070662_100010769 Ga0070662_1000107697 147
283 3300005457 Ga0070662_100297193 Ga0070662_1002971932 147
284 3300005458 Ga0070681_10885179 Ga0070681_108851792 147
285 3300005459 Ga0068867_100006287 Ga0068867_1000062873 147
286 3300005459 Ga0068867_100199654 Ga0068867_1001996542 147
287 3300005466 Ga0070685_10057771 Ga0070685_100577713 147
288 3300005535 Ga0070684_100272673 Ga0070684_1002726732 147
289 3300005539 Ga0068853_100051687 Ga0068853_1000516875 147
290 3300005539 Ga0068853_100064641 Ga0068853_1000646413 147
291 3300005543 Ga0070672_100188078 Ga0070672_1001880783 147
292 3300005545 Ga0070695_100040554 Ga0070695_1000405544 147
293 3300005546 Ga0070696_100003435 Ga0070696_1000034357 147
294 3300005547 Ga0070693_100032667 Ga0070693_1000326675 147
295 3300005547 Ga0070693_100122157 Ga0070693_1001221572 147
296 3300005548 Ga0070665_100005474 Ga0070665_1000054748 147
297 3300005548 Ga0070665_100006380 Ga0070665_1000063807 147
298 3300005548 Ga0070665_100259269 Ga0070665_1002592693 147
299 3300005549 Ga0070704_100000391 Ga0070704_10000039115 147
300 3300005549 Ga0070704_100036324 Ga0070704_1000363244 147
301 3300005563 Ga0068855_100113289 Ga0068855_1001132893 147
302 3300005578 Ga0068854_100004672 Ga0068854_1000046728 147
303 3300005615 Ga0070702_100001144 Ga0070702_10000114410 147
304 3300005615 Ga0070702_100073894 Ga0070702_1000738941 147
305 3300005616 Ga0068852_101437779 Ga0068852_1014377791 147
306 3300005617 Ga0068859_100000606 Ga0068859_10000060617 147
307 3300005617 Ga0068859_100003251 Ga0068859_1000032517 147
308 3300005617 Ga0068859_100571564 Ga0068859_1005715642 147
309 3300005617 Ga0068859_100859037 Ga0068859_1008590372 147
310 3300005618 Ga0068864_100622399 Ga0068864_1006223992 147
311 3300005718 Ga0068866_10002931 Ga0068866_100029312 147
312 3300005718 Ga0068866_10069786 Ga0068866_100697863 147
313 3300005719 Ga0068861_100120570 Ga0068861_1001205702 147
314 3300005719 Ga0068861_100374854 Ga0068861_1003748541 147
315 3300005841 Ga0068863_100465112 Ga0068863_1004651122 147
316 3300005842 Ga0068858_100001109 Ga0068858_1000011097 147
317 3300005842 Ga0068858_100073000 Ga0068858_1000730003 147
318 3300005842 Ga0068858_101752370 Ga0068858_1017523701 147
319 3300005843 Ga0068860_100000025 Ga0068860_100000025152 147
320 3300005843 Ga0068860_100012429 Ga0068860_1000124299 147
321 3300005843 Ga0068860_100801985 Ga0068860_1008019852 147
322 3300005844 Ga0068862_100000045 Ga0068862_100000045152 147
323 3300005844 Ga0068862_100001869 Ga0068862_10000186912 147
324 3300005844 Ga0068862_100186010 Ga0068862_1001860103 147
325 3300005844 Ga0068862_100290319 Ga0068862_1002903192 147
326 3300005844 Ga0068862_102535226 Ga0068862_1025352261 147
327 3300005937 Ga0081455_10039741 Ga0081455_100397415 147
328 3300005937 Ga0081455_10093207 Ga0081455_100932073 147
329 3300005981 Ga0081538_10043770 Ga0081538_100437703 147
330 3300005981 Ga0081538_10185021 Ga0081538_101850212 147
331 3300005983 Ga0081540_1119893 Ga0081540_11198931 147
332 3300006038 Ga0075365_10531100 Ga0075365_105311002 147
333 3300006042 Ga0075368_10392240 Ga0075368_103922402 147
334 3300006048 Ga0075363_100030212 Ga0075363_1000302122 147
335 3300006048 Ga0075363_100184374 Ga0075363_1001843742 147
336 3300006051 Ga0075364_10004468 Ga0075364_100044683 147
337 3300006051 Ga0075364_10005113 Ga0075364_100051132 147
338 3300006051 Ga0075364_10018231 Ga0075364_100182316 147
339 3300006051 Ga0075364_10240055 Ga0075364_102400552 147
340 3300006051 Ga0075364_10433492 Ga0075364_104334921 147
341 3300006173 Ga0070716_100001115 Ga0070716_1000011157 147
342 3300006173 Ga0070716_100013982 Ga0070716_1000139823 147
343 3300006173 Ga0070716_100047642 Ga0070716_1000476424 147
344 3300006173 Ga0070716_100575181 Ga0070716_1005751812 147
345 3300006175 Ga0070712_100003721 Ga0070712_1000037212 147
346 3300006175 Ga0070712_100040073 Ga0070712_1000400732 147
347 3300006177 Ga0075362_10008504 Ga0075362_100085042 147
348 3300006177 Ga0075362_10279148 Ga0075362_102791481 147
349 3300006178 Ga0075367_10360500 Ga0075367_103605002 147
350 3300006186 Ga0075369_10004473 Ga0075369_100044734 147
351 3300006186 Ga0075369_10013887 Ga0075369_100138874 147
352 3300006186 Ga0075369_10058110 Ga0075369_100581102 147
353 3300006186 Ga0075369_10112024 Ga0075369_101120242 147
354 3300006186 Ga0075369_10138554 Ga0075369_101385543 147
355 3300006237 Ga0097621_100190034 Ga0097621_1001900342 147
356 3300006353 Ga0075370_10002478 Ga0075370_100024788 147
357 3300006353 Ga0075370_10206688 Ga0075370_102066882 147
358 3300006353 Ga0075370_10443772 Ga0075370_104437722 147
359 3300006358 Ga0068871_100174587 Ga0068871_1001745873 147
360 3300006358 Ga0068871_100205001 Ga0068871_1002050012 147
361 3300006844 Ga0075428_100004846 Ga0075428_1000048466 147
362 3300006846 Ga0075430_100280293 Ga0075430_1002802932 147
363 3300006847 Ga0075431_100009857 Ga0075431_1000098572 147
364 3300006880 Ga0075429_100156557 Ga0075429_1001565573 147
365 3300006881 Ga0068865_100172714 Ga0068865_1001727143 147
366 3300006931 Ga0097620_100000606 Ga0097620_10000060617 147
367 3300006931 Ga0097620_100003251 Ga0097620_1000032517 147
368 3300006931 Ga0097620_100571680 Ga0097620_1005716802 147
369 3300006931 Ga0097620_100859134 Ga0097620_1008591342 147
370 3300007788 Ga0099795_10007788 Ga0099795_100077882 147
371 3300009011 Ga0105251_10180661 Ga0105251_101806612 147
372 3300009036 Ga0105244_10252061 Ga0105244_102520612 147
373 3300009092 Ga0105250_10056101 Ga0105250_100561013 147
374 3300009093 Ga0105240_12743192 Ga0105240_127431921 147
375 3300009094 Ga0111539_10498934 Ga0111539_104989342 147
376 3300009094 Ga0111539_11906128 Ga0111539_119061282 147
377 3300009098 Ga0105245_10002903 Ga0105245_1000290315 147
378 3300009098 Ga0105245_10692525 Ga0105245_106925251 147
379 3300009098 Ga0105245_11198151 Ga0105245_111981512 147
380 3300009101 Ga0105247_10000010 Ga0105247_10000010182 147
381 3300009101 Ga0105247_10000366 Ga0105247_1000036632 147
382 3300009101 Ga0105247_10825515 Ga0105247_108255151 147
383 3300009147 Ga0114129_10005689 Ga0114129_1000568916 147
384 3300009147 Ga0114129_10261011 Ga0114129_102610112 147
385 3300009148 Ga0105243_10001450 Ga0105243_1000145014 147
386 3300009148 Ga0105243_10060285 Ga0105243_100602854 147
387 3300009174 Ga0105241_10214778 Ga0105241_102147781 147
388 3300009176 Ga0105242_10004714 Ga0105242_100047143 147
389 3300009176 Ga0105242_10149393 Ga0105242_101493933 147
390 3300009177 Ga0105248_10000145 Ga0105248_1000014550 147
391 3300009177 Ga0105248_10002194 Ga0105248_1000219412 147
392 3300009177 Ga0105248_10772473 Ga0105248_107724732 147
393 3300009545 Ga0105237_10025835 Ga0105237_100258356 147
394 3300009545 Ga0105237_10513643 Ga0105237_105136431 147
395 3300009551 Ga0105238_10611824 Ga0105238_106118242 147
396 3300009553 Ga0105249_10000010 Ga0105249_10000010177 147
397 3300009553 Ga0105249_10007809 Ga0105249_100078098 147
398 3300009553 Ga0105249_10699719 Ga0105249_106997192 147
399 3300010159 Ga0099796_10009296 Ga0099796_100092961 147
400 3300010375 Ga0105239_10152069 Ga0105239_101520693 147
401 3300010375 Ga0105239_11238379 Ga0105239_112383792 147
402 3300013105 Ga0157369_10253713 Ga0157369_102537132 147
403 3300013297 Ga0157378_10001442 Ga0157378_1000144211 147
404 3300013306 Ga0163162_10002768 Ga0163162_100027689 147
405 3300013306 Ga0163162_10078462 Ga0163162_100784624 147
406 3300013306 Ga0163162_10121125 Ga0163162_101211251 147
407 3300013306 Ga0163162_12288308 Ga0163162_122883081 147
408 3300013307 Ga0157372_10009077 Ga0157372_100090777 147
409 3300013308 Ga0157375_10001272 Ga0157375_1000127215 147
410 3300014325 Ga0163163_10010065 Ga0163163_100100658 147
411 3300014325 Ga0163163_11008132 Ga0163163_110081322 147
412 3300014326 Ga0157380_10000302 Ga0157380_1000030222 147
413 3300014969 Ga0157376_11953511 Ga0157376_119535111 147
414 3300017792 Ga0163161_10000799 Ga0163161_1000079912 147
415 3300017792 Ga0163161_10294140 Ga0163161_102941402 147
416 3300021384 Ga0213876_10003078 Ga0213876_100030782 147
417 3300021384 Ga0213876_10129432 Ga0213876_101294322 147
418 3300021384 Ga0213876_10156916 Ga0213876_101569162 147
419 3300021388 Ga0213875_10041041 Ga0213875_100410413 147
420 3300021441 Ga0213871_10118423 Ga0213871_101184232 147
421 3300025711 Ga0207696_1061230 Ga0207696_10612302 147
422 3300025893 Ga0207682_10044059 Ga0207682_100440592 147
423 3300025898 Ga0207692_10030153 Ga0207692_100301532 147
424 3300025899 Ga0207642_10000143 Ga0207642_1000014314 147
425 3300025899 Ga0207642_10011054 Ga0207642_100110544 147
426 3300025900 Ga0207710_10000028 Ga0207710_10000028184 147
427 3300025900 Ga0207710_10001961 Ga0207710_100019619 147
428 3300025901 Ga0207688_10000090 Ga0207688_1000009028 147
429 3300025903 Ga0207680_10027001 Ga0207680_100270014 147
430 3300025904 Ga0207647_10069287 Ga0207647_100692874 147
431 3300025905 Ga0207685_10005331 Ga0207685_100053313 147
432 3300025905 Ga0207685_10103693 Ga0207685_101036932 147
433 3300025906 Ga0207699_10012071 Ga0207699_100120714 147
434 3300025906 Ga0207699_10563510 Ga0207699_105635102 147
435 3300025907 Ga0207645_10027091 Ga0207645_100270912 147
436 3300025912 Ga0207707_10762461 Ga0207707_107624612 147
437 3300025915 Ga0207693_10000555 Ga0207693_100005557 147
438 3300025915 Ga0207693_10002064 Ga0207693_100020648 147
439 3300025916 Ga0207663_10002170 Ga0207663_100021709 147
440 3300025916 Ga0207663_10016673 Ga0207663_100166734 147
441 3300025918 Ga0207662_10354014 Ga0207662_103540142 147
442 3300025923 Ga0207681_10006072 Ga0207681_100060726 147
443 3300025923 Ga0207681_10202684 Ga0207681_102026843 147
444 3300025924 Ga0207694_10459613 Ga0207694_104596132 147
445 3300025925 Ga0207650_10539242 Ga0207650_105392422 147
446 3300025926 Ga0207659_10849746 Ga0207659_108497462 147
447 3300025927 Ga0207687_10158624 Ga0207687_101586242 147
448 3300025927 Ga0207687_10640379 Ga0207687_106403791 147
449 3300025928 Ga0207700_10485984 Ga0207700_104859842 147
450 3300025928 Ga0207700_10909935 Ga0207700_109099352 147
451 3300025929 Ga0207664_10297450 Ga0207664_102974503 147
452 3300025931 Ga0207644_10100117 Ga0207644_101001173 147
453 3300025931 Ga0207644_10117672 Ga0207644_101176723 147
454 3300025932 Ga0207690_10032665 Ga0207690_100326655 147
455 3300025933 Ga0207706_10005251 Ga0207706_100052517 147
456 3300025933 Ga0207706_10016540 Ga0207706_100165405 147
457 3300025934 Ga0207686_10001099 Ga0207686_100010999 147
458 3300025934 Ga0207686_10006362 Ga0207686_100063627 147
459 3300025935 Ga0207709_10002258 Ga0207709_100022589 147
460 3300025935 Ga0207709_10700053 Ga0207709_107000532 147
461 3300025936 Ga0207670_10029755 Ga0207670_100297553 147
462 3300025937 Ga0207669_10000752 Ga0207669_1000075210 147
463 3300025938 Ga0207704_10000393 Ga0207704_100003936 147
464 3300025938 Ga0207704_10142440 Ga0207704_101424401 147
465 3300025939 Ga0207665_10001801 Ga0207665_1000180110 147
466 3300025939 Ga0207665_10003000 Ga0207665_100030007 147
467 3300025939 Ga0207665_10085661 Ga0207665_100856612 147
468 3300025939 Ga0207665_10142723 Ga0207665_101427232 147
469 3300025940 Ga0207691_10093942 Ga0207691_100939425 147
470 3300025940 Ga0207691_10309885 Ga0207691_103098852 147
471 3300025941 Ga0207711_10000069 Ga0207711_1000006922 147
472 3300025941 Ga0207711_10019795 Ga0207711_100197952 147
473 3300025942 Ga0207689_10022958 Ga0207689_100229582 147
474 3300025944 Ga0207661_10096794 Ga0207661_100967944 147
475 3300025949 Ga0207667_10380315 Ga0207667_103803152 147
476 3300025961 Ga0207712_10000016 Ga0207712_10000016178 147
477 3300025961 Ga0207712_10046835 Ga0207712_100468355 147
478 3300025972 Ga0207668_10005693 Ga0207668_100056934 147
479 3300025972 Ga0207668_10178951 Ga0207668_101789512 147
480 3300025972 Ga0207668_10276815 Ga0207668_102768153 147
481 3300025986 Ga0207658_10000237 Ga0207658_1000023719 147
482 3300025986 Ga0207658_10002082 Ga0207658_1000208210 147
483 3300025986 Ga0207658_10024434 Ga0207658_100244347 147
484 3300026023 Ga0207677_10003455 Ga0207677_100034553 147
485 3300026023 Ga0207677_10105422 Ga0207677_101054224 147
486 3300026035 Ga0207703_10011384 Ga0207703_100113842 147
487 3300026035 Ga0207703_10044415 Ga0207703_100444153 147
488 3300026035 Ga0207703_11766733 Ga0207703_117667332 147
489 3300026041 Ga0207639_10003107 Ga0207639_100031075 147
490 3300026067 Ga0207678_10011227 Ga0207678_100112276 147
491 3300026067 Ga0207678_10013849 Ga0207678_100138493 147
492 3300026075 Ga0207708_10006978 Ga0207708_100069788 147
493 3300026078 Ga0207702_10724634 Ga0207702_107246342 147
494 3300026088 Ga0207641_10025646 Ga0207641_100256462 147
495 3300026089 Ga0207648_10000349 Ga0207648_1000034925 147
496 3300026089 Ga0207648_10027211 Ga0207648_100272116 147
497 3300026095 Ga0207676_10094326 Ga0207676_100943263 147
498 3300026118 Ga0207675_100006409 Ga0207675_10000640910 147
499 3300026121 Ga0207683_10000040 Ga0207683_1000004056 147
500 3300026121 Ga0207683_11097728 Ga0207683_110977281 147
501 3300026142 Ga0207698_12171651 Ga0207698_121716511 147
502 3300028379 Ga0268266_10002967 Ga0268266_100029672 147
503 3300028379 Ga0268266_10005675 Ga0268266_100056757 147
504 3300028379 Ga0268266_10036703 Ga0268266_100367035 147
505 3300028379 Ga0268266_10681904 Ga0268266_106819041 147
506 3300028380 Ga0268265_10000056 Ga0268265_10000056146 147
507 3300028380 Ga0268265_10005589 Ga0268265_100055895 147
508 3300028380 Ga0268265_10154149 Ga0268265_101541492 147
509 3300028380 Ga0268265_10353054 Ga0268265_103530542 147
510 3300028381 Ga0268264_10000053 Ga0268264_10000053176 147
511 3300028381 Ga0268264_10208375 Ga0268264_102083752 147
512 3300028381 Ga0268264_10225825 Ga0268264_102258252 147
513 3300031852 Ga0307410_10958689 Ga0307410_109586892 147
514 3300031995 Ga0307409_101011214 Ga0307409_1010112141 147
515 3300032002 Ga0307416_102929544 Ga0307416_1029295441 147
516 3300034819 Ga0373958_0005189 Ga0373958_0005189_1159_1602 147
517 3300034957 Ga0373938_0163331 Ga0373938_0163331_21_464 147
518 3300035090 Ga0373949_0029246 Ga0373949_0029246_220_663 147
519 3300035090 Ga0373949_0242939 Ga0373949_0242939_86_529 147
520 3300035112 Ga0373932_0317409 Ga0373932_0317409_38_481 147
521 3300035114 Ga0373939_0022264 Ga0373939_0022264_269_712 147
522 3300035115 Ga0373941_0182084 Ga0373941_0182084_97_540 147
523 3300035207 Ga0373942_0082233 Ga0373942_0082233_424_867 147
524 3300035691 Ga0373931_0045619 Ga0373931_0045619_128_571 147
525 3300035691 Ga0373931_0093273 Ga0373931_0093273_1081_1524 147
526 3300037418 Ga0395900_0016131 Ga0395900_0016131_350_796 147
527 3300037418 Ga0395900_0073852 Ga0395900_0073852_2628_3071 147
528 3300037466 Ga0395898_0203199 Ga0395898_0203199_1092_1538 147
529 3300037853 Ga0436364_0171371 Ga0436364_0171371_676_1119 147
530 3300037853 Ga0436364_0329205 Ga0436364_0329205_1407_1850 147
531 3300037853 Ga0436364_0604589 Ga0436364_0604589_5402_5845 147
532 3300037853 Ga0436364_0928958 Ga0436364_0928958_566_1009 147
533 3300039437 Ga0436365_0329583 Ga0436365_0329583_33098_33541 147
534 3300039437 Ga0436365_0465547 Ga0436365_0465547_1082_1525 147
535 3300039437 Ga0436365_1490253 Ga0436365_1490253_2051_2494 147
536 3300039438 Ga0436360_0763556 Ga0436360_0763556_367_810 147
537 3300039450 Ga0436363_0002351 Ga0436363_0002351_13_456 147
538 3300039450 Ga0436363_1381948 Ga0436363_1381948_452_895 147
539 3300041411 Ga0439466_0005991 Ga0439466_0005991_876_1319 147
540 3300041411 Ga0439466_0007929 Ga0439466_0007929_913_1356 147
541 3300041413 Ga0439465_0000439 Ga0439465_0000439_7786_8229 147
542 3300041413 Ga0439465_0004076 Ga0439465_0004076_1531_1974 147
543 3300041413 Ga0439465_0030810 Ga0439465_0030810_541_984 147
544 3300041507 Ga0451851_0694353 Ga0451851_0694353_33_476 147
545 3300041512 Ga0451853_3770463 Ga0451853_3770463_75_518 147
546 3300041997 Ga0439431_0001548 Ga0439431_0001548_2147_2590 147
547 3300042002 Ga0439442_007871 Ga0439442_007871_276_719 147
548 3300042435 Ga0439434_0134917 Ga0439434_0134917_17_460 147
549 3300042436 Ga0439435_0059908 Ga0439435_0059908_205_648 147
550 3300044658 Ga0466972_0252989 Ga0466972_0252989_205_648 147
551 3300044683 Ga0466965_0034243 Ga0466965_0034243_592_1035 147
552 3300044684 Ga0466966_0276626 Ga0466966_0276626_345_788 147
553 3300044693 Ga0466961_0094341 Ga0466961_0094341_868_1311 147
554 3300044693 Ga0466961_0296851 Ga0466961_0296851_333_776 147
555 3300044694 Ga0466963_0033323 Ga0466963_0033323_96_539 147
556 3300044694 Ga0466963_0090128 Ga0466963_0090128_913_1356 147
557 3300044694 Ga0466963_0233391 Ga0466963_0233391_466_942 147
558 3300044706 Ga0466964_0140355 Ga0466964_0140355_595_1038 147
559 3300044719 Ga0466971_0026763 Ga0466971_0026763_982_1425 147
560 3300044719 Ga0466971_0032310 Ga0466971_0032310_1018_1461 147
561 3300044719 Ga0466971_0058338 Ga0466971_0058338_955_1398 147
562 3300044735 Ga0466968_0008896 Ga0466968_0008896_1383_1826 147
563 3300044765 Ga0466970_0078052 Ga0466970_0078052_1181_1624 147
564 3300044765 Ga0466970_0423686 Ga0466970_0423686_223_666 147
565 3300044765 Ga0466970_0437885 Ga0466970_0437885_180_635 147
566 3300044765 Ga0466970_0547205 Ga0466970_0547205_117_560 147
567 3300044842 Ga0466957_0049815 Ga0466957_0049815_616_1059 147
568 3300044842 Ga0466957_0236789 Ga0466957_0236789_120_563 147
569 3300044901 Ga0466960_0011745 Ga0466960_0011745_3097_3540 147
570 3300044901 Ga0466960_0061867 Ga0466960_0061867_346_789 147
571 3300045049 Ga0466959_0026324 Ga0466959_0026324_3445_3888 147
572 3300045049 Ga0466959_0072859 Ga0466959_0072859_1796_2239 147
573 3300045049 Ga0466959_0292387 Ga0466959_0292387_565_1020 147
574 3300045836 Ga0466958_0154332 Ga0466958_0154332_219_740 147
575 3300045836 Ga0466958_0260122 Ga0466958_0260122_426_869 147
576 3300045836 Ga0466958_0293888 Ga0466958_0293888_559_1002 147
577 3300045976 Ga0466967_0003093 Ga0466967_0003093_1734_2177 147
578 3300045976 Ga0466967_0023877 Ga0466967_0023877_1438_1881 147
579 3300045976 Ga0466967_0301207 Ga0466967_0301207_749_1192 147
580 3300045976 Ga0466967_0600668 Ga0466967_0600668_611_1054 147
581 3300045976 Ga0466967_0951721 Ga0466967_0951721_102_545 147
582 3300045976 Ga0466967_1045977 Ga0466967_1045977_148_591 147
583 3300045976 Ga0466967_1073442 Ga0466967_1073442_28_471 147
584 3300045976 Ga0466967_1432110 Ga0466967_1432110_149_592 147
585 3300045976 Ga0466967_1486107 Ga0466967_1486107_49_504 147
586 3300045976 Ga0466967_2186334 Ga0466967_2186334_95_538 147
587 3300046694 Ga0495649_0154879 Ga0495649_0154879_543_986 147
588 3300047320 Ga0495672_0030035 Ga0495672_0030035_387_830 147
589 3300047320 Ga0495672_0223884 Ga0495672_0223884_462_905 147
590 3300048903 Ga0496100_0005195 Ga0496100_0005195_2004_2447 147
591 3300048903 Ga0496100_0142140 Ga0496100_0142140_1011_1454 147
592 3300048903 Ga0496100_0403034 Ga0496100_0403034_523_966 147
593 3300048904 Ga0496101_0002316 Ga0496101_0002316_4530_4973 147
594 3300048904 Ga0496101_0060971 Ga0496101_0060971_357_800 147
595 3300048904 Ga0496101_0132603 Ga0496101_0132603_399_842 147
596 3300048904 Ga0496101_0157742 Ga0496101_0157742_791_1234 147
597 3300048905 Ga0496102_0000070 Ga0496102_0000070_80654_81097 147
598 3300048905 Ga0496102_0000600 Ga0496102_0000600_5434_5877 147
599 3300048905 Ga0496102_0004697 Ga0496102_0004697_5865_6308 147
600 3300048905 Ga0496102_0008806 Ga0496102_0008806_2731_3174 147
601 3300048905 Ga0496102_0023709 Ga0496102_0023709_338_781 147
602 3300048905 Ga0496102_0076178 Ga0496102_0076178_2456_2899 147
603 3300048905 Ga0496102_0146132 Ga0496102_0146132_891_1334 147
604 3300048905 Ga0496102_0152737 Ga0496102_0152737_445_888 147
605 3300048905 Ga0496102_0409613 Ga0496102_0409613_509_952 147
606 3300048906 Ga0496103_0000477 Ga0496103_0000477_22088_22531 147
607 3300048906 Ga0496103_0000667 Ga0496103_0000667_12384_12827 147
608 3300048906 Ga0496103_0023011 Ga0496103_0023011_880_1323 147
609 3300048907 Ga0496104_0078845 Ga0496104_0078845_1353_1796 147
610 3300048907 Ga0496104_0358326 Ga0496104_0358326_626_1069 147
611 3300048907 Ga0496104_0777574 Ga0496104_0777574_73_516 147
612 3300048908 Ga0496105_0049701 Ga0496105_0049701_212_655 147
613 3300048908 Ga0496105_0696440 Ga0496105_0696440_229_672 147
614 3300048909 Ga0496106_0010257 Ga0496106_0010257_6075_6518 147
615 3300048909 Ga0496106_0130136 Ga0496106_0130136_1030_1473 147
616 3300048909 Ga0496106_0153804 Ga0496106_0153804_173_616 147
617 3300048910 Ga0496107_0002661 Ga0496107_0002661_3125_3568 147
618 3300048910 Ga0496107_0028337 Ga0496107_0028337_404_847 147
619 3300048910 Ga0496107_0047928 Ga0496107_0047928_1956_2399 147
620 3300048910 Ga0496107_0260312 Ga0496107_0260312_136_579 147
621 3300048911 Ga0496108_0353081 Ga0496108_0353081_654_1097 147
622 3300048911 Ga0496108_0518759 Ga0496108_0518759_320_763 147
623 3300048912 Ga0496109_0019118 Ga0496109_0019118_5516_5959 147
624 3300048912 Ga0496109_0233339 Ga0496109_0233339_1105_1548 147
625 3300048912 Ga0496109_1475156 Ga0496109_1475156_51_494 147
626 3300048913 Ga0496110_0130988 Ga0496110_0130988_140_583 147
627 3300048915 Ga0496112_0104600 Ga0496112_0104600_327_770 147
628 3300048915 Ga0496112_0262360 Ga0496112_0262360_651_1094 147
629 3300048915 Ga0496112_0564314 Ga0496112_0564314_532_975 147
630 3300048916 Ga0496113_0255357 Ga0496113_0255357_526_969 147
631 3300048917 Ga0496114_0001610 Ga0496114_0001610_1512_1955 147
632 3300048919 Ga0496116_0023877 Ga0496116_0023877_558_1001 147
633 3300048920 Ga0496117_0001117 Ga0496117_0001117_18020_18463 147
634 3300048920 Ga0496117_0097902 Ga0496117_0097902_474_917 147
635 3300048921 Ga0496118_0000272 Ga0496118_0000272_57778_58221 147
636 3300048921 Ga0496118_0004850 Ga0496118_0004850_11423_11866 147
637 3300048922 Ga0496119_0016323 Ga0496119_0016323_875_1318 147
638 3300048923 Ga0496120_0015370 Ga0496120_0015370_1149_1592 147
639 3300048924 Ga0496121_0002543 Ga0496121_0002543_23258_23701 147
640 3300048927 Ga0496124_0402552 Ga0496124_0402552_349_792 147
641 3300048928 Ga0496125_0010205 Ga0496125_0010205_6242_6685 147
642 3300048929 Ga0496126_0035353 Ga0496126_0035353_2115_2558 147
643 3300048929 Ga0496126_0158219 Ga0496126_0158219_1387_1839 147
644 3300049568 Ga0501031_0137044 Ga0501031_0137044_1107_1550 147
645 3300049569 Ga0501032_0009488 Ga0501032_0009488_2954_3397 147
646 3300049570 Ga0501033_0005242 Ga0501033_0005242_4634_5077 147
647 3300049571 Ga0501034_0015666 Ga0501034_0015666_6244_6687 147
648 3300049571 Ga0501034_0285927 Ga0501034_0285927_240_683 147
649 3300049571 Ga0501034_0457086 Ga0501034_0457086_59_547 147
650 3300049571 Ga0501034_1350627 Ga0501034_1350627_105_548 147
651 3300049573 Ga0501037_0011193 Ga0501037_0011193_5864_6307 147
652 3300049579 Ga0501043_0061911 Ga0501043_0061911_76_519 147
653 3300049580 Ga0501046_0011358 Ga0501046_0011358_4707_5150 147
654 3300049581 Ga0501047_0002023 Ga0501047_0002023_16767_17210 147
655 3300049581 Ga0501047_0395108 Ga0501047_0395108_243_686 147
656 3300049582 Ga0501048_0019214 Ga0501048_0019214_1673_2116 147
657 3300049585 Ga0501069_0042281 Ga0501069_0042281_1974_2417 147
658 3300049586 Ga0501070_0006875 Ga0501070_0006875_3052_3495 147
659 3300049586 Ga0501070_1180289 Ga0501070_1180289_63_506 147
660 3300049589 Ga0501073_0506825 Ga0501073_0506825_197_640 147
661 3300049742 Ga0501080_0018162 Ga0501080_0018162_3772_4215 147
662 3300049744 Ga0501083_0036359 Ga0501083_0036359_1824_2267 147
663 3300049822 Ga0501035_0002184 Ga0501035_0002184_13048_13491 147
664 3300049823 Ga0501044_0002158 Ga0501044_0002158_16759_17202 147
665 3300049823 Ga0501044_0253972 Ga0501044_0253972_651_1094 147
666 3300049823 Ga0501044_0827104 Ga0501044_0827104_86_529 147
667 3300050489 nmdc:mga03683_439054_c1 nmdc:mga03683_439054_c1_174_617 147
668 3300050489 nmdc:mga03683_6343_c1 nmdc:mga03683_6343_c1_78_521 147
669 3300050489 nmdc:mga03683_72136_c1 nmdc:mga03683_72136_c1_83_526 147
670 3300050490 nmdc:mga03n38_68444_c1 nmdc:mga03n38_68444_c1_838_1281 147
671 3300050490 nmdc:mga03n38_767172_c1 nmdc:mga03n38_767172_c1_78_521 147
672 3300050490 nmdc:mga03n38_78819_c1 nmdc:mga03n38_78819_c1_54_497 147
673 3300050491 nmdc:mga00v17_254310_c1 nmdc:mga00v17_254310_c1_406_849 147
674 3300050491 nmdc:mga00v17_81190_c1 nmdc:mga00v17_81190_c1_335_778 147
675 3300050491 nmdc:mga00v17_97515_c1 nmdc:mga00v17_97515_c1_344_787 147
676 3300050492 nmdc:mga0yw44_467099_c1 nmdc:mga0yw44_467099_c1_89_532 147
677 3300050492 nmdc:mga0yw44_51090_c1 nmdc:mga0yw44_51090_c1_427_870 147
678 3300050494 nmdc:mga06z11_806305_c1 nmdc:mga06z11_806305_c1_99_542 147
679 3300050494 nmdc:mga06z11_830948_c1 nmdc:mga06z11_830948_c1_34_477 147
680 3300050496 nmdc:mga07m45_329260_c1 nmdc:mga07m45_329260_c1_151_594 147
681 3300050508 nmdc:mga09592_569056_c1 nmdc:mga09592_569056_c1_497_940 147
682 3300050509 nmdc:mga0qj67_141345_c2 nmdc:mga0qj67_141345_c2_611_1054 147
683 3300050509 nmdc:mga0qj67_28056_c1 nmdc:mga0qj67_28056_c1_2860_3303 147
684 3300050510 nmdc:mga06r32_5670_c1 nmdc:mga06r32_5670_c1_3668_4111 147
685 3300050511 nmdc:mga08y16_388379_c1 nmdc:mga08y16_388379_c1_685_1128 147
686 3300050516 nmdc:mga0sz30_165695_c1 nmdc:mga0sz30_165695_c1_188_631 147
687 3300050516 nmdc:mga0sz30_1896_c2 nmdc:mga0sz30_1896_c2_3343_3786 147
688 3300050516 nmdc:mga0sz30_6965_c1 nmdc:mga0sz30_6965_c1_2697_3140 147
689 3300050516 nmdc:mga0sz30_97397_c1 nmdc:mga0sz30_97397_c1_584_1027 147
690 3300053080 Ga0500635_0045829 Ga0500635_0045829_917_1360 147
691 3300053086 Ga0500578_0659327 Ga0500578_0659327_63_506 147
692 3300061719 Ga0466962_0032975 Ga0466962_0032975_1848_2291 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

32

120

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eje-assembly1.cif.gz_A-2 crystal structure of an fmn-binding protein 0.7776 16 71
1wv4-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.7743 16 88
2aq6-assembly1.cif.gz_B x-ray crystal structure of mycobacterium tuberculosis pyridoxine 5'-phosphate oxidase complexed with pyridoxal 5'-phosphate at 1.7 a resolution 0.7541 3 145
2re7-assembly1.cif.gz_A-2 crystal structure of a pyridoxamine 5'-phosphate oxidase related protein (psyc_0186) from psychrobacter arcticus 273-4 at 2.50 a resolution 0.7435 1 145
2i02-assembly1.cif.gz_A crystal structure of a pyridoxamine 5'-phosphate oxidase-like family protein (npun_r6570) from nostoc punctiforme pcc 73102 at 1.80 a resolution 0.7432 13 145
ID Description Score Start End Superfamily
af_O07754_2_147_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9925 2 147 2.30.110.10
af_O07754_2_147_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9858 2 147 2.30.110.10
1ejeA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7776 16 71 2.30.110.10
2iabB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.751 12 145 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7376 5 147 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1X1AUJ9-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9926 3 146 GO:0005829
GO:0016627
GO:0070967
AF-A0A1B1KHP5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.985 1 147 GO:0005829
GO:0016627
GO:0070967
AF-A0A7I7LGM3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9762 1 93 GO:0005829
GO:0016627
GO:0070967
AF-A0A1B1KHP5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9719 1 147 GO:0005829
GO:0016627
GO:0070967
AF-A0A7I7LGM3-F1-model_v4 Pyridoxamine 5'-phosphate oxidase N-terminal domain-containing protein 0.9661 1 93 GO:0005829
GO:0016627
GO:0070967

Feature Viewer

pLDDT pTM Quality
96.95 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map