F475568
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 354 | 643 | 429 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100096977|Ga0070708_1000969773 |
| Length | 486 |
| Sequence | LIANRGEIARRVARTARRLGIKVIAVYSEADAELPFVAEADEAVLIGPAPAAQSYLNADAILAAAARTGAGAIHPGYGFLAENASFAQRVIDAGRTWIGPSPDAIEQMGDKIRARNLMASVGVPVAAGSAEPVSDAEDAIVEAERIGYPVMIKAAAXXXXIGMTVAADAERLRAGFETARTRAERFFGNPSILLERYIASARHVEVQILGLANGQVIALGERDCSAQRRHQKLAEETPSPGVGDRLRQRMLAAAIQAGEAVGYRGAGTVECLVDRQTGEFVFLEMNTRLQVEHPVTEMVTGIDLVEQQLLIADGADVSFDVGSVKPAGHAFELRVYAEDPVRFLPSPGAISQWQEPAGAGVRVDAGYAAGNVVTPHYDPLLAKLIVSGTDREEALARTRAAVADFVVTGPKTNLAFHAELLASREFATGDYDTSVVSRLRPLSGSSGGDGAQPVMVHPASDVPGSPAGPGDGLAPSQGGARDRDPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 3 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 4 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 5 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 6 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 7 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 8 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 9 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 10 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 11 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 12 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 13 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 14 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 15 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 16 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 17 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 18 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 19 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 20 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 21 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 22 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 23 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 24 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 25 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 26 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 27 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 28 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 29 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 30 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 31 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 32 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 33 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 34 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 35 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 36 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 37 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 38 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 39 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 40 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 41 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 74 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 75 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 80 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 87 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 95 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 98 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 109 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 181 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 182 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 191 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 193 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 199 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 200 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 201 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 202 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 203 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 204 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 205 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 207 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 211 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 215 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 221 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 224 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 226 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 236 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 237 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 238 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 242 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 243 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 244 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 245 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 246 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 247 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 311 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 312 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 313 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 314 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 340 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 341 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 344 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 345 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 346 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 347 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 348 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 349 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 350 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 351 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 352 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 353 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 354 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.34 |
| Metatranscriptomes | 0.58 |
| Isolates | 7.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.58 |
| Nodule | 0.58 |
| Rhizoplane | 3.9 |
| Rhizosphere | 85.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10002661 | 3300002459 | Bacteria | 3594 |
| 2 | JGI25406J46586_10001944 | 3300003203 | Bacteria | 9762 |
| 3 | Ga0070658_10042607 | 3300005327 | Bacteria | 3667 |
| 4 | Ga0070658_10045142 | 3300005327 | Bacteria | 3562 |
| 5 | Ga0070658_10135518 | 3300005327 | Bacteria | 2054 |
| 6 | Ga0070683_100000557 | 3300005329 | Bacteria | 26481 |
| 7 | Ga0070683_100006507 | 3300005329 | Bacteria | 9809 |
| 8 | Ga0070683_100059441 | 3300005329 | Bacteria | 3551 |
| 9 | Ga0070670_100008036 | 3300005331 | Bacteria | 8975 |
| 10 | Ga0068869_100004358 | 3300005334 | Bacteria | 8785 |
| 11 | Ga0068869_100007210 | 3300005334 | Bacteria | 7089 |
| 12 | Ga0068869_100068633 | 3300005334 | Bacteria | 2619 |
| 13 | Ga0070680_100002227 | 3300005336 | Bacteria | 14305 |
| 14 | Ga0070680_100057742 | 3300005336 | Bacteria | 3173 |
| 15 | Ga0070680_100109379 | 3300005336 | Bacteria | 2300 |
| 16 | Ga0070682_100001454 | 3300005337 | Bacteria | 13299 |
| 17 | Ga0070682_100137222 | 3300005337 | Bacteria | 1663 |
| 18 | Ga0068868_100020944 | 3300005338 | Bacteria | 4922 |
| 19 | Ga0068868_100024010 | 3300005338 | Bacteria | 4621 |
| 20 | Ga0070660_100021974 | 3300005339 | Bacteria | 4712 |
| 21 | Ga0070660_100025036 | 3300005339 | Bacteria | 4433 |
| 22 | Ga0070660_100137197 | 3300005339 | Bacteria | 1960 |
| 23 | Ga0070689_100105407 | 3300005340 | Bacteria | 2236 |
| 24 | Ga0070691_10002921 | 3300005341 | Bacteria | 7662 |
| 25 | Ga0070687_100077703 | 3300005343 | Bacteria | 1802 |
| 26 | Ga0070661_100137943 | 3300005344 | Bacteria | 1836 |
| 27 | Ga0070692_10004655 | 3300005345 | Bacteria | 5749 |
| 28 | Ga0070668_100006041 | 3300005347 | Bacteria | 8980 |
| 29 | Ga0070668_100181420 | 3300005347 | Bacteria | 1720 |
| 30 | Ga0070675_100000851 | 3300005354 | Bacteria | 21682 |
| 31 | Ga0070675_100004377 | 3300005354 | Bacteria | 10776 |
| 32 | Ga0070675_100183577 | 3300005354 | Bacteria | 1810 |
| 33 | Ga0070671_100010749 | 3300005355 | Bacteria | 7346 |
| 34 | Ga0070673_100078002 | 3300005364 | Bacteria | 2678 |
| 35 | Ga0070673_100152433 | 3300005364 | Bacteria | 1958 |
| 36 | Ga0070659_100000886 | 3300005366 | Bacteria | 21881 |
| 37 | Ga0070659_100016339 | 3300005366 | Bacteria | 5572 |
| 38 | Ga0070659_100117654 | 3300005366 | Bacteria | 2149 |
| 39 | Ga0070659_100120145 | 3300005366 | Bacteria | 2127 |
| 40 | Ga0070667_100158779 | 3300005367 | Bacteria | 1990 |
| 41 | Ga0070709_10005114 | 3300005434 | Bacteria | 7092 |
| 42 | Ga0070714_100000319 | 3300005435 | Bacteria | 36427 |
| 43 | Ga0070714_100024889 | 3300005435 | Bacteria | 4935 |
| 44 | Ga0070714_100047262 | 3300005435 | Bacteria | 3655 |
| 45 | Ga0070714_100060055 | 3300005435 | Bacteria | 3262 |
| 46 | Ga0070714_100077075 | 3300005435 | Bacteria | 2895 |
| 47 | Ga0070714_100083193 | 3300005435 | Bacteria | 2790 |
| 48 | Ga0070714_100101008 | 3300005435 | Bacteria | 2541 |
| 49 | Ga0070714_100193533 | 3300005435 | Bacteria | 1857 |
| 50 | Ga0070713_100012448 | 3300005436 | Bacteria | 6239 |
| 51 | Ga0070713_100046651 | 3300005436 | Bacteria | 3556 |
| 52 | Ga0070713_100050364 | 3300005436 | Bacteria | 3440 |
| 53 | Ga0070710_10008962 | 3300005437 | Bacteria | 4887 |
| 54 | Ga0070710_10011538 | 3300005437 | Bacteria | 4368 |
| 55 | Ga0070710_10073193 | 3300005437 | Bacteria | 1980 |
| 56 | Ga0070701_10029795 | 3300005438 | Bacteria | 2695 |
| 57 | Ga0070711_100038791 | 3300005439 | Bacteria | 3205 |
| 58 | Ga0070711_100166223 | 3300005439 | Bacteria | 1677 |
| 59 | Ga0070705_100046324 | 3300005440 | Bacteria | 2506 |
| 60 | Ga0070700_100004088 | 3300005441 | Bacteria | 7597 |
| 61 | Ga0070700_100112604 | 3300005441 | Bacteria | 1812 |
| 62 | Ga0070708_100001787 | 3300005445 | Bacteria | 16504 |
| 63 | Ga0070708_100015492 | 3300005445 | Bacteria | 6300 |
| 64 | Ga0070708_100039236 | 3300005445 | Bacteria | 4142 |
| 65 | Ga0070708_100060710 | 3300005445 | Bacteria | 3375 |
| 66 | Ga0070708_100096977 | 3300005445 | Bacteria | 2694 |
| 67 | Ga0070663_100014634 | 3300005455 | Bacteria | 5041 |
| 68 | Ga0070662_100086176 | 3300005457 | Bacteria | 2349 |
| 69 | Ga0070662_100098811 | 3300005457 | Bacteria | 2205 |
| 70 | Ga0070681_10001334 | 3300005458 | Bacteria | 21584 |
| 71 | Ga0070681_10065012 | 3300005458 | Bacteria | 3617 |
| 72 | Ga0068867_100025176 | 3300005459 | Bacteria | 4269 |
| 73 | Ga0070685_10007879 | 3300005466 | Bacteria | 5457 |
| 74 | Ga0070706_100008084 | 3300005467 | Bacteria | 9809 |
| 75 | Ga0070706_100010390 | 3300005467 | Bacteria | 8646 |
| 76 | Ga0070706_100011220 | 3300005467 | Bacteria | 8322 |
| 77 | Ga0070706_100030034 | 3300005467 | Bacteria | 5005 |
| 78 | Ga0070706_100105958 | 3300005467 | Bacteria | 2616 |
| 79 | Ga0070707_100000127 | 3300005468 | Bacteria | 71273 |
| 80 | Ga0070707_100001180 | 3300005468 | Bacteria | 25707 |
| 81 | Ga0070707_100006664 | 3300005468 | Bacteria | 10699 |
| 82 | Ga0070707_100024871 | 3300005468 | Bacteria | 5676 |
| 83 | Ga0070707_100048768 | 3300005468 | Bacteria | 4057 |
| 84 | Ga0070707_100197809 | 3300005468 | Bacteria | 1959 |
| 85 | Ga0070698_100000597 | 3300005471 | Bacteria | 38839 |
| 86 | Ga0070698_100002462 | 3300005471 | Bacteria | 20439 |
| 87 | Ga0070698_100008768 | 3300005471 | Bacteria | 10889 |
| 88 | Ga0070698_100061318 | 3300005471 | Bacteria | 3795 |
| 89 | Ga0070698_100090154 | 3300005471 | Bacteria | 3050 |
| 90 | Ga0070698_100107989 | 3300005471 | Bacteria | 2750 |
| 91 | Ga0070699_100277324 | 3300005518 | Bacteria | 1501 |
| 92 | Ga0070679_100000273 | 3300005530 | Bacteria | 43331 |
| 93 | Ga0070679_100091365 | 3300005530 | Bacteria | 3032 |
| 94 | Ga0070679_100113334 | 3300005530 | Bacteria | 2697 |
| 95 | Ga0070684_100004299 | 3300005535 | Bacteria | 10812 |
| 96 | Ga0070684_100007875 | 3300005535 | Bacteria | 8310 |
| 97 | Ga0070697_100039861 | 3300005536 | Bacteria | 3799 |
| 98 | Ga0068853_100042610 | 3300005539 | Bacteria | 3882 |
| 99 | Ga0068853_100128392 | 3300005539 | Bacteria | 2267 |
| 100 | Ga0070672_100011916 | 3300005543 | Bacteria | 6077 |
| 101 | Ga0070695_100022226 | 3300005545 | Bacteria | 3889 |
| 102 | Ga0070693_100000804 | 3300005547 | Bacteria | 13886 |
| 103 | Ga0068855_100008477 | 3300005563 | Bacteria | 12426 |
| 104 | Ga0068855_100075327 | 3300005563 | Bacteria | 3919 |
| 105 | Ga0068855_100224284 | 3300005563 | Bacteria | 2106 |
| 106 | Ga0070664_100000617 | 3300005564 | Bacteria | 27174 |
| 107 | Ga0068857_100045321 | 3300005577 | Bacteria | 3901 |
| 108 | Ga0068857_100221950 | 3300005577 | Bacteria | 1726 |
| 109 | Ga0068854_100056665 | 3300005578 | Bacteria | 2825 |
| 110 | Ga0068854_100058231 | 3300005578 | Bacteria | 2788 |
| 111 | Ga0068856_100055156 | 3300005614 | Bacteria | 3922 |
| 112 | Ga0070702_100000979 | 3300005615 | Bacteria | 11262 |
| 113 | Ga0070702_100060131 | 3300005615 | Bacteria | 2208 |
| 114 | Ga0068852_100005693 | 3300005616 | Bacteria | 8937 |
| 115 | Ga0068861_100032455 | 3300005719 | Bacteria | 3844 |
| 116 | Ga0068861_100070616 | 3300005719 | Bacteria | 2705 |
| 117 | Ga0068870_10000074 | 3300005840 | Bacteria | 31568 |
| 118 | Ga0068863_100013453 | 3300005841 | Bacteria | 7891 |
| 119 | Ga0068858_100011258 | 3300005842 | Bacteria | 8452 |
| 120 | Ga0068860_100014937 | 3300005843 | Bacteria | 7591 |
| 121 | Ga0068862_100020398 | 3300005844 | Bacteria | 5537 |
| 122 | Ga0081540_1000207 | 3300005983 | Bacteria | 61586 |
| 123 | Ga0081540_1000517 | 3300005983 | Bacteria | 37840 |
| 124 | Ga0081540_1018761 | 3300005983 | Bacteria | 4229 |
| 125 | Ga0081539_10000809 | 3300005985 | Bacteria | 60775 |
| 126 | Ga0081539_10001196 | 3300005985 | Bacteria | 46791 |
| 127 | Ga0081539_10003770 | 3300005985 | Bacteria | 17940 |
| 128 | Ga0081539_10096472 | 3300005985 | Bacteria | 1516 |
| 129 | Ga0070717_10007692 | 3300006028 | Bacteria | 8015 |
| 130 | Ga0070717_10015393 | 3300006028 | Bacteria | 5908 |
| 131 | Ga0070717_10026141 | 3300006028 | Bacteria | 4654 |
| 132 | Ga0070717_10051767 | 3300006028 | Bacteria | 3380 |
| 133 | Ga0070717_10068380 | 3300006028 | Bacteria | 2956 |
| 134 | Ga0070717_10281038 | 3300006028 | Bacteria | 1476 |
| 135 | Ga0070716_100003008 | 3300006173 | Bacteria | 7860 |
| 136 | Ga0070716_100044210 | 3300006173 | Bacteria | 2494 |
| 137 | Ga0070712_100052502 | 3300006175 | Bacteria | 2843 |
| 138 | Ga0070712_100109771 | 3300006175 | Bacteria | 2057 |
| 139 | Ga0075428_100000598 | 3300006844 | Bacteria | 36812 |
| 140 | Ga0075428_100007643 | 3300006844 | Bacteria | 11980 |
| 141 | Ga0075428_100029853 | 3300006844 | Bacteria | 6030 |
| 142 | Ga0075428_100197116 | 3300006844 | Bacteria | 2178 |
| 143 | Ga0075430_100001817 | 3300006846 | Bacteria | 17473 |
| 144 | Ga0075430_100004049 | 3300006846 | Bacteria | 12371 |
| 145 | Ga0075431_100004612 | 3300006847 | Bacteria | 13530 |
| 146 | Ga0075431_100011144 | 3300006847 | Bacteria | 9050 |
| 147 | Ga0075431_100120206 | 3300006847 | Bacteria | 2710 |
| 148 | Ga0075433_10010746 | 3300006852 | Bacteria | 7362 |
| 149 | Ga0075434_100001385 | 3300006871 | Bacteria | 20340 |
| 150 | Ga0075434_100012318 | 3300006871 | Bacteria | 8101 |
| 151 | Ga0075429_100001920 | 3300006880 | Bacteria | 17234 |
| 152 | Ga0075429_100003184 | 3300006880 | Bacteria | 13949 |
| 153 | Ga0075429_100033013 | 3300006880 | Bacteria | 4498 |
| 154 | Ga0075429_100247561 | 3300006880 | Bacteria | 1561 |
| 155 | Ga0075435_100004313 | 3300007076 | Bacteria | 9778 |
| 156 | Ga0075435_100005790 | 3300007076 | Bacteria | 8681 |
| 157 | Ga0099794_10006625 | 3300007265 | Bacteria | 4704 |
| 158 | Ga0099795_10028181 | 3300007788 | Bacteria | 1907 |
| 159 | Ga0105240_10273158 | 3300009093 | Bacteria | 1945 |
| 160 | Ga0111539_10007767 | 3300009094 | Bacteria | 13693 |
| 161 | Ga0105245_10011036 | 3300009098 | Bacteria | 7865 |
| 162 | Ga0114129_10000272 | 3300009147 | Bacteria | 58807 |
| 163 | Ga0114129_10000557 | 3300009147 | Bacteria | 45780 |
| 164 | Ga0114129_10020083 | 3300009147 | Bacteria | 9508 |
| 165 | Ga0114129_10083012 | 3300009147 | Bacteria | 4452 |
| 166 | Ga0114129_10132722 | 3300009147 | Bacteria | 3419 |
| 167 | Ga0105243_10086816 | 3300009148 | Bacteria | 2567 |
| 168 | Ga0105241_10069806 | 3300009174 | Bacteria | 2725 |
| 169 | Ga0105237_10105256 | 3300009545 | Bacteria | 2812 |
| 170 | Ga0105238_10074381 | 3300009551 | Bacteria | 3390 |
| 171 | Ga0105239_10190039 | 3300010375 | Bacteria | 2299 |
| 172 | Ga0105246_10000575 | 3300011119 | Bacteria | 20378 |
| 173 | Ga0157371_10042577 | 3300013102 | Bacteria | 3237 |
| 174 | Ga0157371_10067364 | 3300013102 | Bacteria | 2534 |
| 175 | Ga0157370_10032408 | 3300013104 | Bacteria | 5104 |
| 176 | Ga0157369_10007654 | 3300013105 | Bacteria | 12425 |
| 177 | Ga0157369_10008009 | 3300013105 | Bacteria | 12135 |
| 178 | Ga0157369_10034539 | 3300013105 | Bacteria | 5549 |
| 179 | Ga0157369_10154261 | 3300013105 | Bacteria | 2427 |
| 180 | Ga0163162_10085493 | 3300013306 | Bacteria | 3231 |
| 181 | Ga0157375_10050374 | 3300013308 | Bacteria | 4085 |
| 182 | Ga0157375_10134848 | 3300013308 | Bacteria | 2591 |
| 183 | Ga0157376_10161328 | 3300014969 | Bacteria | 2033 |
| 184 | Ga0206354_10180487 | 3300020081 | Bacteria | 2243 |
| 185 | Ga0206353_10443563 | 3300020082 | Bacteria | 3346 |
| 186 | Ga0213873_10000068 | 3300021358 | Bacteria | 22379 |
| 187 | Ga0213876_10000193 | 3300021384 | Bacteria | 63355 |
| 188 | Ga0213876_10000552 | 3300021384 | Bacteria | 28013 |
| 189 | Ga0213875_10000218 | 3300021388 | Bacteria | 58140 |
| 190 | Ga0213875_10000428 | 3300021388 | Bacteria | 36761 |
| 191 | Ga0224712_10001312 | 3300022467 | Bacteria | 5658 |
| 192 | Ga0224712_10019476 | 3300022467 | Bacteria | 2289 |
| 193 | Ga0224572_1002342 | 3300024225 | Bacteria | 3038 |
| 194 | Ga0207692_10003021 | 3300025898 | Bacteria | 6524 |
| 195 | Ga0207688_10006713 | 3300025901 | Bacteria | 6260 |
| 196 | Ga0207688_10006817 | 3300025901 | Bacteria | 6217 |
| 197 | Ga0207699_10002673 | 3300025906 | Bacteria | 8421 |
| 198 | Ga0207699_10015277 | 3300025906 | Bacteria | 3984 |
| 199 | Ga0207645_10015649 | 3300025907 | Bacteria | 5032 |
| 200 | Ga0207643_10000037 | 3300025908 | Bacteria | 89297 |
| 201 | Ga0207643_10008004 | 3300025908 | Bacteria | 5673 |
| 202 | Ga0207705_10017310 | 3300025909 | Bacteria | 5159 |
| 203 | Ga0207705_10119778 | 3300025909 | Bacteria | 1952 |
| 204 | Ga0207684_10001782 | 3300025910 | Bacteria | 22690 |
| 205 | Ga0207684_10003848 | 3300025910 | Bacteria | 14442 |
| 206 | Ga0207684_10040619 | 3300025910 | Bacteria | 3944 |
| 207 | Ga0207684_10089336 | 3300025910 | Bacteria | 2625 |
| 208 | Ga0207684_10099913 | 3300025910 | Bacteria | 2479 |
| 209 | Ga0207707_10000023 | 3300025912 | Bacteria | 183706 |
| 210 | Ga0207707_10046384 | 3300025912 | Bacteria | 3785 |
| 211 | Ga0207695_10019091 | 3300025913 | Bacteria | 7906 |
| 212 | Ga0207693_10006051 | 3300025915 | Bacteria | 10023 |
| 213 | Ga0207693_10033330 | 3300025915 | Bacteria | 4064 |
| 214 | Ga0207663_10020146 | 3300025916 | Bacteria | 3773 |
| 215 | Ga0207663_10118993 | 3300025916 | Bacteria | 1805 |
| 216 | Ga0207660_10003404 | 3300025917 | Bacteria | 10371 |
| 217 | Ga0207660_10082284 | 3300025917 | Bacteria | 2368 |
| 218 | Ga0207660_10191895 | 3300025917 | Bacteria | 1591 |
| 219 | Ga0207662_10004219 | 3300025918 | Bacteria | 7537 |
| 220 | Ga0207657_10032723 | 3300025919 | Bacteria | 4694 |
| 221 | Ga0207657_10054307 | 3300025919 | Bacteria | 3465 |
| 222 | Ga0207657_10133220 | 3300025919 | Bacteria | 2035 |
| 223 | Ga0207649_10008226 | 3300025920 | Bacteria | 5682 |
| 224 | Ga0207652_10000039 | 3300025921 | Bacteria | 131660 |
| 225 | Ga0207652_10042138 | 3300025921 | Bacteria | 3883 |
| 226 | Ga0207646_10000264 | 3300025922 | Bacteria | 71299 |
| 227 | Ga0207646_10001334 | 3300025922 | Bacteria | 30684 |
| 228 | Ga0207646_10003773 | 3300025922 | Bacteria | 16878 |
| 229 | Ga0207646_10007952 | 3300025922 | Bacteria | 10699 |
| 230 | Ga0207646_10061146 | 3300025922 | Bacteria | 3363 |
| 231 | Ga0207646_10074356 | 3300025922 | Bacteria | 3035 |
| 232 | Ga0207646_10108072 | 3300025922 | Bacteria | 2496 |
| 233 | Ga0207646_10178531 | 3300025922 | Bacteria | 1917 |
| 234 | Ga0207650_10000873 | 3300025925 | Bacteria | 22864 |
| 235 | Ga0207659_10004144 | 3300025926 | Bacteria | 8749 |
| 236 | Ga0207659_10020583 | 3300025926 | Bacteria | 4363 |
| 237 | Ga0207687_10009534 | 3300025927 | Bacteria | 6349 |
| 238 | Ga0207700_10007108 | 3300025928 | Bacteria | 6818 |
| 239 | Ga0207700_10014331 | 3300025928 | Bacteria | 5192 |
| 240 | Ga0207700_10027643 | 3300025928 | Bacteria | 3977 |
| 241 | Ga0207700_10031413 | 3300025928 | Bacteria | 3773 |
| 242 | Ga0207664_10000218 | 3300025929 | Bacteria | 43292 |
| 243 | Ga0207664_10008062 | 3300025929 | Bacteria | 7325 |
| 244 | Ga0207664_10012976 | 3300025929 | Bacteria | 5970 |
| 245 | Ga0207664_10027036 | 3300025929 | Bacteria | 4345 |
| 246 | Ga0207664_10047912 | 3300025929 | Bacteria | 3359 |
| 247 | Ga0207664_10060279 | 3300025929 | Bacteria | 3024 |
| 248 | Ga0207664_10084004 | 3300025929 | Bacteria | 2596 |
| 249 | Ga0207664_10111572 | 3300025929 | Bacteria | 2275 |
| 250 | Ga0207664_10190772 | 3300025929 | Bacteria | 1764 |
| 251 | Ga0207644_10039647 | 3300025931 | Bacteria | 3325 |
| 252 | Ga0207690_10000393 | 3300025932 | Bacteria | 28872 |
| 253 | Ga0207690_10090079 | 3300025932 | Bacteria | 2164 |
| 254 | Ga0207690_10090596 | 3300025932 | Bacteria | 2159 |
| 255 | Ga0207706_10024004 | 3300025933 | Bacteria | 5471 |
| 256 | Ga0207706_10027305 | 3300025933 | Bacteria | 5105 |
| 257 | Ga0207706_10104977 | 3300025933 | Bacteria | 2486 |
| 258 | Ga0207670_10096894 | 3300025936 | Bacteria | 2099 |
| 259 | Ga0207665_10004519 | 3300025939 | Bacteria | 9227 |
| 260 | Ga0207665_10009065 | 3300025939 | Bacteria | 6531 |
| 261 | Ga0207665_10011920 | 3300025939 | Bacteria | 5709 |
| 262 | Ga0207665_10029973 | 3300025939 | Bacteria | 3595 |
| 263 | Ga0207691_10013128 | 3300025940 | Bacteria | 7930 |
| 264 | Ga0207691_10133498 | 3300025940 | Bacteria | 2191 |
| 265 | Ga0207689_10001161 | 3300025942 | Bacteria | 25352 |
| 266 | Ga0207689_10011945 | 3300025942 | Bacteria | 7442 |
| 267 | Ga0207689_10028353 | 3300025942 | Bacteria | 4684 |
| 268 | Ga0207689_10083080 | 3300025942 | Bacteria | 2633 |
| 269 | Ga0207661_10001808 | 3300025944 | Bacteria | 14611 |
| 270 | Ga0207661_10008848 | 3300025944 | Bacteria | 7207 |
| 271 | Ga0207661_10041617 | 3300025944 | Bacteria | 3617 |
| 272 | Ga0207661_10063571 | 3300025944 | Bacteria | 2989 |
| 273 | Ga0207661_10088477 | 3300025944 | Bacteria | 2575 |
| 274 | Ga0207679_10002759 | 3300025945 | Bacteria | 10870 |
| 275 | Ga0207668_10001164 | 3300025972 | Bacteria | 15617 |
| 276 | Ga0207677_10011954 | 3300026023 | Bacteria | 4971 |
| 277 | Ga0207703_10025713 | 3300026035 | Bacteria | 4631 |
| 278 | Ga0207703_10159360 | 3300026035 | Bacteria | 1975 |
| 279 | Ga0207678_10004448 | 3300026067 | Bacteria | 12606 |
| 280 | Ga0207678_10006590 | 3300026067 | Bacteria | 10299 |
| 281 | Ga0207678_10006712 | 3300026067 | Bacteria | 10208 |
| 282 | Ga0207708_10001038 | 3300026075 | Bacteria | 20784 |
| 283 | Ga0207708_10004711 | 3300026075 | Bacteria | 10032 |
| 284 | Ga0207702_10002388 | 3300026078 | Bacteria | 17880 |
| 285 | Ga0207702_10006916 | 3300026078 | Bacteria | 9713 |
| 286 | Ga0207676_10066988 | 3300026095 | Bacteria | 2867 |
| 287 | Ga0207674_10022739 | 3300026116 | Bacteria | 6727 |
| 288 | Ga0207674_10054729 | 3300026116 | Bacteria | 4061 |
| 289 | Ga0207674_10133033 | 3300026116 | Bacteria | 2450 |
| 290 | Ga0207675_100026879 | 3300026118 | Bacteria | 5356 |
| 291 | Ga0207675_100045144 | 3300026118 | Bacteria | 4117 |
| 292 | Ga0207683_10044813 | 3300026121 | Bacteria | 3867 |
| 293 | Ga0207698_10040140 | 3300026142 | Bacteria | 3474 |
| 294 | Ga0207428_10010980 | 3300027907 | Bacteria | 8054 |
| 295 | Ga0207428_10016826 | 3300027907 | Bacteria | 6285 |
| 296 | Ga0268265_10002195 | 3300028380 | Bacteria | 15067 |
| 297 | Ga0307517_10039180 | 3300028786 | Bacteria | 5215 |
| 298 | Ga0307515_10000095 | 3300028794 | Bacteria | 208513 |
| 299 | Ga0307515_10005285 | 3300028794 | Bacteria | 26256 |
| 300 | Ga0307515_10103289 | 3300028794 | Bacteria | 3417 |
| 301 | Ga0265338_10054526 | 3300028800 | Bacteria | 3564 |
| 302 | Ga0307512_10007735 | 3300030522 | Bacteria | 10578 |
| 303 | Ga0307512_10015066 | 3300030522 | Bacteria | 7185 |
| 304 | Ga0265325_10009579 | 3300031241 | Bacteria | 5653 |
| 305 | Ga0265340_10000457 | 3300031247 | Bacteria | 22102 |
| 306 | Ga0265340_10013376 | 3300031247 | Bacteria | 4308 |
| 307 | Ga0265339_10008669 | 3300031249 | Bacteria | 6453 |
| 308 | Ga0265316_10024470 | 3300031344 | Bacteria | 5060 |
| 309 | Ga0265316_10089052 | 3300031344 | Bacteria | 2356 |
| 310 | Ga0307513_10048880 | 3300031456 | Bacteria | 4586 |
| 311 | Ga0307513_10144174 | 3300031456 | Bacteria | 2302 |
| 312 | Ga0307513_10180230 | 3300031456 | Bacteria | 1977 |
| 313 | Ga0307509_10061343 | 3300031507 | Bacteria | 3970 |
| 314 | Ga0307508_10006410 | 3300031616 | Bacteria | 11064 |
| 315 | Ga0307508_10014514 | 3300031616 | Bacteria | 7186 |
| 316 | Ga0307508_10040674 | 3300031616 | Bacteria | 4173 |
| 317 | Ga0307508_10042719 | 3300031616 | Bacteria | 4065 |
| 318 | Ga0307508_10134323 | 3300031616 | Bacteria | 2077 |
| 319 | Ga0265342_10031016 | 3300031712 | Bacteria | 3308 |
| 320 | Ga0316578_10006155 | 3300031728 | Bacteria | 5895 |
| 321 | Ga0307516_10001182 | 3300031730 | Bacteria | 36492 |
| 322 | Ga0307405_10005868 | 3300031731 | Bacteria | 5981 |
| 323 | Ga0307413_10010370 | 3300031824 | Bacteria | 4516 |
| 324 | Ga0326468_10000567 | 3300031889 | Bacteria | 3844 |
| 325 | Ga0307406_10003953 | 3300031901 | Bacteria | 8054 |
| 326 | Ga0307406_10006740 | 3300031901 | Bacteria | 6352 |
| 327 | Ga0307406_10024910 | 3300031901 | Bacteria | 3577 |
| 328 | Ga0307409_100000900 | 3300031995 | Bacteria | 13785 |
| 329 | Ga0307409_100010423 | 3300031995 | Bacteria | 5780 |
| 330 | Ga0307416_100018199 | 3300032002 | Bacteria | 4943 |
| 331 | Ga0307411_10061973 | 3300032005 | Bacteria | 2493 |
| 332 | Ga0307415_100000008 | 3300032126 | Bacteria | 90898 |
| 333 | Ga0307415_100026955 | 3300032126 | Bacteria | 3633 |
| 334 | Ga0307507_10139828 | 3300033179 | Bacteria | 1861 |
| 335 | Ga0373938_0005385 | 3300034957 | Bacteria | 2175 |
| 336 | Ga0373938_0016256 | 3300034957 | Bacteria | 1452 |
| 337 | Ga0373926_0000313 | 3300035083 | Bacteria | 12025 |
| 338 | Ga0373926_0000673 | 3300035083 | Bacteria | 9388 |
| 339 | Ga0373934_0001413 | 3300035086 | Bacteria | 8783 |
| 340 | Ga0373934_0010850 | 3300035086 | Bacteria | 3424 |
| 341 | Ga0373944_0000369 | 3300035089 | Bacteria | 10184 |
| 342 | Ga0373944_0002781 | 3300035089 | Bacteria | 4474 |
| 343 | Ga0373951_0000035 | 3300035091 | Bacteria | 52707 |
| 344 | Ga0373923_0002491 | 3300035111 | Bacteria | 5685 |
| 345 | Ga0373932_0004457 | 3300035112 | Bacteria | 3308 |
| 346 | Ga0373936_0003410 | 3300035113 | Bacteria | 5958 |
| 347 | Ga0373936_0003491 | 3300035113 | Bacteria | 5907 |
| 348 | Ga0373936_0034728 | 3300035113 | Bacteria | 2005 |
| 349 | Ga0373939_0011898 | 3300035114 | Bacteria | 2208 |
| 350 | Ga0373945_0001173 | 3300035116 | Bacteria | 7968 |
| 351 | Ga0373953_0012605 | 3300035117 | Bacteria | 2999 |
| 352 | Ga0373954_0055206 | 3300035118 | Bacteria | 1869 |
| 353 | Ga0373956_0009276 | 3300035119 | Bacteria | 3997 |
| 354 | Ga0373943_0000269 | 3300035170 | Bacteria | 21448 |
| 355 | Ga0373943_0018423 | 3300035170 | Bacteria | 3207 |
| 356 | Ga0373946_0002878 | 3300035171 | Bacteria | 6103 |
| 357 | Ga0373946_0012619 | 3300035171 | Bacteria | 3166 |
| 358 | Ga0373946_0049706 | 3300035171 | Bacteria | 1749 |
| 359 | Ga0373955_0004654 | 3300035172 | Bacteria | 6085 |
| 360 | Ga0373955_0015118 | 3300035172 | Bacteria | 3771 |
| 361 | Ga0373955_0041133 | 3300035172 | Bacteria | 2475 |
| 362 | Ga0373955_0059780 | 3300035172 | Bacteria | 2100 |
| 363 | Ga0373942_0000279 | 3300035207 | Bacteria | 13829 |
| 364 | Ga0316574_0005082 | 3300035398 | Bacteria | 6989 |
| 365 | Ga0373924_0028597 | 3300035410 | Bacteria | 2222 |
| 366 | Ga0373935_0000373 | 3300035692 | Bacteria | 22971 |
| 367 | Ga0373935_0009413 | 3300035692 | Bacteria | 5845 |
| 368 | Ga0373935_0012880 | 3300035692 | Bacteria | 5037 |
| 369 | Ga0373935_0021620 | 3300035692 | Bacteria | 3940 |
| 370 | Ga0373935_0026324 | 3300035692 | Bacteria | 3588 |
| 371 | Ga0373927_0000125 | 3300035695 | Bacteria | 58736 |
| 372 | Ga0373927_0002091 | 3300035695 | Bacteria | 14731 |
| 373 | Ga0373933_0026188 | 3300035724 | Bacteria | 3348 |
| 374 | Ga0373933_0026953 | 3300035724 | Bacteria | 3305 |
| 375 | Ga0373947_0000007 | 3300035725 | Bacteria | 192259 |
| 376 | Ga0373947_0003170 | 3300035725 | Bacteria | 9788 |
| 377 | Ga0373947_0009658 | 3300035725 | Bacteria | 5537 |
| 378 | Ga0373937_0010565 | 3300036401 | Bacteria | 8065 |
| 379 | Ga0373937_0046900 | 3300036401 | Bacteria | 3952 |
| 380 | Ga0373937_0071089 | 3300036401 | Bacteria | 3210 |
| 381 | Ga0373937_0073680 | 3300036401 | Bacteria | 3150 |
| 382 | Ga0373937_0091119 | 3300036401 | Bacteria | 2824 |
| 383 | Ga0316584_0008056 | 3300036712 | Bacteria | 7236 |
| 384 | Ga0373925_0000003 | 3300037068 | Bacteria | 362401 |
| 385 | Ga0373925_0045436 | 3300037068 | Bacteria | 3262 |
| 386 | Ga0373925_0093090 | 3300037068 | Bacteria | 2306 |
| 387 | Ga0373925_0105067 | 3300037068 | Bacteria | 2175 |
| 388 | Ga0373925_0120359 | 3300037068 | Bacteria | 2037 |
| 389 | Ga0395899_0006633 | 3300037312 | Bacteria | 8970 |
| 390 | Ga0395899_0031133 | 3300037312 | Bacteria | 4010 |
| 391 | Ga0395900_0004495 | 3300037418 | Bacteria | 14766 |
| 392 | Ga0395898_0010093 | 3300037466 | Bacteria | 9882 |
| 393 | Ga0395898_0048326 | 3300037466 | Bacteria | 4173 |
| 394 | Ga0395905_0014282 | 3300037471 | Bacteria | 7586 |
| 395 | Ga0436364_0386143 | 3300037853 | Bacteria | 1859 |
| 396 | Ga0436364_0393888 | 3300037853 | Bacteria | 62164 |
| 397 | Ga0436364_0512240 | 3300037853 | Bacteria | 2950 |
| 398 | Ga0436364_0538624 | 3300037853 | Bacteria | 74940 |
| 399 | Ga0436364_0756837 | 3300037853 | Bacteria | 2196 |
| 400 | Ga0436364_1201672 | 3300037853 | Bacteria | 1627 |
| 401 | Ga0436364_1394109 | 3300037853 | Bacteria | 7390 |
| 402 | Ga0395901_0013285 | 3300038443 | Bacteria | 8363 |
| 403 | Ga0436365_0083635 | 3300039437 | Bacteria | 4148 |
| 404 | Ga0436365_0115299 | 3300039437 | Bacteria | 40894 |
| 405 | Ga0436365_0586466 | 3300039437 | Bacteria | 1822 |
| 406 | Ga0436365_1781586 | 3300039437 | Bacteria | 55120 |
| 407 | Ga0436363_0294318 | 3300039450 | Bacteria | 1649 |
| 408 | Ga0436362_0358937 | 3300039453 | Bacteria | 43996 |
| 409 | Ga0451797_1033868 | 3300041453 | Bacteria | 5431 |
| 410 | Ga0451843_1154776 | 3300041509 | Bacteria | 1798 |
| 411 | Ga0466972_0001392 | 3300044658 | Bacteria | 11712 |
| 412 | Ga0466966_0000704 | 3300044684 | Bacteria | 21260 |
| 413 | Ga0466966_0026923 | 3300044684 | Bacteria | 3750 |
| 414 | Ga0466961_0013731 | 3300044693 | Bacteria | 5190 |
| 415 | Ga0466961_0019066 | 3300044693 | Bacteria | 4414 |
| 416 | Ga0466961_0022404 | 3300044693 | Bacteria | 4064 |
| 417 | Ga0466961_0042077 | 3300044693 | Bacteria | 2929 |
| 418 | Ga0466963_0093382 | 3300044694 | Bacteria | 2051 |
| 419 | Ga0466971_0006211 | 3300044719 | Bacteria | 5193 |
| 420 | Ga0466968_0000465 | 3300044735 | Bacteria | 13649 |
| 421 | Ga0466970_0007026 | 3300044765 | Bacteria | 5634 |
| 422 | Ga0466957_0000234 | 3300044842 | Bacteria | 26243 |
| 423 | Ga0466957_0005441 | 3300044842 | Bacteria | 7151 |
| 424 | Ga0466957_0033508 | 3300044842 | Bacteria | 3082 |
| 425 | Ga0466957_0070031 | 3300044842 | Bacteria | 2167 |
| 426 | Ga0466959_0043080 | 3300045049 | Bacteria | 3329 |
| 427 | Ga0466958_0002622 | 3300045836 | Bacteria | 9095 |
| 428 | Ga0466958_0046065 | 3300045836 | Bacteria | 2631 |
| 429 | Ga0466967_0000475 | 3300045976 | Bacteria | 19428 |
| 430 | Ga0466967_0024008 | 3300045976 | Bacteria | 5006 |
| 431 | Ga0466967_0054920 | 3300045976 | Bacteria | 3508 |
| 432 | Ga0495592_0051894 | 3300046454 | Bacteria | 3046 |
| 433 | Ga0495592_0056451 | 3300046454 | Bacteria | 2902 |
| 434 | Ga0495592_0063346 | 3300046454 | Bacteria | 2712 |
| 435 | Ga0495603_0005396 | 3300046455 | Bacteria | 7629 |
| 436 | Ga0495629_0000833 | 3300046459 | Bacteria | 25000 |
| 437 | Ga0495629_0058089 | 3300046459 | Bacteria | 2704 |
| 438 | Ga0495629_0072822 | 3300046459 | Bacteria | 2399 |
| 439 | Ga0495641_0003291 | 3300046461 | Bacteria | 12200 |
| 440 | Ga0495641_0011042 | 3300046461 | Bacteria | 5175 |
| 441 | Ga0495641_0032936 | 3300046461 | Bacteria | 2463 |
| 442 | Ga0495651_0002251 | 3300046462 | Bacteria | 14907 |
| 443 | Ga0495651_0011791 | 3300046462 | Bacteria | 6718 |
| 444 | Ga0495651_0021678 | 3300046462 | Bacteria | 4994 |
| 445 | Ga0495651_0056889 | 3300046462 | Bacteria | 3003 |
| 446 | Ga0495653_0001970 | 3300046463 | Bacteria | 16162 |
| 447 | Ga0495653_0002205 | 3300046463 | Bacteria | 15402 |
| 448 | Ga0495653_0016859 | 3300046463 | Bacteria | 5945 |
| 449 | Ga0495653_0093678 | 3300046463 | Bacteria | 2190 |
| 450 | Ga0495580_0007445 | 3300046472 | Bacteria | 8799 |
| 451 | Ga0495580_0049530 | 3300046472 | Bacteria | 2972 |
| 452 | Ga0495582_0031128 | 3300046473 | Bacteria | 2931 |
| 453 | Ga0495639_0001638 | 3300046475 | Bacteria | 9972 |
| 454 | Ga0495662_0010392 | 3300046476 | Bacteria | 4559 |
| 455 | Ga0495662_0068676 | 3300046476 | Bacteria | 1716 |
| 456 | Ga0495664_0000535 | 3300046477 | Bacteria | 19109 |
| 457 | Ga0495664_0010056 | 3300046477 | Bacteria | 5306 |
| 458 | Ga0495664_0010569 | 3300046477 | Bacteria | 5180 |
| 459 | Ga0495664_0039665 | 3300046477 | Bacteria | 2783 |
| 460 | Ga0495664_0046676 | 3300046477 | Bacteria | 2570 |
| 461 | Ga0495594_0002852 | 3300046499 | Bacteria | 8982 |
| 462 | Ga0495606_0001924 | 3300046507 | Bacteria | 25800 |
| 463 | Ga0495608_0002854 | 3300046511 | Bacteria | 12378 |
| 464 | Ga0495608_0028155 | 3300046511 | Bacteria | 3819 |
| 465 | Ga0495608_0030892 | 3300046511 | Bacteria | 3623 |
| 466 | Ga0495618_0005766 | 3300046514 | Bacteria | 7525 |
| 467 | Ga0495618_0039204 | 3300046514 | Bacteria | 2978 |
| 468 | Ga0495618_0093896 | 3300046514 | Bacteria | 1918 |
| 469 | Ga0495628_0103559 | 3300046516 | Bacteria | 2194 |
| 470 | Ga0495630_0000611 | 3300046517 | Bacteria | 25878 |
| 471 | Ga0495630_0072650 | 3300046517 | Bacteria | 2590 |
| 472 | Ga0495630_0074696 | 3300046517 | Bacteria | 2553 |
| 473 | Ga0495666_0000522 | 3300046526 | Bacteria | 17099 |
| 474 | Ga0495666_0001378 | 3300046526 | Bacteria | 11779 |
| 475 | Ga0495652_0008598 | 3300046529 | Bacteria | 9307 |
| 476 | Ga0495652_0017031 | 3300046529 | Bacteria | 6492 |
| 477 | Ga0495652_0023765 | 3300046529 | Bacteria | 5432 |
| 478 | Ga0495652_0045084 | 3300046529 | Bacteria | 3794 |
| 479 | Ga0495652_0130161 | 3300046529 | Bacteria | 1993 |
| 480 | Ga0495665_0003264 | 3300046531 | Bacteria | 8780 |
| 481 | Ga0495665_0004535 | 3300046531 | Bacteria | 7497 |
| 482 | Ga0495665_0013813 | 3300046531 | Bacteria | 4361 |
| 483 | Ga0495640_0008966 | 3300046533 | Bacteria | 7812 |
| 484 | Ga0495640_0027185 | 3300046533 | Bacteria | 4129 |
| 485 | Ga0495640_0027891 | 3300046533 | Bacteria | 4068 |
| 486 | Ga0495640_0064571 | 3300046533 | Bacteria | 2474 |
| 487 | Ga0495586_0000603 | 3300046535 | Bacteria | 20817 |
| 488 | Ga0495586_0011264 | 3300046535 | Bacteria | 4755 |
| 489 | Ga0495587_0005840 | 3300046536 | Bacteria | 8014 |
| 490 | Ga0495587_0014155 | 3300046536 | Bacteria | 5009 |
| 491 | Ga0495587_0019352 | 3300046536 | Bacteria | 4214 |
| 492 | Ga0495587_0057252 | 3300046536 | Bacteria | 2292 |
| 493 | Ga0495645_0002366 | 3300046543 | Bacteria | 12784 |
| 494 | Ga0495645_0013718 | 3300046543 | Bacteria | 5741 |
| 495 | Ga0495645_0114808 | 3300046543 | Bacteria | 1902 |
| 496 | Ga0495667_0000254 | 3300046559 | Bacteria | 34663 |
| 497 | Ga0495667_0002719 | 3300046559 | Bacteria | 11829 |
| 498 | Ga0495667_0004095 | 3300046559 | Bacteria | 9793 |
| 499 | Ga0495667_0034225 | 3300046559 | Bacteria | 3397 |
| 500 | Ga0495667_0069432 | 3300046559 | Bacteria | 2299 |
| 501 | Ga0495668_0000907 | 3300046616 | Bacteria | 33233 |
| 502 | Ga0495634_0008438 | 3300046642 | Bacteria | 7667 |
| 503 | Ga0495634_0027604 | 3300046642 | Bacteria | 3948 |
| 504 | Ga0495625_0001756 | 3300046660 | Bacteria | 25058 |
| 505 | Ga0495635_0007100 | 3300046663 | Bacteria | 7831 |
| 506 | Ga0495635_0009213 | 3300046663 | Bacteria | 6896 |
| 507 | Ga0495635_0012135 | 3300046663 | Bacteria | 6040 |
| 508 | Ga0495635_0043071 | 3300046663 | Bacteria | 3115 |
| 509 | Ga0495657_0008452 | 3300046675 | Bacteria | 7871 |
| 510 | Ga0495657_0019052 | 3300046675 | Bacteria | 4958 |
| 511 | Ga0495657_0030415 | 3300046675 | Bacteria | 3782 |
| 512 | Ga0495657_0030686 | 3300046675 | Bacteria | 3761 |
| 513 | Ga0495599_0012042 | 3300046678 | Bacteria | 5323 |
| 514 | Ga0495599_0012075 | 3300046678 | Bacteria | 5315 |
| 515 | Ga0495599_0109598 | 3300046678 | Bacteria | 1720 |
| 516 | Ga0495623_0027189 | 3300046679 | Bacteria | 3678 |
| 517 | Ga0495623_0031688 | 3300046679 | Bacteria | 3398 |
| 518 | Ga0495623_0058974 | 3300046679 | Bacteria | 2412 |
| 519 | Ga0495646_0077780 | 3300046680 | Bacteria | 1940 |
| 520 | Ga0495646_0097929 | 3300046680 | Bacteria | 1685 |
| 521 | Ga0495647_0016513 | 3300046681 | Bacteria | 2599 |
| 522 | Ga0495658_0006326 | 3300046683 | Bacteria | 5818 |
| 523 | Ga0495658_0049336 | 3300046683 | Bacteria | 2377 |
| 524 | Ga0495613_0021766 | 3300046689 | Bacteria | 4777 |
| 525 | Ga0495624_0002198 | 3300046690 | Bacteria | 14890 |
| 526 | Ga0495624_0005267 | 3300046690 | Bacteria | 9339 |
| 527 | Ga0495624_0035154 | 3300046690 | Bacteria | 3235 |
| 528 | Ga0495600_0003900 | 3300046809 | Bacteria | 8856 |
| 529 | Ga0495600_0022120 | 3300046809 | Bacteria | 4080 |
| 530 | Ga0495600_0023132 | 3300046809 | Bacteria | 3997 |
| 531 | Ga0495600_0067876 | 3300046809 | Bacteria | 2330 |
| 532 | Ga0495581_0023994 | 3300047315 | Bacteria | 3534 |
| 533 | Ga0495581_0068957 | 3300047315 | Bacteria | 2045 |
| 534 | Ga0495581_0100252 | 3300047315 | Bacteria | 1682 |
| 535 | Ga0495604_0021457 | 3300047317 | Bacteria | 5156 |
| 536 | Ga0495604_0035748 | 3300047317 | Bacteria | 3921 |
| 537 | Ga0495604_0121789 | 3300047317 | Bacteria | 1887 |
| 538 | Ga0495674_0000921 | 3300047319 | Bacteria | 28109 |
| 539 | Ga0495674_0003717 | 3300047319 | Bacteria | 14838 |
| 540 | Ga0495674_0029704 | 3300047319 | Bacteria | 4975 |
| 541 | Ga0495674_0066029 | 3300047319 | Bacteria | 3140 |
| 542 | Ga0495674_0123294 | 3300047319 | Bacteria | 2188 |
| 543 | Ga0495676_0012381 | 3300047321 | Bacteria | 7685 |
| 544 | Ga0495680_0001471 | 3300047322 | Bacteria | 25414 |
| 545 | Ga0495680_0005235 | 3300047322 | Bacteria | 12246 |
| 546 | Ga0495680_0005358 | 3300047322 | Bacteria | 12098 |
| 547 | Ga0495680_0016731 | 3300047322 | Bacteria | 6288 |
| 548 | Ga0495680_0028247 | 3300047322 | Bacteria | 4600 |
| 549 | Ga0495680_0057334 | 3300047322 | Bacteria | 3012 |
| 550 | Ga0495680_0094928 | 3300047322 | Bacteria | 2230 |
| 551 | Ga0495675_0019397 | 3300047444 | Bacteria | 4321 |
| 552 | Ga0495675_0042718 | 3300047444 | Bacteria | 2887 |
| 553 | Ga0495675_0062178 | 3300047444 | Bacteria | 2364 |
| 554 | Ga0495675_0096244 | 3300047444 | Bacteria | 1856 |
| 555 | Ga0495684_0002564 | 3300047471 | Bacteria | 14445 |
| 556 | Ga0495684_0034496 | 3300047471 | Bacteria | 3882 |
| 557 | Ga0495684_0037337 | 3300047471 | Bacteria | 3725 |
| 558 | Ga0495684_0120475 | 3300047471 | Bacteria | 1976 |
| 559 | Ga0495593_0001342 | 3300047673 | Bacteria | 14392 |
| 560 | Ga0495593_0003178 | 3300047673 | Bacteria | 9864 |
| 561 | Ga0495602_0075206 | 3300048088 | Bacteria | 2867 |
| 562 | Ga0495602_0081418 | 3300048088 | Bacteria | 2722 |
| 563 | Ga0495602_0130080 | 3300048088 | Bacteria | 2009 |
| 564 | Ga0495602_0144926 | 3300048088 | Bacteria | 1875 |
| 565 | Ga0495614_0013563 | 3300048089 | Bacteria | 3573 |
| 566 | Ga0495626_0000687 | 3300048091 | Bacteria | 32458 |
| 567 | Ga0496100_0052625 | 3300048903 | Bacteria | 2648 |
| 568 | Ga0496101_0053621 | 3300048904 | Bacteria | 2910 |
| 569 | Ga0496102_0017605 | 3300048905 | Bacteria | 6261 |
| 570 | Ga0496102_0065822 | 3300048905 | Bacteria | 3322 |
| 571 | Ga0496104_0026187 | 3300048907 | Bacteria | 5381 |
| 572 | Ga0496104_0112981 | 3300048907 | Bacteria | 2605 |
| 573 | Ga0496105_0004921 | 3300048908 | Bacteria | 10100 |
| 574 | Ga0496105_0009025 | 3300048908 | Bacteria | 7781 |
| 575 | Ga0496105_0010886 | 3300048908 | Bacteria | 7163 |
| 576 | Ga0496106_0160017 | 3300048909 | Bacteria | 1780 |
| 577 | Ga0496107_0022648 | 3300048910 | Bacteria | 4440 |
| 578 | Ga0496108_0003051 | 3300048911 | Bacteria | 13460 |
| 579 | Ga0496109_0000405 | 3300048912 | Bacteria | 38562 |
| 580 | Ga0496110_0005067 | 3300048913 | Bacteria | 10295 |
| 581 | Ga0496110_0012887 | 3300048913 | Bacteria | 6892 |
| 582 | Ga0496110_0056486 | 3300048913 | Bacteria | 3454 |
| 583 | Ga0496110_0316509 | 3300048913 | Bacteria | 1421 |
| 584 | Ga0496111_0000601 | 3300048914 | Bacteria | 18995 |
| 585 | Ga0496111_0002094 | 3300048914 | Bacteria | 11906 |
| 586 | Ga0496112_0119762 | 3300048915 | Bacteria | 2602 |
| 587 | Ga0496112_0176163 | 3300048915 | Bacteria | 2104 |
| 588 | Ga0496112_0185224 | 3300048915 | Bacteria | 2045 |
| 589 | Ga0496113_0088429 | 3300048916 | Bacteria | 2383 |
| 590 | Ga0496114_0037990 | 3300048917 | Bacteria | 3983 |
| 591 | Ga0496114_0143310 | 3300048917 | Bacteria | 2070 |
| 592 | Ga0496115_0089529 | 3300048918 | Bacteria | 2513 |
| 593 | Ga0496126_0000022 | 3300048929 | Bacteria | 464393 |
| 594 | Ga0501037_0025648 | 3300049573 | Bacteria | 4355 |
| 595 | Ga0501047_0013662 | 3300049581 | Bacteria | 7707 |
| 596 | Ga0501047_0019565 | 3300049581 | Bacteria | 6496 |
| 597 | Ga0501069_0001080 | 3300049585 | Bacteria | 13107 |
| 598 | Ga0501070_0001163 | 3300049586 | Bacteria | 23531 |
| 599 | Ga0501070_0008460 | 3300049586 | Bacteria | 8692 |
| 600 | Ga0501071_0121598 | 3300049587 | Bacteria | 1935 |
| 601 | Ga0501074_0006228 | 3300049590 | Bacteria | 8610 |
| 602 | Ga0501074_0109770 | 3300049590 | Bacteria | 1974 |
| 603 | Ga0501075_0095243 | 3300049591 | Bacteria | 2259 |
| 604 | Ga0501077_0029415 | 3300049593 | Bacteria | 3492 |
| 605 | Ga0501079_0000971 | 3300049741 | Bacteria | 19779 |
| 606 | Ga0501080_0000278 | 3300049742 | Bacteria | 38585 |
| 607 | Ga0501080_0016523 | 3300049742 | Bacteria | 6818 |
| 608 | Ga0501080_0070587 | 3300049742 | Bacteria | 3249 |
| 609 | Ga0501080_0071420 | 3300049742 | Bacteria | 3229 |
| 610 | Ga0501080_0202951 | 3300049742 | Bacteria | 1820 |
| 611 | nmdc:mga05p37_302149_c1 | 3300050507 | Bacteria | 1901 |
| 612 | nmdc:mga05p37_30312_c1 | 3300050507 | Bacteria | 6600 |
| 613 | nmdc:mga05p37_4438_c1 | 3300050507 | Bacteria | 16397 |
| 614 | nmdc:mga05p37_57310_c1 | 3300050507 | Bacteria | 4798 |
| 615 | nmdc:mga05p37_61_c1 | 3300050507 | Bacteria | 94943 |
| 616 | nmdc:mga09592_17_c1 | 3300050508 | Bacteria | 95560 |
| 617 | nmdc:mga09592_96400_c1 | 3300050508 | Bacteria | 2530 |
| 618 | nmdc:mga0qj67_1305_c1 | 3300050509 | Bacteria | 17488 |
| 619 | nmdc:mga0qj67_32_c1 | 3300050509 | Bacteria | 98555 |
| 620 | nmdc:mga06r32_19359_c1 | 3300050510 | Bacteria | 6244 |
| 621 | nmdc:mga06r32_26_c1 | 3300050510 | Bacteria | 90558 |
| 622 | nmdc:mga08y16_15394_c1 | 3300050511 | Bacteria | 8045 |
| 623 | nmdc:mga08y16_65187_c1 | 3300050511 | Bacteria | 3803 |
| 624 | nmdc:mga0n895_154302_c1 | 3300050512 | Bacteria | 2327 |
| 625 | nmdc:mga0n895_9045_c1 | 3300050512 | Bacteria | 8689 |
| 626 | nmdc:mga0rr50_1354_c1 | 3300050513 | Bacteria | 13386 |
| 627 | nmdc:mga0rr50_15487_c1 | 3300050513 | Bacteria | 5036 |
| 628 | nmdc:mga08x19_11432_c1 | 3300050514 | Bacteria | 5342 |
| 629 | nmdc:mga08x19_7000_c1 | 3300050514 | Bacteria | 6696 |
| 630 | nmdc:mga0a205_27716_c1 | 3300050515 | Bacteria | 5410 |
| 631 | Ga0495601_0077222 | 3300053077 | Bacteria | 2132 |
| 632 | Ga0495612_0004980 | 3300053078 | Bacteria | 5497 |
| 633 | Ga0495612_0042196 | 3300053078 | Bacteria | 1861 |
| 634 | Ga0495595_0001189 | 3300053084 | Bacteria | 10120 |
| 635 | Ga0495595_0037066 | 3300053084 | Bacteria | 2216 |
| 636 | Ga0495595_0064449 | 3300053084 | Bacteria | 1722 |
| 637 | Ga0495619_0011582 | 3300053085 | Bacteria | 5557 |
| 638 | Ga0500646_0000143 | 3300053090 | Bacteria | 21040 |
| 639 | Ga0500569_007291 | 3300053109 | Bacteria | 2473 |
| 640 | Ga0500568_0001871 | 3300053139 | Bacteria | 12963 |
| 641 | Ga0500588_0000517 | 3300053146 | Bacteria | 6189 |
| 642 | Ga0466962_0029201 | 3300061719 | Bacteria | 2639 |
| 643 | Ga0530510_0021801 | 3300061734 | Bacteria | 4559 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039437 | Ga0436365_0586466 | Ga0436365_0586466_635_1753 | 330 |
| 2 | 3300046454 | Ga0495592_0056451 | Ga0495592_0056451_584_1843 | 378 |
| 3 | 3300046514 | Ga0495618_0093896 | Ga0495618_0093896_416_1675 | 378 |
| 4 | 3300046529 | Ga0495652_0130161 | Ga0495652_0130161_196_1455 | 378 |
| 5 | 3300046536 | Ga0495587_0057252 | Ga0495587_0057252_532_1791 | 378 |
| 6 | 3300046559 | Ga0495667_0069432 | Ga0495667_0069432_487_1746 | 378 |
| 7 | 3300047322 | Ga0495680_0094928 | Ga0495680_0094928_592_1851 | 378 |
| 8 | 3300047471 | Ga0495684_0034496 | Ga0495684_0034496_2384_3643 | 378 |
| 9 | 3300048913 | Ga0496110_0316509 | Ga0496110_0316509_131_1402 | 380 |
| 10 | 3300005327 | Ga0070658_10042607 | Ga0070658_100426074 | 381 |
| 11 | 3300005441 | Ga0070700_100112604 | Ga0070700_1001126041 | 381 |
| 12 | 3300005563 | Ga0068855_100224284 | Ga0068855_1002242842 | 381 |
| 13 | 3300005577 | Ga0068857_100221950 | Ga0068857_1002219502 | 381 |
| 14 | 3300006173 | Ga0070716_100044210 | Ga0070716_1000442101 | 381 |
| 15 | 3300009174 | Ga0105241_10069806 | Ga0105241_100698063 | 381 |
| 16 | 3300025939 | Ga0207665_10029973 | Ga0207665_100299733 | 381 |
| 17 | 3300026121 | Ga0207683_10044813 | Ga0207683_100448134 | 381 |
| 18 | 3300048909 | Ga0496106_0160017 | Ga0496106_0160017_478_1752 | 381 |
| 19 | 3300005435 | Ga0070714_100083193 | Ga0070714_1000831932 | 382 |
| 20 | 3300005437 | Ga0070710_10073193 | Ga0070710_100731931 | 382 |
| 21 | 3300005530 | Ga0070679_100091365 | Ga0070679_1000913651 | 382 |
| 22 | 3300025929 | Ga0207664_10060279 | Ga0207664_100602792 | 382 |
| 23 | 3300005339 | Ga0070660_100025036 | Ga0070660_1000250363 | 383 |
| 24 | 3300025919 | Ga0207657_10032723 | Ga0207657_100327235 | 383 |
| 25 | 3300048088 | Ga0495602_0130080 | Ga0495602_0130080_225_1499 | 383 |
| 26 | 3300021384 | Ga0213876_10000552 | Ga0213876_1000055216 | 384 |
| 27 | 3300039437 | Ga0436365_1781586 | Ga0436365_1781586_32469_33740 | 384 |
| 28 | 3300046477 | Ga0495664_0046676 | Ga0495664_0046676_519_1859 | 385 |
| 29 | 3300047319 | Ga0495674_0123294 | Ga0495674_0123294_98_1438 | 385 |
| 30 | 3300047322 | Ga0495680_0005235 | Ga0495680_0005235_15_1292 | 385 |
| 31 | 3300005435 | Ga0070714_100193533 | Ga0070714_1001935332 | 386 |
| 32 | 3300025929 | Ga0207664_10190772 | Ga0207664_101907721 | 386 |
| 33 | 3300006847 | Ga0075431_100120206 | Ga0075431_1001202063 | 387 |
| 34 | 3300005336 | Ga0070680_100002227 | Ga0070680_1000022276 | 389 |
| 35 | 3300006844 | Ga0075428_100000598 | Ga0075428_1000005985 | 389 |
| 36 | 3300050510 | nmdc:mga06r32_19359_c1 | nmdc:mga06r32_19359_c1_501_1832 | 390 |
| 37 | 3300005468 | Ga0070707_100197809 | Ga0070707_1001978093 | 391 |
| 38 | 3300006028 | Ga0070717_10015393 | Ga0070717_100153936 | 391 |
| 39 | 3300007265 | Ga0099794_10006625 | Ga0099794_100066253 | 391 |
| 40 | 3300009147 | Ga0114129_10000272 | Ga0114129_1000027244 | 391 |
| 41 | 3300025922 | Ga0207646_10061146 | Ga0207646_100611461 | 391 |
| 42 | 3300050507 | nmdc:mga05p37_4438_c1 | nmdc:mga05p37_4438_c1_3995_5302 | 391 |
| 43 | 3300005354 | Ga0070675_100183577 | Ga0070675_1001835772 | 392 |
| 44 | 3300006844 | Ga0075428_100029853 | Ga0075428_1000298532 | 394 |
| 45 | 3300006847 | Ga0075431_100011144 | Ga0075431_1000111445 | 394 |
| 46 | 3300006880 | Ga0075429_100003184 | Ga0075429_10000318414 | 394 |
| 47 | 3300050507 | nmdc:mga05p37_30312_c1 | nmdc:mga05p37_30312_c1_1550_2845 | 394 |
| 48 | 3300013308 | Ga0157375_10050374 | Ga0157375_100503743 | 395 |
| 49 | 3300048905 | Ga0496102_0065822 | Ga0496102_0065822_1096_2436 | 395 |
| 50 | 3300048915 | Ga0496112_0119762 | Ga0496112_0119762_935_2275 | 395 |
| 51 | 3300006880 | Ga0075429_100033013 | Ga0075429_1000330132 | 396 |
| 52 | 3300009147 | Ga0114129_10020083 | Ga0114129_100200839 | 396 |
| 53 | 3300049573 | Ga0501037_0025648 | Ga0501037_0025648_2385_3740 | 396 |
| 54 | 3300049742 | Ga0501080_0202951 | Ga0501080_0202951_317_1699 | 396 |
| 55 | 3300046477 | Ga0495664_0039665 | Ga0495664_0039665_667_2052 | 397 |
| 56 | 3300053139 | Ga0500568_0001871 | Ga0500568_0001871_10383_11720 | 397 |
| 57 | 3300005471 | Ga0070698_100061318 | Ga0070698_1000613184 | 398 |
| 58 | 3300034957 | Ga0373938_0016256 | Ga0373938_0016256_35_1366 | 398 |
| 59 | 3300044684 | Ga0466966_0000704 | Ga0466966_0000704_12300_13643 | 398 |
| 60 | 3300044842 | Ga0466957_0000234 | Ga0466957_0000234_10170_11513 | 398 |
| 61 | 3300045836 | Ga0466958_0002622 | Ga0466958_0002622_1989_3332 | 398 |
| 62 | 3300045976 | Ga0466967_0054920 | Ga0466967_0054920_1161_2504 | 398 |
| 63 | iso_pu_bacteria | 2856741275 | 2856743151 | 398 |
| 64 | iso_pu_bacteria | 2856858025 | 2856859730 | 398 |
| 65 | iso_pu_bacteria | 2891395885 | 2891401155 | 398 |
| 66 | iso_pu_bacteria | 2891554331 | 2891559845 | 398 |
| 67 | iso_pu_bacteria | 2891562705 | 2891566054 | 398 |
| 68 | iso_pu_bacteria | 3002998708 | 3002999615 | 398 |
| 69 | iso_pu_bacteria | 8053945823 | 8053946516 | 398 |
| 70 | 3300005334 | Ga0068869_100068633 | Ga0068869_1000686332 | 399 |
| 71 | 3300005338 | Ga0068868_100020944 | Ga0068868_1000209444 | 399 |
| 72 | 3300005366 | Ga0070659_100000886 | Ga0070659_10000088622 | 399 |
| 73 | 3300005435 | Ga0070714_100000319 | Ga0070714_1000003196 | 399 |
| 74 | 3300005436 | Ga0070713_100046651 | Ga0070713_1000466512 | 399 |
| 75 | 3300005983 | Ga0081540_1000207 | Ga0081540_100020759 | 399 |
| 76 | 3300005983 | Ga0081540_1018761 | Ga0081540_10187612 | 399 |
| 77 | 3300006028 | Ga0070717_10026141 | Ga0070717_100261413 | 399 |
| 78 | 3300013105 | Ga0157369_10008009 | Ga0157369_1000800910 | 399 |
| 79 | 3300021384 | Ga0213876_10000193 | Ga0213876_1000019346 | 399 |
| 80 | 3300025928 | Ga0207700_10027643 | Ga0207700_100276433 | 399 |
| 81 | 3300025929 | Ga0207664_10000218 | Ga0207664_1000021836 | 399 |
| 82 | 3300025932 | Ga0207690_10000393 | Ga0207690_1000039321 | 399 |
| 83 | 3300025942 | Ga0207689_10083080 | Ga0207689_100830802 | 399 |
| 84 | 3300026023 | Ga0207677_10011954 | Ga0207677_100119543 | 399 |
| 85 | 3300031616 | Ga0307508_10042719 | Ga0307508_100427193 | 399 |
| 86 | 3300034957 | Ga0373938_0005385 | Ga0373938_0005385_569_1912 | 399 |
| 87 | 3300035695 | Ga0373927_0000125 | Ga0373927_0000125_49574_50920 | 399 |
| 88 | 3300037068 | Ga0373925_0000003 | Ga0373925_0000003_230889_232235 | 399 |
| 89 | 3300037853 | Ga0436364_1201672 | Ga0436364_1201672_125_1450 | 399 |
| 90 | 3300039437 | Ga0436365_0115299 | Ga0436365_0115299_25479_26804 | 399 |
| 91 | 3300039450 | Ga0436363_0294318 | Ga0436363_0294318_214_1539 | 399 |
| 92 | 3300044735 | Ga0466968_0000465 | Ga0466968_0000465_404_1741 | 399 |
| 93 | 3300045976 | Ga0466967_0000475 | Ga0466967_0000475_5460_6797 | 399 |
| 94 | 3300046459 | Ga0495629_0072822 | Ga0495629_0072822_690_2039 | 399 |
| 95 | 3300046499 | Ga0495594_0002852 | Ga0495594_0002852_5576_6925 | 399 |
| 96 | 3300005985 | Ga0081539_10003770 | Ga0081539_1000377018 | 400 |
| 97 | 3300013102 | Ga0157371_10067364 | Ga0157371_100673642 | 400 |
| 98 | 3300021388 | Ga0213875_10000218 | Ga0213875_1000021832 | 400 |
| 99 | 3300028794 | Ga0307515_10103289 | Ga0307515_101032893 | 400 |
| 100 | 3300031247 | Ga0265340_10000457 | Ga0265340_1000045723 | 400 |
| 101 | 3300031616 | Ga0307508_10006410 | Ga0307508_100064103 | 400 |
| 102 | 3300035086 | Ga0373934_0010850 | Ga0373934_0010850_1410_2741 | 400 |
| 103 | 3300035089 | Ga0373944_0002781 | Ga0373944_0002781_2675_4006 | 400 |
| 104 | 3300035111 | Ga0373923_0002491 | Ga0373923_0002491_3644_4975 | 400 |
| 105 | 3300035114 | Ga0373939_0011898 | Ga0373939_0011898_234_1565 | 400 |
| 106 | 3300035170 | Ga0373943_0018423 | Ga0373943_0018423_304_1635 | 400 |
| 107 | 3300035171 | Ga0373946_0012619 | Ga0373946_0012619_228_1559 | 400 |
| 108 | 3300035171 | Ga0373946_0049706 | Ga0373946_0049706_50_1381 | 400 |
| 109 | 3300035172 | Ga0373955_0041133 | Ga0373955_0041133_228_1559 | 400 |
| 110 | 3300035410 | Ga0373924_0028597 | Ga0373924_0028597_59_1390 | 400 |
| 111 | 3300035692 | Ga0373935_0021620 | Ga0373935_0021620_1037_2368 | 400 |
| 112 | 3300035725 | Ga0373947_0009658 | Ga0373947_0009658_1334_2665 | 400 |
| 113 | 3300037068 | Ga0373925_0045436 | Ga0373925_0045436_1334_2665 | 400 |
| 114 | 3300037312 | Ga0395899_0006633 | Ga0395899_0006633_1563_2903 | 400 |
| 115 | 3300037853 | Ga0436364_0538624 | Ga0436364_0538624_41370_42707 | 400 |
| 116 | 3300039437 | Ga0436365_0083635 | Ga0436365_0083635_2039_3376 | 400 |
| 117 | 3300046454 | Ga0495592_0063346 | Ga0495592_0063346_1231_2562 | 400 |
| 118 | 3300046455 | Ga0495603_0005396 | Ga0495603_0005396_4135_5466 | 400 |
| 119 | 3300046459 | Ga0495629_0058089 | Ga0495629_0058089_117_1448 | 400 |
| 120 | 3300046461 | Ga0495641_0032936 | Ga0495641_0032936_76_1407 | 400 |
| 121 | 3300046463 | Ga0495653_0016859 | Ga0495653_0016859_4202_5533 | 400 |
| 122 | 3300046472 | Ga0495580_0049530 | Ga0495580_0049530_109_1440 | 400 |
| 123 | 3300046473 | Ga0495582_0031128 | Ga0495582_0031128_94_1425 | 400 |
| 124 | 3300046475 | Ga0495639_0001638 | Ga0495639_0001638_3946_5277 | 400 |
| 125 | 3300046476 | Ga0495662_0010392 | Ga0495662_0010392_2184_3515 | 400 |
| 126 | 3300046477 | Ga0495664_0010056 | Ga0495664_0010056_2873_4204 | 400 |
| 127 | 3300046511 | Ga0495608_0028155 | Ga0495608_0028155_1231_2562 | 400 |
| 128 | 3300046514 | Ga0495618_0005766 | Ga0495618_0005766_598_1929 | 400 |
| 129 | 3300046517 | Ga0495630_0000611 | Ga0495630_0000611_11037_12368 | 400 |
| 130 | 3300046526 | Ga0495666_0001378 | Ga0495666_0001378_2420_3751 | 400 |
| 131 | 3300046529 | Ga0495652_0045084 | Ga0495652_0045084_1334_2665 | 400 |
| 132 | 3300046531 | Ga0495665_0003264 | Ga0495665_0003264_7296_8627 | 400 |
| 133 | 3300046533 | Ga0495640_0008966 | Ga0495640_0008966_541_1872 | 400 |
| 134 | 3300046535 | Ga0495586_0000603 | Ga0495586_0000603_4603_5934 | 400 |
| 135 | 3300046536 | Ga0495587_0014155 | Ga0495587_0014155_2318_3649 | 400 |
| 136 | 3300046543 | Ga0495645_0002366 | Ga0495645_0002366_11383_12714 | 400 |
| 137 | 3300046642 | Ga0495634_0008438 | Ga0495634_0008438_519_1850 | 400 |
| 138 | 3300046663 | Ga0495635_0012135 | Ga0495635_0012135_4031_5362 | 400 |
| 139 | 3300046675 | Ga0495657_0030686 | Ga0495657_0030686_103_1434 | 400 |
| 140 | 3300046678 | Ga0495599_0012075 | Ga0495599_0012075_1369_2700 | 400 |
| 141 | 3300046679 | Ga0495623_0031688 | Ga0495623_0031688_1920_3251 | 400 |
| 142 | 3300046680 | Ga0495646_0097929 | Ga0495646_0097929_253_1584 | 400 |
| 143 | 3300046681 | Ga0495647_0016513 | Ga0495647_0016513_12_1343 | 400 |
| 144 | 3300046683 | Ga0495658_0006326 | Ga0495658_0006326_35_1366 | 400 |
| 145 | 3300046690 | Ga0495624_0035154 | Ga0495624_0035154_104_1435 | 400 |
| 146 | 3300046809 | Ga0495600_0067876 | Ga0495600_0067876_71_1402 | 400 |
| 147 | 3300047315 | Ga0495581_0100252 | Ga0495581_0100252_99_1430 | 400 |
| 148 | 3300047322 | Ga0495680_0016731 | Ga0495680_0016731_4577_5908 | 400 |
| 149 | 3300047471 | Ga0495684_0037337 | Ga0495684_0037337_1793_3124 | 400 |
| 150 | 3300047673 | Ga0495593_0001342 | Ga0495593_0001342_12837_14168 | 400 |
| 151 | 3300048089 | Ga0495614_0013563 | Ga0495614_0013563_2205_3536 | 400 |
| 152 | 3300048908 | Ga0496105_0009025 | Ga0496105_0009025_594_1925 | 400 |
| 153 | 3300048913 | Ga0496110_0056486 | Ga0496110_0056486_272_1603 | 400 |
| 154 | 3300048918 | Ga0496115_0089529 | Ga0496115_0089529_1147_2478 | 400 |
| 155 | 3300053077 | Ga0495601_0077222 | Ga0495601_0077222_325_1656 | 400 |
| 156 | 3300053078 | Ga0495612_0004980 | Ga0495612_0004980_3749_5080 | 400 |
| 157 | 3300053084 | Ga0495595_0064449 | Ga0495595_0064449_72_1403 | 400 |
| 158 | 3300053085 | Ga0495619_0011582 | Ga0495619_0011582_4112_5443 | 400 |
| 159 | iso_pu_bacteria | 2861520306 | 2861526612 | 400 |
| 160 | iso_pu_bacteria | 8002811521 | 8002813553 | 400 |
| 161 | iso_pu_bacteria | 8057568493 | 8057574530 | 400 |
| 162 | 3300005347 | Ga0070668_100181420 | Ga0070668_1001814201 | 401 |
| 163 | 3300005843 | Ga0068860_100014937 | Ga0068860_1000149374 | 401 |
| 164 | 3300031507 | Ga0307509_10061343 | Ga0307509_100613432 | 401 |
| 165 | 3300044765 | Ga0466970_0007026 | Ga0466970_0007026_311_1648 | 401 |
| 166 | 3300046472 | Ga0495580_0007445 | Ga0495580_0007445_2816_4153 | 401 |
| 167 | 3300046526 | Ga0495666_0000522 | Ga0495666_0000522_15036_16373 | 401 |
| 168 | 3300046531 | Ga0495665_0004535 | Ga0495665_0004535_2955_4292 | 401 |
| 169 | 3300003203 | JGI25406J46586_10001944 | JGI25406J46586_100019444 | 402 |
| 170 | 3300005327 | Ga0070658_10045142 | Ga0070658_100451423 | 402 |
| 171 | 3300005329 | Ga0070683_100000557 | Ga0070683_1000005579 | 402 |
| 172 | 3300005329 | Ga0070683_100059441 | Ga0070683_1000594413 | 402 |
| 173 | 3300005367 | Ga0070667_100158779 | Ga0070667_1001587792 | 402 |
| 174 | 3300005435 | Ga0070714_100060055 | Ga0070714_1000600553 | 402 |
| 175 | 3300005445 | Ga0070708_100096977 | Ga0070708_1000969773 | 402 |
| 176 | 3300005458 | Ga0070681_10065012 | Ga0070681_100650123 | 402 |
| 177 | 3300005459 | Ga0068867_100025176 | Ga0068867_1000251763 | 402 |
| 178 | 3300005468 | Ga0070707_100048768 | Ga0070707_1000487683 | 402 |
| 179 | 3300005518 | Ga0070699_100277324 | Ga0070699_1002773241 | 402 |
| 180 | 3300005535 | Ga0070684_100007875 | Ga0070684_1000078754 | 402 |
| 181 | 3300005983 | Ga0081540_1000517 | Ga0081540_100051712 | 402 |
| 182 | 3300005985 | Ga0081539_10000809 | Ga0081539_1000080936 | 402 |
| 183 | 3300006844 | Ga0075428_100007643 | Ga0075428_1000076433 | 402 |
| 184 | 3300006844 | Ga0075428_100197116 | Ga0075428_1001971162 | 402 |
| 185 | 3300006846 | Ga0075430_100001817 | Ga0075430_1000018177 | 402 |
| 186 | 3300006846 | Ga0075430_100004049 | Ga0075430_1000040493 | 402 |
| 187 | 3300006847 | Ga0075431_100004612 | Ga0075431_1000046125 | 402 |
| 188 | 3300006880 | Ga0075429_100001920 | Ga0075429_10000192014 | 402 |
| 189 | 3300009147 | Ga0114129_10000557 | Ga0114129_1000055716 | 402 |
| 190 | 3300020081 | Ga0206354_10180487 | Ga0206354_101804872 | 402 |
| 191 | 3300020082 | Ga0206353_10443563 | Ga0206353_104435632 | 402 |
| 192 | 3300021358 | Ga0213873_10000068 | Ga0213873_1000006816 | 402 |
| 193 | 3300025909 | Ga0207705_10119778 | Ga0207705_101197782 | 402 |
| 194 | 3300025917 | Ga0207660_10191895 | Ga0207660_101918952 | 402 |
| 195 | 3300025929 | Ga0207664_10027036 | Ga0207664_100270362 | 402 |
| 196 | 3300025944 | Ga0207661_10041617 | Ga0207661_100416173 | 402 |
| 197 | 3300025944 | Ga0207661_10063571 | Ga0207661_100635712 | 402 |
| 198 | 3300028800 | Ga0265338_10054526 | Ga0265338_100545264 | 402 |
| 199 | 3300031241 | Ga0265325_10009579 | Ga0265325_100095795 | 402 |
| 200 | 3300031344 | Ga0265316_10024470 | Ga0265316_100244702 | 402 |
| 201 | 3300031456 | Ga0307513_10048880 | Ga0307513_100488802 | 402 |
| 202 | 3300031456 | Ga0307513_10144174 | Ga0307513_101441742 | 402 |
| 203 | 3300031456 | Ga0307513_10180230 | Ga0307513_101802302 | 402 |
| 204 | 3300031616 | Ga0307508_10040674 | Ga0307508_100406741 | 402 |
| 205 | 3300033179 | Ga0307507_10139828 | Ga0307507_101398282 | 402 |
| 206 | 3300035112 | Ga0373932_0004457 | Ga0373932_0004457_419_1759 | 402 |
| 207 | 3300035207 | Ga0373942_0000279 | Ga0373942_0000279_1904_3241 | 402 |
| 208 | 3300036401 | Ga0373937_0071089 | Ga0373937_0071089_996_2339 | 402 |
| 209 | 3300037853 | Ga0436364_1394109 | Ga0436364_1394109_956_2512 | 402 |
| 210 | 3300039453 | Ga0436362_0358937 | Ga0436362_0358937_6496_7833 | 402 |
| 211 | 3300044694 | Ga0466963_0093382 | Ga0466963_0093382_188_1531 | 402 |
| 212 | 3300045976 | Ga0466967_0024008 | Ga0466967_0024008_274_1617 | 402 |
| 213 | 3300049581 | Ga0501047_0019565 | Ga0501047_0019565_2265_3605 | 402 |
| 214 | 3300049593 | Ga0501077_0029415 | Ga0501077_0029415_166_1506 | 402 |
| 215 | 3300050507 | nmdc:mga05p37_61_c1 | nmdc:mga05p37_61_c1_72931_74268 | 402 |
| 216 | 3300050508 | nmdc:mga09592_17_c1 | nmdc:mga09592_17_c1_17266_18603 | 402 |
| 217 | 3300050509 | nmdc:mga0qj67_1305_c1 | nmdc:mga0qj67_1305_c1_10161_11498 | 402 |
| 218 | 3300050509 | nmdc:mga0qj67_32_c1 | nmdc:mga0qj67_32_c1_20261_21598 | 402 |
| 219 | 3300050510 | nmdc:mga06r32_26_c1 | nmdc:mga06r32_26_c1_16290_17627 | 402 |
| 220 | 3300053084 | Ga0495595_0037066 | Ga0495595_0037066_322_1650 | 402 |
| 221 | 3300053090 | Ga0500646_0000143 | Ga0500646_0000143_14710_16053 | 402 |
| 222 | 3300053146 | Ga0500588_0000517 | Ga0500588_0000517_1160_2503 | 402 |
| 223 | iso_pu_bacteria | 2515154088 | 2515498034 | 402 |
| 224 | iso_pu_bacteria | 2515154129 | 2515721804 | 402 |
| 225 | iso_pu_bacteria | 2515154137 | 2515756209 | 402 |
| 226 | iso_pu_bacteria | 2515154202 | 2516086836 | 402 |
| 227 | iso_pu_bacteria | 2515154203 | 2516092154 | 402 |
| 228 | iso_pu_bacteria | 2675903059 | 2676486935 | 402 |
| 229 | iso_pu_bacteria | 2772190715 | 2772642777 | 402 |
| 230 | iso_pu_bacteria | 2831935698 | 2831940948 | 402 |
| 231 | iso_pu_bacteria | 2832004796 | 2832005278 | 402 |
| 232 | iso_pu_bacteria | 2855670206 | 2855674368 | 402 |
| 233 | iso_pu_bacteria | 2855676851 | 2855679709 | 402 |
| 234 | iso_pu_bacteria | 2855683550 | 2855685710 | 402 |
| 235 | iso_pu_bacteria | 2857288857 | 2857290616 | 402 |
| 236 | iso_pu_bacteria | 2858848962 | 2858854632 | 402 |
| 237 | iso_pu_bacteria | 2858882152 | 2858885032 | 402 |
| 238 | iso_pu_bacteria | 2858888857 | 2858891828 | 402 |
| 239 | iso_pu_bacteria | 2858895516 | 2858899605 | 402 |
| 240 | iso_pu_bacteria | 2866065130 | 2866069593 | 402 |
| 241 | iso_pu_bacteria | 2867312974 | 2867318952 | 402 |
| 242 | iso_pu_bacteria | 2867319477 | 2867323898 | 402 |
| 243 | iso_pu_bacteria | 2869048445 | 2869049318 | 402 |
| 244 | iso_pu_bacteria | 2869061728 | 2869064065 | 402 |
| 245 | iso_pu_bacteria | 2869068681 | 2869072711 | 402 |
| 246 | iso_pu_bacteria | 2873314349 | 2873317087 | 402 |
| 247 | iso_pu_bacteria | 2880489317 | 2880494412 | 402 |
| 248 | iso_pu_bacteria | 2880495981 | 2880497898 | 402 |
| 249 | iso_pu_bacteria | 2887478801 | 2887484383 | 402 |
| 250 | iso_pu_bacteria | 2902582711 | 2902588588 | 402 |
| 251 | iso_pu_bacteria | 2929219909 | 2929219958 | 402 |
| 252 | iso_pu_bacteria | 2929226422 | 2929226473 | 402 |
| 253 | iso_pu_bacteria | 2996221748 | 2996225908 | 402 |
| 254 | iso_pu_bacteria | 8001781756 | 8001782886 | 402 |
| 255 | iso_pu_bacteria | 8054704163 | 8054710547 | 402 |
| 256 | iso_pu_bacteria | 8054734606 | 8054740535 | 402 |
| 257 | 3300005439 | Ga0070711_100166223 | Ga0070711_1001662231 | 403 |
| 258 | 3300005445 | Ga0070708_100060710 | Ga0070708_1000607103 | 403 |
| 259 | 3300005467 | Ga0070706_100011220 | Ga0070706_1000112203 | 403 |
| 260 | 3300005468 | Ga0070707_100001180 | Ga0070707_1000011804 | 403 |
| 261 | 3300005536 | Ga0070697_100039861 | Ga0070697_1000398614 | 403 |
| 262 | 3300005985 | Ga0081539_10001196 | Ga0081539_1000119643 | 403 |
| 263 | 3300009147 | Ga0114129_10132722 | Ga0114129_101327223 | 403 |
| 264 | 3300013306 | Ga0163162_10085493 | Ga0163162_100854933 | 403 |
| 265 | 3300025910 | Ga0207684_10040619 | Ga0207684_100406194 | 403 |
| 266 | 3300025922 | Ga0207646_10003773 | Ga0207646_100037734 | 403 |
| 267 | 3300028786 | Ga0307517_10039180 | Ga0307517_100391803 | 403 |
| 268 | 3300028794 | Ga0307515_10005285 | Ga0307515_100052853 | 403 |
| 269 | 3300030522 | Ga0307512_10007735 | Ga0307512_100077356 | 403 |
| 270 | 3300030522 | Ga0307512_10015066 | Ga0307512_100150662 | 403 |
| 271 | 3300031616 | Ga0307508_10014514 | Ga0307508_100145143 | 403 |
| 272 | 3300031616 | Ga0307508_10134323 | Ga0307508_101343232 | 403 |
| 273 | 3300031824 | Ga0307413_10010370 | Ga0307413_100103704 | 403 |
| 274 | 3300031889 | Ga0326468_10000567 | Ga0326468_100005673 | 403 |
| 275 | 3300031901 | Ga0307406_10006740 | Ga0307406_100067403 | 403 |
| 276 | 3300031901 | Ga0307406_10024910 | Ga0307406_100249101 | 403 |
| 277 | 3300031995 | Ga0307409_100010423 | Ga0307409_1000104233 | 403 |
| 278 | 3300032005 | Ga0307411_10061973 | Ga0307411_100619733 | 403 |
| 279 | 3300035091 | Ga0373951_0000035 | Ga0373951_0000035_12733_14070 | 403 |
| 280 | 3300035172 | Ga0373955_0059780 | Ga0373955_0059780_607_1950 | 403 |
| 281 | 3300036401 | Ga0373937_0091119 | Ga0373937_0091119_506_1876 | 403 |
| 282 | 3300037068 | Ga0373925_0120359 | Ga0373925_0120359_216_1601 | 403 |
| 283 | 3300037312 | Ga0395899_0031133 | Ga0395899_0031133_2373_3731 | 403 |
| 284 | 3300037418 | Ga0395900_0004495 | Ga0395900_0004495_3450_4808 | 403 |
| 285 | 3300037466 | Ga0395898_0010093 | Ga0395898_0010093_69_1427 | 403 |
| 286 | 3300037471 | Ga0395905_0014282 | Ga0395905_0014282_2386_3744 | 403 |
| 287 | 3300037853 | Ga0436364_0386143 | Ga0436364_0386143_162_1520 | 403 |
| 288 | 3300038443 | Ga0395901_0013285 | Ga0395901_0013285_69_1427 | 403 |
| 289 | 3300044658 | Ga0466972_0001392 | Ga0466972_0001392_474_1847 | 403 |
| 290 | 3300044684 | Ga0466966_0026923 | Ga0466966_0026923_331_1704 | 403 |
| 291 | 3300044719 | Ga0466971_0006211 | Ga0466971_0006211_2212_3585 | 403 |
| 292 | 3300046462 | Ga0495651_0002251 | Ga0495651_0002251_11653_13023 | 403 |
| 293 | 3300046463 | Ga0495653_0001970 | Ga0495653_0001970_7301_8671 | 403 |
| 294 | 3300046511 | Ga0495608_0002854 | Ga0495608_0002854_8744_10114 | 403 |
| 295 | 3300046516 | Ga0495628_0103559 | Ga0495628_0103559_377_1747 | 403 |
| 296 | 3300046529 | Ga0495652_0008598 | Ga0495652_0008598_7161_8531 | 403 |
| 297 | 3300046533 | Ga0495640_0027185 | Ga0495640_0027185_2327_3697 | 403 |
| 298 | 3300046536 | Ga0495587_0019352 | Ga0495587_0019352_1854_3224 | 403 |
| 299 | 3300046559 | Ga0495667_0000254 | Ga0495667_0000254_2261_3631 | 403 |
| 300 | 3300046663 | Ga0495635_0043071 | Ga0495635_0043071_1085_2455 | 403 |
| 301 | 3300046675 | Ga0495657_0008452 | Ga0495657_0008452_319_1689 | 403 |
| 302 | 3300046809 | Ga0495600_0003900 | Ga0495600_0003900_5991_7361 | 403 |
| 303 | 3300047317 | Ga0495604_0021457 | Ga0495604_0021457_261_1631 | 403 |
| 304 | 3300047319 | Ga0495674_0003717 | Ga0495674_0003717_5976_7346 | 403 |
| 305 | 3300047322 | Ga0495680_0001471 | Ga0495680_0001471_24004_25374 | 403 |
| 306 | 3300047444 | Ga0495675_0062178 | Ga0495675_0062178_764_2134 | 403 |
| 307 | 3300047471 | Ga0495684_0120475 | Ga0495684_0120475_236_1606 | 403 |
| 308 | 3300048088 | Ga0495602_0075206 | Ga0495602_0075206_236_1606 | 403 |
| 309 | 3300048917 | Ga0496114_0037990 | Ga0496114_0037990_903_2243 | 403 |
| 310 | 3300049581 | Ga0501047_0013662 | Ga0501047_0013662_625_1974 | 403 |
| 311 | 3300049586 | Ga0501070_0001163 | Ga0501070_0001163_9012_10346 | 403 |
| 312 | 3300049590 | Ga0501074_0006228 | Ga0501074_0006228_6450_7784 | 403 |
| 313 | 3300049741 | Ga0501079_0000971 | Ga0501079_0000971_5434_6768 | 403 |
| 314 | 3300049742 | Ga0501080_0000278 | Ga0501080_0000278_28969_30303 | 403 |
| 315 | 3300050507 | nmdc:mga05p37_302149_c1 | nmdc:mga05p37_302149_c1_353_1732 | 403 |
| 316 | 3300053109 | Ga0500569_007291 | Ga0500569_007291_854_2191 | 403 |
| 317 | iso_pu_bacteria | 8003870546 | 8003873731 | 403 |
| 318 | iso_pu_bacteria | 8055066027 | 8055073391 | 403 |
| 319 | iso_pu_bacteria | 8055172936 | 8055175846 | 403 |
| 320 | 3300005329 | Ga0070683_100006507 | Ga0070683_1000065076 | 404 |
| 321 | 3300005334 | Ga0068869_100004358 | Ga0068869_1000043584 | 404 |
| 322 | 3300005339 | Ga0070660_100021974 | Ga0070660_1000219745 | 404 |
| 323 | 3300005343 | Ga0070687_100077703 | Ga0070687_1000777031 | 404 |
| 324 | 3300005347 | Ga0070668_100006041 | Ga0070668_1000060416 | 404 |
| 325 | 3300005354 | Ga0070675_100000851 | Ga0070675_1000008519 | 404 |
| 326 | 3300005364 | Ga0070673_100078002 | Ga0070673_1000780021 | 404 |
| 327 | 3300005366 | Ga0070659_100016339 | Ga0070659_1000163392 | 404 |
| 328 | 3300005366 | Ga0070659_100120145 | Ga0070659_1001201452 | 404 |
| 329 | 3300005440 | Ga0070705_100046324 | Ga0070705_1000463243 | 404 |
| 330 | 3300005441 | Ga0070700_100004088 | Ga0070700_1000040886 | 404 |
| 331 | 3300005455 | Ga0070663_100014634 | Ga0070663_1000146342 | 404 |
| 332 | 3300005457 | Ga0070662_100098811 | Ga0070662_1000988112 | 404 |
| 333 | 3300005471 | Ga0070698_100107989 | Ga0070698_1001079891 | 404 |
| 334 | 3300005535 | Ga0070684_100004299 | Ga0070684_1000042991 | 404 |
| 335 | 3300005539 | Ga0068853_100042610 | Ga0068853_1000426104 | 404 |
| 336 | 3300005543 | Ga0070672_100011916 | Ga0070672_1000119163 | 404 |
| 337 | 3300005545 | Ga0070695_100022226 | Ga0070695_1000222262 | 404 |
| 338 | 3300005564 | Ga0070664_100000617 | Ga0070664_10000061716 | 404 |
| 339 | 3300005577 | Ga0068857_100045321 | Ga0068857_1000453214 | 404 |
| 340 | 3300005578 | Ga0068854_100058231 | Ga0068854_1000582313 | 404 |
| 341 | 3300005615 | Ga0070702_100060131 | Ga0070702_1000601312 | 404 |
| 342 | 3300005719 | Ga0068861_100032455 | Ga0068861_1000324554 | 404 |
| 343 | 3300005719 | Ga0068861_100070616 | Ga0068861_1000706163 | 404 |
| 344 | 3300005844 | Ga0068862_100020398 | Ga0068862_1000203982 | 404 |
| 345 | 3300005985 | Ga0081539_10096472 | Ga0081539_100964722 | 404 |
| 346 | 3300006880 | Ga0075429_100247561 | Ga0075429_1002475612 | 404 |
| 347 | 3300007788 | Ga0099795_10028181 | Ga0099795_100281811 | 404 |
| 348 | 3300009093 | Ga0105240_10273158 | Ga0105240_102731582 | 404 |
| 349 | 3300009094 | Ga0111539_10007767 | Ga0111539_100077678 | 404 |
| 350 | 3300009098 | Ga0105245_10011036 | Ga0105245_100110365 | 404 |
| 351 | 3300010375 | Ga0105239_10190039 | Ga0105239_101900392 | 404 |
| 352 | 3300013105 | Ga0157369_10007654 | Ga0157369_100076547 | 404 |
| 353 | 3300021388 | Ga0213875_10000428 | Ga0213875_1000042834 | 404 |
| 354 | 3300025901 | Ga0207688_10006713 | Ga0207688_100067135 | 404 |
| 355 | 3300025908 | Ga0207643_10008004 | Ga0207643_100080045 | 404 |
| 356 | 3300025912 | Ga0207707_10046384 | Ga0207707_100463842 | 404 |
| 357 | 3300025915 | Ga0207693_10006051 | Ga0207693_100060519 | 404 |
| 358 | 3300025916 | Ga0207663_10118993 | Ga0207663_101189932 | 404 |
| 359 | 3300025918 | Ga0207662_10004219 | Ga0207662_100042195 | 404 |
| 360 | 3300025919 | Ga0207657_10054307 | Ga0207657_100543073 | 404 |
| 361 | 3300025926 | Ga0207659_10004144 | Ga0207659_100041447 | 404 |
| 362 | 3300025927 | Ga0207687_10009534 | Ga0207687_100095343 | 404 |
| 363 | 3300025929 | Ga0207664_10012976 | Ga0207664_100129763 | 404 |
| 364 | 3300025932 | Ga0207690_10090079 | Ga0207690_100900792 | 404 |
| 365 | 3300025932 | Ga0207690_10090596 | Ga0207690_100905962 | 404 |
| 366 | 3300025933 | Ga0207706_10027305 | Ga0207706_100273053 | 404 |
| 367 | 3300025933 | Ga0207706_10104977 | Ga0207706_101049773 | 404 |
| 368 | 3300025939 | Ga0207665_10011920 | Ga0207665_100119201 | 404 |
| 369 | 3300025940 | Ga0207691_10013128 | Ga0207691_100131284 | 404 |
| 370 | 3300025942 | Ga0207689_10001161 | Ga0207689_100011615 | 404 |
| 371 | 3300025942 | Ga0207689_10011945 | Ga0207689_100119455 | 404 |
| 372 | 3300025944 | Ga0207661_10008848 | Ga0207661_100088483 | 404 |
| 373 | 3300025945 | Ga0207679_10002759 | Ga0207679_100027592 | 404 |
| 374 | 3300025972 | Ga0207668_10001164 | Ga0207668_100011643 | 404 |
| 375 | 3300026035 | Ga0207703_10159360 | Ga0207703_101593603 | 404 |
| 376 | 3300026067 | Ga0207678_10004448 | Ga0207678_100044483 | 404 |
| 377 | 3300026067 | Ga0207678_10006712 | Ga0207678_100067126 | 404 |
| 378 | 3300026075 | Ga0207708_10001038 | Ga0207708_1000103810 | 404 |
| 379 | 3300026095 | Ga0207676_10066988 | Ga0207676_100669883 | 404 |
| 380 | 3300026116 | Ga0207674_10054729 | Ga0207674_100547292 | 404 |
| 381 | 3300026118 | Ga0207675_100026879 | Ga0207675_1000268795 | 404 |
| 382 | 3300026118 | Ga0207675_100045144 | Ga0207675_1000451442 | 404 |
| 383 | 3300026142 | Ga0207698_10040140 | Ga0207698_100401403 | 404 |
| 384 | 3300027907 | Ga0207428_10010980 | Ga0207428_100109802 | 404 |
| 385 | 3300028380 | Ga0268265_10002195 | Ga0268265_100021954 | 404 |
| 386 | 3300028794 | Ga0307515_10000095 | Ga0307515_1000009528 | 404 |
| 387 | 3300031731 | Ga0307405_10005868 | Ga0307405_100058686 | 404 |
| 388 | 3300031995 | Ga0307409_100000900 | Ga0307409_10000090010 | 404 |
| 389 | 3300032002 | Ga0307416_100018199 | Ga0307416_1000181994 | 404 |
| 390 | 3300032126 | Ga0307415_100000008 | Ga0307415_10000000848 | 404 |
| 391 | 3300036401 | Ga0373937_0010565 | Ga0373937_0010565_4631_5974 | 404 |
| 392 | 3300037068 | Ga0373925_0093090 | Ga0373925_0093090_18_1361 | 404 |
| 393 | 3300037853 | Ga0436364_0393888 | Ga0436364_0393888_27180_28523 | 404 |
| 394 | 3300044693 | Ga0466961_0022404 | Ga0466961_0022404_981_2321 | 404 |
| 395 | 3300044842 | Ga0466957_0005441 | Ga0466957_0005441_2409_3749 | 404 |
| 396 | 3300044842 | Ga0466957_0033508 | Ga0466957_0033508_1214_2563 | 404 |
| 397 | 3300046462 | Ga0495651_0021678 | Ga0495651_0021678_2145_3488 | 404 |
| 398 | 3300046507 | Ga0495606_0001924 | Ga0495606_0001924_6161_7498 | 404 |
| 399 | 3300046559 | Ga0495667_0002719 | Ga0495667_0002719_4887_6230 | 404 |
| 400 | 3300046616 | Ga0495668_0000907 | Ga0495668_0000907_21877_23214 | 404 |
| 401 | 3300046660 | Ga0495625_0001756 | Ga0495625_0001756_2290_3627 | 404 |
| 402 | 3300046663 | Ga0495635_0009213 | Ga0495635_0009213_5405_6748 | 404 |
| 403 | 3300046675 | Ga0495657_0019052 | Ga0495657_0019052_506_1849 | 404 |
| 404 | 3300047322 | Ga0495680_0005358 | Ga0495680_0005358_6209_7552 | 404 |
| 405 | 3300048091 | Ga0495626_0000687 | Ga0495626_0000687_21124_22461 | 404 |
| 406 | 3300048904 | Ga0496101_0053621 | Ga0496101_0053621_1254_2597 | 404 |
| 407 | 3300048915 | Ga0496112_0185224 | Ga0496112_0185224_104_1462 | 404 |
| 408 | 3300049742 | Ga0501080_0070587 | Ga0501080_0070587_290_1630 | 404 |
| 409 | 3300050508 | nmdc:mga09592_96400_c1 | nmdc:mga09592_96400_c1_757_2136 | 404 |
| 410 | 3300050511 | nmdc:mga08y16_65187_c1 | nmdc:mga08y16_65187_c1_2188_3534 | 404 |
| 411 | 3300061719 | Ga0466962_0029201 | Ga0466962_0029201_75_1415 | 404 |
| 412 | 3300061734 | Ga0530510_0021801 | Ga0530510_0021801_2862_4202 | 404 |
| 413 | 3300005336 | Ga0070680_100057742 | Ga0070680_1000577424 | 405 |
| 414 | 3300005336 | Ga0070680_100109379 | Ga0070680_1001093792 | 405 |
| 415 | 3300005435 | Ga0070714_100101008 | Ga0070714_1001010083 | 405 |
| 416 | 3300005445 | Ga0070708_100001787 | Ga0070708_1000017871 | 405 |
| 417 | 3300005467 | Ga0070706_100105958 | Ga0070706_1001059581 | 405 |
| 418 | 3300006028 | Ga0070717_10007692 | Ga0070717_100076924 | 405 |
| 419 | 3300013105 | Ga0157369_10034539 | Ga0157369_100345396 | 405 |
| 420 | 3300014969 | Ga0157376_10161328 | Ga0157376_101613282 | 405 |
| 421 | 3300022467 | Ga0224712_10019476 | Ga0224712_100194762 | 405 |
| 422 | 3300025910 | Ga0207684_10099913 | Ga0207684_100999133 | 405 |
| 423 | 3300025915 | Ga0207693_10033330 | Ga0207693_100333302 | 405 |
| 424 | 3300025917 | Ga0207660_10082284 | Ga0207660_100822842 | 405 |
| 425 | 3300025922 | Ga0207646_10178531 | Ga0207646_101785311 | 405 |
| 426 | 3300025944 | Ga0207661_10088477 | Ga0207661_100884772 | 405 |
| 427 | 3300026116 | Ga0207674_10022739 | Ga0207674_100227392 | 405 |
| 428 | 3300031730 | Ga0307516_10001182 | Ga0307516_1000118213 | 405 |
| 429 | 3300031901 | Ga0307406_10003953 | Ga0307406_100039532 | 405 |
| 430 | 3300032126 | Ga0307415_100026955 | Ga0307415_1000269553 | 405 |
| 431 | 3300035083 | Ga0373926_0000673 | Ga0373926_0000673_5138_6481 | 405 |
| 432 | 3300035089 | Ga0373944_0000369 | Ga0373944_0000369_3744_5087 | 405 |
| 433 | 3300035113 | Ga0373936_0003410 | Ga0373936_0003410_2810_4153 | 405 |
| 434 | 3300035116 | Ga0373945_0001173 | Ga0373945_0001173_1235_2578 | 405 |
| 435 | 3300035170 | Ga0373943_0000269 | Ga0373943_0000269_11719_13062 | 405 |
| 436 | 3300035171 | Ga0373946_0002878 | Ga0373946_0002878_2730_4073 | 405 |
| 437 | 3300035692 | Ga0373935_0012880 | Ga0373935_0012880_1523_2866 | 405 |
| 438 | 3300035695 | Ga0373927_0002091 | Ga0373927_0002091_13017_14360 | 405 |
| 439 | 3300035725 | Ga0373947_0003170 | Ga0373947_0003170_6309_7652 | 405 |
| 440 | 3300037068 | Ga0373925_0105067 | Ga0373925_0105067_541_1884 | 405 |
| 441 | 3300044693 | Ga0466961_0013731 | Ga0466961_0013731_3205_4563 | 405 |
| 442 | 3300044693 | Ga0466961_0042077 | Ga0466961_0042077_528_1868 | 405 |
| 443 | 3300045049 | Ga0466959_0043080 | Ga0466959_0043080_692_2050 | 405 |
| 444 | 3300046461 | Ga0495641_0011042 | Ga0495641_0011042_3350_4693 | 405 |
| 445 | 3300046463 | Ga0495653_0002205 | Ga0495653_0002205_8853_10196 | 405 |
| 446 | 3300046477 | Ga0495664_0000535 | Ga0495664_0000535_8510_9853 | 405 |
| 447 | 3300046514 | Ga0495618_0039204 | Ga0495618_0039204_1604_2947 | 405 |
| 448 | 3300046517 | Ga0495630_0072650 | Ga0495630_0072650_1186_2529 | 405 |
| 449 | 3300046529 | Ga0495652_0017031 | Ga0495652_0017031_3626_4969 | 405 |
| 450 | 3300046559 | Ga0495667_0004095 | Ga0495667_0004095_953_2296 | 405 |
| 451 | 3300046663 | Ga0495635_0007100 | Ga0495635_0007100_6102_7445 | 405 |
| 452 | 3300046678 | Ga0495599_0012042 | Ga0495599_0012042_3748_5091 | 405 |
| 453 | 3300046680 | Ga0495646_0077780 | Ga0495646_0077780_186_1529 | 405 |
| 454 | 3300046690 | Ga0495624_0002198 | Ga0495624_0002198_9887_11230 | 405 |
| 455 | 3300047315 | Ga0495581_0023994 | Ga0495581_0023994_1938_3281 | 405 |
| 456 | 3300047315 | Ga0495581_0068957 | Ga0495581_0068957_76_1428 | 405 |
| 457 | 3300047319 | Ga0495674_0000921 | Ga0495674_0000921_12937_14280 | 405 |
| 458 | 3300047321 | Ga0495676_0012381 | Ga0495676_0012381_1442_2785 | 405 |
| 459 | 3300047322 | Ga0495680_0028247 | Ga0495680_0028247_1066_2409 | 405 |
| 460 | 3300047471 | Ga0495684_0002564 | Ga0495684_0002564_4524_5867 | 405 |
| 461 | 3300048907 | Ga0496104_0112981 | Ga0496104_0112981_157_1575 | 405 |
| 462 | 3300048917 | Ga0496114_0143310 | Ga0496114_0143310_597_1937 | 405 |
| 463 | 3300049585 | Ga0501069_0001080 | Ga0501069_0001080_921_2264 | 405 |
| 464 | 3300049586 | Ga0501070_0008460 | Ga0501070_0008460_885_2225 | 405 |
| 465 | 3300049587 | Ga0501071_0121598 | Ga0501071_0121598_210_1550 | 405 |
| 466 | 3300049590 | Ga0501074_0109770 | Ga0501074_0109770_464_1807 | 405 |
| 467 | 3300049591 | Ga0501075_0095243 | Ga0501075_0095243_562_1902 | 405 |
| 468 | 3300049742 | Ga0501080_0016523 | Ga0501080_0016523_4634_5977 | 405 |
| 469 | iso_pu_bacteria | 2501939600 | 2501943178 | 405 |
| 470 | iso_pu_bacteria | 649633069 | 649810220 | 405 |
| 471 | 3300005337 | Ga0070682_100137222 | Ga0070682_1001372221 | 406 |
| 472 | 3300005445 | Ga0070708_100015492 | Ga0070708_1000154924 | 406 |
| 473 | 3300005458 | Ga0070681_10001334 | Ga0070681_100013343 | 406 |
| 474 | 3300005467 | Ga0070706_100008084 | Ga0070706_1000080847 | 406 |
| 475 | 3300005468 | Ga0070707_100024871 | Ga0070707_1000248713 | 406 |
| 476 | 3300005471 | Ga0070698_100002462 | Ga0070698_1000024625 | 406 |
| 477 | 3300005530 | Ga0070679_100000273 | Ga0070679_10000027321 | 406 |
| 478 | 3300025910 | Ga0207684_10001782 | Ga0207684_1000178214 | 406 |
| 479 | 3300025912 | Ga0207707_10000023 | Ga0207707_10000023189 | 406 |
| 480 | 3300025917 | Ga0207660_10003404 | Ga0207660_100034049 | 406 |
| 481 | 3300025921 | Ga0207652_10000039 | Ga0207652_1000003921 | 406 |
| 482 | 3300025922 | Ga0207646_10001334 | Ga0207646_1000133420 | 406 |
| 483 | 3300031249 | Ga0265339_10008669 | Ga0265339_100086697 | 406 |
| 484 | 3300031344 | Ga0265316_10089052 | Ga0265316_100890522 | 406 |
| 485 | 3300031712 | Ga0265342_10031016 | Ga0265342_100310163 | 406 |
| 486 | 3300041453 | Ga0451797_1033868 | Ga0451797_1033868_1772_3112 | 406 |
| 487 | 3300041509 | Ga0451843_1154776 | Ga0451843_1154776_366_1706 | 406 |
| 488 | 3300044842 | Ga0466957_0070031 | Ga0466957_0070031_676_2016 | 406 |
| 489 | 3300045836 | Ga0466958_0046065 | Ga0466958_0046065_1017_2357 | 406 |
| 490 | 3300048905 | Ga0496102_0017605 | Ga0496102_0017605_947_2299 | 406 |
| 491 | 3300048907 | Ga0496104_0026187 | Ga0496104_0026187_791_2143 | 406 |
| 492 | 3300048908 | Ga0496105_0010886 | Ga0496105_0010886_4559_5911 | 406 |
| 493 | 3300048911 | Ga0496108_0003051 | Ga0496108_0003051_5402_6754 | 406 |
| 494 | 3300048912 | Ga0496109_0000405 | Ga0496109_0000405_35372_36724 | 406 |
| 495 | 3300048913 | Ga0496110_0012887 | Ga0496110_0012887_1253_2605 | 406 |
| 496 | 3300048914 | Ga0496111_0002094 | Ga0496111_0002094_7315_8667 | 406 |
| 497 | 3300048915 | Ga0496112_0176163 | Ga0496112_0176163_734_2086 | 406 |
| 498 | 3300048916 | Ga0496113_0088429 | Ga0496113_0088429_193_1545 | 406 |
| 499 | 3300049742 | Ga0501080_0071420 | Ga0501080_0071420_695_2035 | 406 |
| 500 | 3300005434 | Ga0070709_10005114 | Ga0070709_100051146 | 407 |
| 501 | 3300005435 | Ga0070714_100024889 | Ga0070714_1000248896 | 407 |
| 502 | 3300005436 | Ga0070713_100050364 | Ga0070713_1000503645 | 407 |
| 503 | 3300005437 | Ga0070710_10008962 | Ga0070710_100089623 | 407 |
| 504 | 3300005439 | Ga0070711_100038791 | Ga0070711_1000387911 | 407 |
| 505 | 3300005445 | Ga0070708_100039236 | Ga0070708_1000392362 | 407 |
| 506 | 3300005467 | Ga0070706_100010390 | Ga0070706_1000103903 | 407 |
| 507 | 3300005467 | Ga0070706_100030034 | Ga0070706_1000300345 | 407 |
| 508 | 3300005468 | Ga0070707_100000127 | Ga0070707_10000012756 | 407 |
| 509 | 3300005468 | Ga0070707_100006664 | Ga0070707_1000066643 | 407 |
| 510 | 3300005471 | Ga0070698_100000597 | Ga0070698_10000059714 | 407 |
| 511 | 3300005471 | Ga0070698_100008768 | Ga0070698_1000087682 | 407 |
| 512 | 3300005471 | Ga0070698_100090154 | Ga0070698_1000901543 | 407 |
| 513 | 3300006028 | Ga0070717_10051767 | Ga0070717_100517672 | 407 |
| 514 | 3300006028 | Ga0070717_10068380 | Ga0070717_100683802 | 407 |
| 515 | 3300006175 | Ga0070712_100109771 | Ga0070712_1001097712 | 407 |
| 516 | 3300006871 | Ga0075434_100012318 | Ga0075434_1000123184 | 407 |
| 517 | 3300007076 | Ga0075435_100005790 | Ga0075435_1000057904 | 407 |
| 518 | 3300009545 | Ga0105237_10105256 | Ga0105237_101052562 | 407 |
| 519 | 3300013105 | Ga0157369_10154261 | Ga0157369_101542613 | 407 |
| 520 | 3300022467 | Ga0224712_10001312 | Ga0224712_100013123 | 407 |
| 521 | 3300024225 | Ga0224572_1002342 | Ga0224572_10023422 | 407 |
| 522 | 3300025898 | Ga0207692_10003021 | Ga0207692_100030214 | 407 |
| 523 | 3300025906 | Ga0207699_10002673 | Ga0207699_100026736 | 407 |
| 524 | 3300025909 | Ga0207705_10017310 | Ga0207705_100173106 | 407 |
| 525 | 3300025910 | Ga0207684_10003848 | Ga0207684_100038483 | 407 |
| 526 | 3300025910 | Ga0207684_10089336 | Ga0207684_100893362 | 407 |
| 527 | 3300025922 | Ga0207646_10000264 | Ga0207646_1000026410 | 407 |
| 528 | 3300025922 | Ga0207646_10007952 | Ga0207646_100079523 | 407 |
| 529 | 3300025922 | Ga0207646_10074356 | Ga0207646_100743562 | 407 |
| 530 | 3300025922 | Ga0207646_10108072 | Ga0207646_101080723 | 407 |
| 531 | 3300025928 | Ga0207700_10007108 | Ga0207700_100071083 | 407 |
| 532 | 3300025928 | Ga0207700_10031413 | Ga0207700_100314133 | 407 |
| 533 | 3300025929 | Ga0207664_10008062 | Ga0207664_100080626 | 407 |
| 534 | 3300025929 | Ga0207664_10084004 | Ga0207664_100840042 | 407 |
| 535 | 3300025939 | Ga0207665_10004519 | Ga0207665_100045196 | 407 |
| 536 | 3300035083 | Ga0373926_0000313 | Ga0373926_0000313_4705_6045 | 407 |
| 537 | 3300035086 | Ga0373934_0001413 | Ga0373934_0001413_6616_7956 | 407 |
| 538 | 3300035113 | Ga0373936_0003491 | Ga0373936_0003491_2334_3674 | 407 |
| 539 | 3300035119 | Ga0373956_0009276 | Ga0373956_0009276_2162_3502 | 407 |
| 540 | 3300035172 | Ga0373955_0004654 | Ga0373955_0004654_3866_5206 | 407 |
| 541 | 3300035172 | Ga0373955_0015118 | Ga0373955_0015118_616_1956 | 407 |
| 542 | 3300035692 | Ga0373935_0000373 | Ga0373935_0000373_15183_16523 | 407 |
| 543 | 3300035692 | Ga0373935_0026324 | Ga0373935_0026324_192_1532 | 407 |
| 544 | 3300035724 | Ga0373933_0026188 | Ga0373933_0026188_215_1555 | 407 |
| 545 | 3300035724 | Ga0373933_0026953 | Ga0373933_0026953_825_2165 | 407 |
| 546 | 3300035725 | Ga0373947_0000007 | Ga0373947_0000007_73377_74717 | 407 |
| 547 | 3300036401 | Ga0373937_0046900 | Ga0373937_0046900_697_2037 | 407 |
| 548 | 3300036401 | Ga0373937_0073680 | Ga0373937_0073680_880_2220 | 407 |
| 549 | 3300037853 | Ga0436364_0512240 | Ga0436364_0512240_650_1990 | 407 |
| 550 | 3300037853 | Ga0436364_0756837 | Ga0436364_0756837_292_1647 | 407 |
| 551 | 3300044693 | Ga0466961_0019066 | Ga0466961_0019066_330_1670 | 407 |
| 552 | 3300046459 | Ga0495629_0000833 | Ga0495629_0000833_20532_21872 | 407 |
| 553 | 3300046461 | Ga0495641_0003291 | Ga0495641_0003291_2138_3478 | 407 |
| 554 | 3300046462 | Ga0495651_0011791 | Ga0495651_0011791_2255_3595 | 407 |
| 555 | 3300046462 | Ga0495651_0056889 | Ga0495651_0056889_374_1714 | 407 |
| 556 | 3300046463 | Ga0495653_0093678 | Ga0495653_0093678_183_1523 | 407 |
| 557 | 3300046476 | Ga0495662_0068676 | Ga0495662_0068676_188_1528 | 407 |
| 558 | 3300046477 | Ga0495664_0010569 | Ga0495664_0010569_3607_4947 | 407 |
| 559 | 3300046511 | Ga0495608_0030892 | Ga0495608_0030892_2136_3476 | 407 |
| 560 | 3300046517 | Ga0495630_0074696 | Ga0495630_0074696_196_1536 | 407 |
| 561 | 3300046529 | Ga0495652_0023765 | Ga0495652_0023765_1824_3164 | 407 |
| 562 | 3300046531 | Ga0495665_0013813 | Ga0495665_0013813_2990_4330 | 407 |
| 563 | 3300046533 | Ga0495640_0064571 | Ga0495640_0064571_127_1467 | 407 |
| 564 | 3300046535 | Ga0495586_0011264 | Ga0495586_0011264_98_1438 | 407 |
| 565 | 3300046536 | Ga0495587_0005840 | Ga0495587_0005840_5434_6774 | 407 |
| 566 | 3300046543 | Ga0495645_0013718 | Ga0495645_0013718_3154_4494 | 407 |
| 567 | 3300046559 | Ga0495667_0034225 | Ga0495667_0034225_1763_3103 | 407 |
| 568 | 3300046642 | Ga0495634_0027604 | Ga0495634_0027604_1633_2973 | 407 |
| 569 | 3300046675 | Ga0495657_0030415 | Ga0495657_0030415_258_1598 | 407 |
| 570 | 3300046678 | Ga0495599_0109598 | Ga0495599_0109598_218_1558 | 407 |
| 571 | 3300046679 | Ga0495623_0027189 | Ga0495623_0027189_1018_2358 | 407 |
| 572 | 3300046679 | Ga0495623_0058974 | Ga0495623_0058974_324_1664 | 407 |
| 573 | 3300046683 | Ga0495658_0049336 | Ga0495658_0049336_996_2336 | 407 |
| 574 | 3300046689 | Ga0495613_0021766 | Ga0495613_0021766_458_1798 | 407 |
| 575 | 3300046690 | Ga0495624_0005267 | Ga0495624_0005267_1156_2496 | 407 |
| 576 | 3300046809 | Ga0495600_0022120 | Ga0495600_0022120_825_2165 | 407 |
| 577 | 3300047317 | Ga0495604_0035748 | Ga0495604_0035748_2348_3688 | 407 |
| 578 | 3300047317 | Ga0495604_0121789 | Ga0495604_0121789_137_1477 | 407 |
| 579 | 3300047319 | Ga0495674_0066029 | Ga0495674_0066029_825_2165 | 407 |
| 580 | 3300047322 | Ga0495680_0057334 | Ga0495680_0057334_848_2188 | 407 |
| 581 | 3300047444 | Ga0495675_0019397 | Ga0495675_0019397_654_1994 | 407 |
| 582 | 3300047444 | Ga0495675_0042718 | Ga0495675_0042718_530_1870 | 407 |
| 583 | 3300047673 | Ga0495593_0003178 | Ga0495593_0003178_7549_8889 | 407 |
| 584 | 3300048088 | Ga0495602_0081418 | Ga0495602_0081418_488_1828 | 407 |
| 585 | 3300048088 | Ga0495602_0144926 | Ga0495602_0144926_164_1504 | 407 |
| 586 | 3300048929 | Ga0496126_0000022 | Ga0496126_0000022_278460_279818 | 407 |
| 587 | 3300050512 | nmdc:mga0n895_9045_c1 | nmdc:mga0n895_9045_c1_3070_4410 | 407 |
| 588 | 3300050513 | nmdc:mga0rr50_15487_c1 | nmdc:mga0rr50_15487_c1_1254_2594 | 407 |
| 589 | 3300050514 | nmdc:mga08x19_11432_c1 | nmdc:mga08x19_11432_c1_3413_4753 | 407 |
| 590 | 3300053084 | Ga0495595_0001189 | Ga0495595_0001189_4131_5471 | 407 |
| 591 | 3300005364 | Ga0070673_100152433 | Ga0070673_1001524333 | 408 |
| 592 | 3300005435 | Ga0070714_100077075 | Ga0070714_1000770755 | 408 |
| 593 | 3300005437 | Ga0070710_10011538 | Ga0070710_100115382 | 408 |
| 594 | 3300005539 | Ga0068853_100128392 | Ga0068853_1001283923 | 408 |
| 595 | 3300006028 | Ga0070717_10281038 | Ga0070717_102810382 | 408 |
| 596 | 3300006173 | Ga0070716_100003008 | Ga0070716_1000030083 | 408 |
| 597 | 3300006175 | Ga0070712_100052502 | Ga0070712_1000525021 | 408 |
| 598 | 3300025906 | Ga0207699_10015277 | Ga0207699_100152775 | 408 |
| 599 | 3300025916 | Ga0207663_10020146 | Ga0207663_100201465 | 408 |
| 600 | 3300025929 | Ga0207664_10111572 | Ga0207664_101115722 | 408 |
| 601 | 3300025939 | Ga0207665_10009065 | Ga0207665_100090654 | 408 |
| 602 | 3300031728 | Ga0316578_10006155 | Ga0316578_100061554 | 408 |
| 603 | 3300035113 | Ga0373936_0034728 | Ga0373936_0034728_515_1861 | 408 |
| 604 | 3300035117 | Ga0373953_0012605 | Ga0373953_0012605_395_1741 | 408 |
| 605 | 3300035118 | Ga0373954_0055206 | Ga0373954_0055206_450_1796 | 408 |
| 606 | 3300035398 | Ga0316574_0005082 | Ga0316574_0005082_1292_2635 | 408 |
| 607 | 3300035692 | Ga0373935_0009413 | Ga0373935_0009413_4401_5747 | 408 |
| 608 | 3300036712 | Ga0316584_0008056 | Ga0316584_0008056_477_1820 | 408 |
| 609 | 3300046454 | Ga0495592_0051894 | Ga0495592_0051894_908_2254 | 408 |
| 610 | 3300046533 | Ga0495640_0027891 | Ga0495640_0027891_153_1499 | 408 |
| 611 | 3300046543 | Ga0495645_0114808 | Ga0495645_0114808_206_1552 | 408 |
| 612 | 3300046809 | Ga0495600_0023132 | Ga0495600_0023132_990_2336 | 408 |
| 613 | 3300047319 | Ga0495674_0029704 | Ga0495674_0029704_3398_4744 | 408 |
| 614 | 3300047444 | Ga0495675_0096244 | Ga0495675_0096244_175_1521 | 408 |
| 615 | 3300053078 | Ga0495612_0042196 | Ga0495612_0042196_218_1564 | 408 |
| 616 | 3300005337 | Ga0070682_100001454 | Ga0070682_1000014541 | 409 |
| 617 | 3300005338 | Ga0068868_100024010 | Ga0068868_1000240103 | 409 |
| 618 | 3300005344 | Ga0070661_100137943 | Ga0070661_1001379432 | 409 |
| 619 | 3300005366 | Ga0070659_100117654 | Ga0070659_1001176541 | 409 |
| 620 | 3300005563 | Ga0068855_100008477 | Ga0068855_1000084775 | 409 |
| 621 | 3300005563 | Ga0068855_100075327 | Ga0068855_1000753272 | 409 |
| 622 | 3300005578 | Ga0068854_100056665 | Ga0068854_1000566653 | 409 |
| 623 | 3300005840 | Ga0068870_10000074 | Ga0068870_100000748 | 409 |
| 624 | 3300005841 | Ga0068863_100013453 | Ga0068863_1000134533 | 409 |
| 625 | 3300006852 | Ga0075433_10010746 | Ga0075433_100107468 | 409 |
| 626 | 3300011119 | Ga0105246_10000575 | Ga0105246_100005756 | 409 |
| 627 | 3300013102 | Ga0157371_10042577 | Ga0157371_100425774 | 409 |
| 628 | 3300013104 | Ga0157370_10032408 | Ga0157370_100324083 | 409 |
| 629 | 3300025908 | Ga0207643_10000037 | Ga0207643_1000003751 | 409 |
| 630 | 3300025913 | Ga0207695_10019091 | Ga0207695_100190913 | 409 |
| 631 | 3300025920 | Ga0207649_10008226 | Ga0207649_100082262 | 409 |
| 632 | 3300025921 | Ga0207652_10042138 | Ga0207652_100421382 | 409 |
| 633 | 3300025944 | Ga0207661_10001808 | Ga0207661_1000180814 | 409 |
| 634 | 3300026116 | Ga0207674_10133033 | Ga0207674_101330333 | 409 |
| 635 | 3300031247 | Ga0265340_10013376 | Ga0265340_100133764 | 409 |
| 636 | 3300037466 | Ga0395898_0048326 | Ga0395898_0048326_1028_2389 | 409 |
| 637 | 3300048908 | Ga0496105_0004921 | Ga0496105_0004921_621_1964 | 409 |
| 638 | 3300002459 | JGI24751J29686_10002661 | JGI24751J29686_100026611 | 410 |
| 639 | 3300005327 | Ga0070658_10135518 | Ga0070658_101355181 | 410 |
| 640 | 3300005331 | Ga0070670_100008036 | Ga0070670_1000080362 | 410 |
| 641 | 3300005334 | Ga0068869_100007210 | Ga0068869_1000072105 | 410 |
| 642 | 3300005339 | Ga0070660_100137197 | Ga0070660_1001371971 | 410 |
| 643 | 3300005340 | Ga0070689_100105407 | Ga0070689_1001054073 | 410 |
| 644 | 3300005341 | Ga0070691_10002921 | Ga0070691_100029215 | 410 |
| 645 | 3300005345 | Ga0070692_10004655 | Ga0070692_100046551 | 410 |
| 646 | 3300005354 | Ga0070675_100004377 | Ga0070675_1000043773 | 410 |
| 647 | 3300005355 | Ga0070671_100010749 | Ga0070671_1000107497 | 410 |
| 648 | 3300005435 | Ga0070714_100047262 | Ga0070714_1000472624 | 410 |
| 649 | 3300005436 | Ga0070713_100012448 | Ga0070713_1000124484 | 410 |
| 650 | 3300005438 | Ga0070701_10029795 | Ga0070701_100297953 | 410 |
| 651 | 3300005457 | Ga0070662_100086176 | Ga0070662_1000861761 | 410 |
| 652 | 3300005466 | Ga0070685_10007879 | Ga0070685_100078794 | 410 |
| 653 | 3300005530 | Ga0070679_100113334 | Ga0070679_1001133344 | 410 |
| 654 | 3300005547 | Ga0070693_100000804 | Ga0070693_1000008046 | 410 |
| 655 | 3300005614 | Ga0068856_100055156 | Ga0068856_1000551562 | 410 |
| 656 | 3300005615 | Ga0070702_100000979 | Ga0070702_10000097913 | 410 |
| 657 | 3300005616 | Ga0068852_100005693 | Ga0068852_1000056938 | 410 |
| 658 | 3300005842 | Ga0068858_100011258 | Ga0068858_1000112583 | 410 |
| 659 | 3300006871 | Ga0075434_100001385 | Ga0075434_10000138517 | 410 |
| 660 | 3300007076 | Ga0075435_100004313 | Ga0075435_10000431312 | 410 |
| 661 | 3300009147 | Ga0114129_10083012 | Ga0114129_100830123 | 410 |
| 662 | 3300009148 | Ga0105243_10086816 | Ga0105243_100868163 | 410 |
| 663 | 3300009551 | Ga0105238_10074381 | Ga0105238_100743814 | 410 |
| 664 | 3300013308 | Ga0157375_10134848 | Ga0157375_101348483 | 410 |
| 665 | 3300025901 | Ga0207688_10006817 | Ga0207688_100068173 | 410 |
| 666 | 3300025907 | Ga0207645_10015649 | Ga0207645_100156492 | 410 |
| 667 | 3300025919 | Ga0207657_10133220 | Ga0207657_101332202 | 410 |
| 668 | 3300025925 | Ga0207650_10000873 | Ga0207650_1000087319 | 410 |
| 669 | 3300025926 | Ga0207659_10020583 | Ga0207659_100205831 | 410 |
| 670 | 3300025928 | Ga0207700_10014331 | Ga0207700_100143315 | 410 |
| 671 | 3300025929 | Ga0207664_10047912 | Ga0207664_100479122 | 410 |
| 672 | 3300025931 | Ga0207644_10039647 | Ga0207644_100396474 | 410 |
| 673 | 3300025933 | Ga0207706_10024004 | Ga0207706_100240045 | 410 |
| 674 | 3300025936 | Ga0207670_10096894 | Ga0207670_100968943 | 410 |
| 675 | 3300025940 | Ga0207691_10133498 | Ga0207691_101334983 | 410 |
| 676 | 3300025942 | Ga0207689_10028353 | Ga0207689_100283533 | 410 |
| 677 | 3300026035 | Ga0207703_10025713 | Ga0207703_100257134 | 410 |
| 678 | 3300026067 | Ga0207678_10006590 | Ga0207678_1000659012 | 410 |
| 679 | 3300026075 | Ga0207708_10004711 | Ga0207708_100047115 | 410 |
| 680 | 3300026078 | Ga0207702_10002388 | Ga0207702_100023887 | 410 |
| 681 | 3300026078 | Ga0207702_10006916 | Ga0207702_1000691610 | 410 |
| 682 | 3300027907 | Ga0207428_10016826 | Ga0207428_100168266 | 410 |
| 683 | 3300048903 | Ga0496100_0052625 | Ga0496100_0052625_98_1441 | 410 |
| 684 | 3300048910 | Ga0496107_0022648 | Ga0496107_0022648_2869_4212 | 410 |
| 685 | 3300048913 | Ga0496110_0005067 | Ga0496110_0005067_1248_2591 | 410 |
| 686 | 3300048914 | Ga0496111_0000601 | Ga0496111_0000601_13642_14985 | 410 |
| 687 | 3300050507 | nmdc:mga05p37_57310_c1 | nmdc:mga05p37_57310_c1_56_1399 | 410 |
| 688 | 3300050511 | nmdc:mga08y16_15394_c1 | nmdc:mga08y16_15394_c1_852_2195 | 410 |
| 689 | 3300050512 | nmdc:mga0n895_154302_c1 | nmdc:mga0n895_154302_c1_190_1533 | 410 |
| 690 | 3300050513 | nmdc:mga0rr50_1354_c1 | nmdc:mga0rr50_1354_c1_11213_12556 | 410 |
| 691 | 3300050514 | nmdc:mga08x19_7000_c1 | nmdc:mga08x19_7000_c1_4977_6320 | 410 |
| 692 | 3300050515 | nmdc:mga0a205_27716_c1 | nmdc:mga0a205_27716_c1_169_1512 | 410 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jzf-assembly1.cif.gz_A | crystal structure of biotin carboxylase from e. coli in complex with benzimidazoles series | 0.9783 | 1 | 409 |
| 3va7-assembly1.cif.gz_A | crystal structure of the kluyveromyces lactis urea carboxylase | 0.9745 | 2 | 406 |
| 3g8d-assembly1.cif.gz_A | crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli | 0.9718 | 1 | 408 |
| 3n6r-assembly1.cif.gz_E | crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) | 0.9709 | 2 | 408 |
| 5mlk-assembly1.cif.gz_B | biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) | 0.9702 | 2 | 402 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8PV58_38_157_3.40.50.20 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9933 | 14 | 130 | 3.40.50.20 |
| 2vqdA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9799 | 1 | 84 | 3.40.50.20 |
| af_A0A1D6J3D9_373_520_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9786 | 167 | 284 | 3.30.470.20 |
| 3n6rA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9735 | 2 | 130 | 3.40.50.20 |
| af_A0A1D8PDC6_817_1059_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9698 | 168 | 406 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A323V7T1-F1-model_v4 | biotin carboxylase (EC 6.3.4.14) | 1.006 | 2 | 78 |
GO:0005524
GO:0016874 |
| AF-A0A3M1P1Z5-F1-model_v4 | Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) | 1 | 2 | 74 |
GO:0003989
GO:0005524 |
| AF-A0A2M8PKW1-F1-model_v4 | 3-methylcrotonyl-CoA carboxylase | 0.9989 | 1 | 105 |
GO:0005524
GO:0016874 |
| AF-A0A3C1KWC0-F1-model_v4 | Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) | 0.9983 | 3 | 84 |
GO:0003989
GO:0005524 |
| AF-A0A2V8M7X3-F1-model_v4 | Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) | 0.9982 | 1 | 110 |
GO:0003989
GO:0005524 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar