F475568

General Info

Members Datasets Scaffolds Average Seq Length
692 354 643 429

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100096977|Ga0070708_1000969773
Length 486
Sequence LIANRGEIARRVARTARRLGIKVIAVYSEADAELPFVAEADEAVLIGPAPAAQSYLNADAILAAAARTGAGAIHPGYGFLAENASFAQRVIDAGRTWIGPSPDAIEQMGDKIRARNLMASVGVPVAAGSAEPVSDAEDAIVEAERIGYPVMIKAAAXXXXIGMTVAADAERLRAGFETARTRAERFFGNPSILLERYIASARHVEVQILGLANGQVIALGERDCSAQRRHQKLAEETPSPGVGDRLRQRMLAAAIQAGEAVGYRGAGTVECLVDRQTGEFVFLEMNTRLQVEHPVTEMVTGIDLVEQQLLIADGADVSFDVGSVKPAGHAFELRVYAEDPVRFLPSPGAISQWQEPAGAGVRVDAGYAAGNVVTPHYDPLLAKLIVSGTDREEALARTRAAVADFVVTGPKTNLAFHAELLASREFATGDYDTSVVSRLRPLSGSSGGDGAQPVMVHPASDVPGSPAGPGDGLAPSQGGARDRDPR

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
3 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
4 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
5 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
6 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
7 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
8 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
9 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
10 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
11 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
12 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
13 2855683550 Micromonospora sp. RP3T Isolate Unclassified
14 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
15 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
16 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
17 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
18 2858882152 Micromonospora noduli MED15 Isolate Nodule
19 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
20 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
21 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
22 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
23 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
24 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
25 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
26 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
27 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
28 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
29 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
30 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
31 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
32 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
33 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
34 2891562705 Microbispora tritici MT50 Isolate Unclassified
35 2902582711 Micromonospora sp. AP08 Isolate Unclassified
36 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
37 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
38 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
39 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
40 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
41 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
60 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
75 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
76 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
95 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
98 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
99 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
100 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
101 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
109 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
183 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
192 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
199 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
205 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
219 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
220 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
224 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
236 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
237 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
238 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
239 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
242 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
243 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
244 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
245 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
246 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
247 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
256 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
279 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
280 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
281 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
282 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
283 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
288 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
289 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
290 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
302 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
311 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
312 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
313 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
314 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
337 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
340 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
341 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
342 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
344 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
345 649633069 Micromonospora sp. L5 Isolate Unclassified
346 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
347 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
348 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
349 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
350 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
351 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
352 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
353 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
354 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.34
Metatranscriptomes 0.58
Isolates 7.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0.58
Rhizoplane 3.9
Rhizosphere 85.26
Stem 0
Stem Tuber 0
Unclassified 9.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10002661 3300002459 Bacteria 3594
2 JGI25406J46586_10001944 3300003203 Bacteria 9762
3 Ga0070658_10042607 3300005327 Bacteria 3667
4 Ga0070658_10045142 3300005327 Bacteria 3562
5 Ga0070658_10135518 3300005327 Bacteria 2054
6 Ga0070683_100000557 3300005329 Bacteria 26481
7 Ga0070683_100006507 3300005329 Bacteria 9809
8 Ga0070683_100059441 3300005329 Bacteria 3551
9 Ga0070670_100008036 3300005331 Bacteria 8975
10 Ga0068869_100004358 3300005334 Bacteria 8785
11 Ga0068869_100007210 3300005334 Bacteria 7089
12 Ga0068869_100068633 3300005334 Bacteria 2619
13 Ga0070680_100002227 3300005336 Bacteria 14305
14 Ga0070680_100057742 3300005336 Bacteria 3173
15 Ga0070680_100109379 3300005336 Bacteria 2300
16 Ga0070682_100001454 3300005337 Bacteria 13299
17 Ga0070682_100137222 3300005337 Bacteria 1663
18 Ga0068868_100020944 3300005338 Bacteria 4922
19 Ga0068868_100024010 3300005338 Bacteria 4621
20 Ga0070660_100021974 3300005339 Bacteria 4712
21 Ga0070660_100025036 3300005339 Bacteria 4433
22 Ga0070660_100137197 3300005339 Bacteria 1960
23 Ga0070689_100105407 3300005340 Bacteria 2236
24 Ga0070691_10002921 3300005341 Bacteria 7662
25 Ga0070687_100077703 3300005343 Bacteria 1802
26 Ga0070661_100137943 3300005344 Bacteria 1836
27 Ga0070692_10004655 3300005345 Bacteria 5749
28 Ga0070668_100006041 3300005347 Bacteria 8980
29 Ga0070668_100181420 3300005347 Bacteria 1720
30 Ga0070675_100000851 3300005354 Bacteria 21682
31 Ga0070675_100004377 3300005354 Bacteria 10776
32 Ga0070675_100183577 3300005354 Bacteria 1810
33 Ga0070671_100010749 3300005355 Bacteria 7346
34 Ga0070673_100078002 3300005364 Bacteria 2678
35 Ga0070673_100152433 3300005364 Bacteria 1958
36 Ga0070659_100000886 3300005366 Bacteria 21881
37 Ga0070659_100016339 3300005366 Bacteria 5572
38 Ga0070659_100117654 3300005366 Bacteria 2149
39 Ga0070659_100120145 3300005366 Bacteria 2127
40 Ga0070667_100158779 3300005367 Bacteria 1990
41 Ga0070709_10005114 3300005434 Bacteria 7092
42 Ga0070714_100000319 3300005435 Bacteria 36427
43 Ga0070714_100024889 3300005435 Bacteria 4935
44 Ga0070714_100047262 3300005435 Bacteria 3655
45 Ga0070714_100060055 3300005435 Bacteria 3262
46 Ga0070714_100077075 3300005435 Bacteria 2895
47 Ga0070714_100083193 3300005435 Bacteria 2790
48 Ga0070714_100101008 3300005435 Bacteria 2541
49 Ga0070714_100193533 3300005435 Bacteria 1857
50 Ga0070713_100012448 3300005436 Bacteria 6239
51 Ga0070713_100046651 3300005436 Bacteria 3556
52 Ga0070713_100050364 3300005436 Bacteria 3440
53 Ga0070710_10008962 3300005437 Bacteria 4887
54 Ga0070710_10011538 3300005437 Bacteria 4368
55 Ga0070710_10073193 3300005437 Bacteria 1980
56 Ga0070701_10029795 3300005438 Bacteria 2695
57 Ga0070711_100038791 3300005439 Bacteria 3205
58 Ga0070711_100166223 3300005439 Bacteria 1677
59 Ga0070705_100046324 3300005440 Bacteria 2506
60 Ga0070700_100004088 3300005441 Bacteria 7597
61 Ga0070700_100112604 3300005441 Bacteria 1812
62 Ga0070708_100001787 3300005445 Bacteria 16504
63 Ga0070708_100015492 3300005445 Bacteria 6300
64 Ga0070708_100039236 3300005445 Bacteria 4142
65 Ga0070708_100060710 3300005445 Bacteria 3375
66 Ga0070708_100096977 3300005445 Bacteria 2694
67 Ga0070663_100014634 3300005455 Bacteria 5041
68 Ga0070662_100086176 3300005457 Bacteria 2349
69 Ga0070662_100098811 3300005457 Bacteria 2205
70 Ga0070681_10001334 3300005458 Bacteria 21584
71 Ga0070681_10065012 3300005458 Bacteria 3617
72 Ga0068867_100025176 3300005459 Bacteria 4269
73 Ga0070685_10007879 3300005466 Bacteria 5457
74 Ga0070706_100008084 3300005467 Bacteria 9809
75 Ga0070706_100010390 3300005467 Bacteria 8646
76 Ga0070706_100011220 3300005467 Bacteria 8322
77 Ga0070706_100030034 3300005467 Bacteria 5005
78 Ga0070706_100105958 3300005467 Bacteria 2616
79 Ga0070707_100000127 3300005468 Bacteria 71273
80 Ga0070707_100001180 3300005468 Bacteria 25707
81 Ga0070707_100006664 3300005468 Bacteria 10699
82 Ga0070707_100024871 3300005468 Bacteria 5676
83 Ga0070707_100048768 3300005468 Bacteria 4057
84 Ga0070707_100197809 3300005468 Bacteria 1959
85 Ga0070698_100000597 3300005471 Bacteria 38839
86 Ga0070698_100002462 3300005471 Bacteria 20439
87 Ga0070698_100008768 3300005471 Bacteria 10889
88 Ga0070698_100061318 3300005471 Bacteria 3795
89 Ga0070698_100090154 3300005471 Bacteria 3050
90 Ga0070698_100107989 3300005471 Bacteria 2750
91 Ga0070699_100277324 3300005518 Bacteria 1501
92 Ga0070679_100000273 3300005530 Bacteria 43331
93 Ga0070679_100091365 3300005530 Bacteria 3032
94 Ga0070679_100113334 3300005530 Bacteria 2697
95 Ga0070684_100004299 3300005535 Bacteria 10812
96 Ga0070684_100007875 3300005535 Bacteria 8310
97 Ga0070697_100039861 3300005536 Bacteria 3799
98 Ga0068853_100042610 3300005539 Bacteria 3882
99 Ga0068853_100128392 3300005539 Bacteria 2267
100 Ga0070672_100011916 3300005543 Bacteria 6077
101 Ga0070695_100022226 3300005545 Bacteria 3889
102 Ga0070693_100000804 3300005547 Bacteria 13886
103 Ga0068855_100008477 3300005563 Bacteria 12426
104 Ga0068855_100075327 3300005563 Bacteria 3919
105 Ga0068855_100224284 3300005563 Bacteria 2106
106 Ga0070664_100000617 3300005564 Bacteria 27174
107 Ga0068857_100045321 3300005577 Bacteria 3901
108 Ga0068857_100221950 3300005577 Bacteria 1726
109 Ga0068854_100056665 3300005578 Bacteria 2825
110 Ga0068854_100058231 3300005578 Bacteria 2788
111 Ga0068856_100055156 3300005614 Bacteria 3922
112 Ga0070702_100000979 3300005615 Bacteria 11262
113 Ga0070702_100060131 3300005615 Bacteria 2208
114 Ga0068852_100005693 3300005616 Bacteria 8937
115 Ga0068861_100032455 3300005719 Bacteria 3844
116 Ga0068861_100070616 3300005719 Bacteria 2705
117 Ga0068870_10000074 3300005840 Bacteria 31568
118 Ga0068863_100013453 3300005841 Bacteria 7891
119 Ga0068858_100011258 3300005842 Bacteria 8452
120 Ga0068860_100014937 3300005843 Bacteria 7591
121 Ga0068862_100020398 3300005844 Bacteria 5537
122 Ga0081540_1000207 3300005983 Bacteria 61586
123 Ga0081540_1000517 3300005983 Bacteria 37840
124 Ga0081540_1018761 3300005983 Bacteria 4229
125 Ga0081539_10000809 3300005985 Bacteria 60775
126 Ga0081539_10001196 3300005985 Bacteria 46791
127 Ga0081539_10003770 3300005985 Bacteria 17940
128 Ga0081539_10096472 3300005985 Bacteria 1516
129 Ga0070717_10007692 3300006028 Bacteria 8015
130 Ga0070717_10015393 3300006028 Bacteria 5908
131 Ga0070717_10026141 3300006028 Bacteria 4654
132 Ga0070717_10051767 3300006028 Bacteria 3380
133 Ga0070717_10068380 3300006028 Bacteria 2956
134 Ga0070717_10281038 3300006028 Bacteria 1476
135 Ga0070716_100003008 3300006173 Bacteria 7860
136 Ga0070716_100044210 3300006173 Bacteria 2494
137 Ga0070712_100052502 3300006175 Bacteria 2843
138 Ga0070712_100109771 3300006175 Bacteria 2057
139 Ga0075428_100000598 3300006844 Bacteria 36812
140 Ga0075428_100007643 3300006844 Bacteria 11980
141 Ga0075428_100029853 3300006844 Bacteria 6030
142 Ga0075428_100197116 3300006844 Bacteria 2178
143 Ga0075430_100001817 3300006846 Bacteria 17473
144 Ga0075430_100004049 3300006846 Bacteria 12371
145 Ga0075431_100004612 3300006847 Bacteria 13530
146 Ga0075431_100011144 3300006847 Bacteria 9050
147 Ga0075431_100120206 3300006847 Bacteria 2710
148 Ga0075433_10010746 3300006852 Bacteria 7362
149 Ga0075434_100001385 3300006871 Bacteria 20340
150 Ga0075434_100012318 3300006871 Bacteria 8101
151 Ga0075429_100001920 3300006880 Bacteria 17234
152 Ga0075429_100003184 3300006880 Bacteria 13949
153 Ga0075429_100033013 3300006880 Bacteria 4498
154 Ga0075429_100247561 3300006880 Bacteria 1561
155 Ga0075435_100004313 3300007076 Bacteria 9778
156 Ga0075435_100005790 3300007076 Bacteria 8681
157 Ga0099794_10006625 3300007265 Bacteria 4704
158 Ga0099795_10028181 3300007788 Bacteria 1907
159 Ga0105240_10273158 3300009093 Bacteria 1945
160 Ga0111539_10007767 3300009094 Bacteria 13693
161 Ga0105245_10011036 3300009098 Bacteria 7865
162 Ga0114129_10000272 3300009147 Bacteria 58807
163 Ga0114129_10000557 3300009147 Bacteria 45780
164 Ga0114129_10020083 3300009147 Bacteria 9508
165 Ga0114129_10083012 3300009147 Bacteria 4452
166 Ga0114129_10132722 3300009147 Bacteria 3419
167 Ga0105243_10086816 3300009148 Bacteria 2567
168 Ga0105241_10069806 3300009174 Bacteria 2725
169 Ga0105237_10105256 3300009545 Bacteria 2812
170 Ga0105238_10074381 3300009551 Bacteria 3390
171 Ga0105239_10190039 3300010375 Bacteria 2299
172 Ga0105246_10000575 3300011119 Bacteria 20378
173 Ga0157371_10042577 3300013102 Bacteria 3237
174 Ga0157371_10067364 3300013102 Bacteria 2534
175 Ga0157370_10032408 3300013104 Bacteria 5104
176 Ga0157369_10007654 3300013105 Bacteria 12425
177 Ga0157369_10008009 3300013105 Bacteria 12135
178 Ga0157369_10034539 3300013105 Bacteria 5549
179 Ga0157369_10154261 3300013105 Bacteria 2427
180 Ga0163162_10085493 3300013306 Bacteria 3231
181 Ga0157375_10050374 3300013308 Bacteria 4085
182 Ga0157375_10134848 3300013308 Bacteria 2591
183 Ga0157376_10161328 3300014969 Bacteria 2033
184 Ga0206354_10180487 3300020081 Bacteria 2243
185 Ga0206353_10443563 3300020082 Bacteria 3346
186 Ga0213873_10000068 3300021358 Bacteria 22379
187 Ga0213876_10000193 3300021384 Bacteria 63355
188 Ga0213876_10000552 3300021384 Bacteria 28013
189 Ga0213875_10000218 3300021388 Bacteria 58140
190 Ga0213875_10000428 3300021388 Bacteria 36761
191 Ga0224712_10001312 3300022467 Bacteria 5658
192 Ga0224712_10019476 3300022467 Bacteria 2289
193 Ga0224572_1002342 3300024225 Bacteria 3038
194 Ga0207692_10003021 3300025898 Bacteria 6524
195 Ga0207688_10006713 3300025901 Bacteria 6260
196 Ga0207688_10006817 3300025901 Bacteria 6217
197 Ga0207699_10002673 3300025906 Bacteria 8421
198 Ga0207699_10015277 3300025906 Bacteria 3984
199 Ga0207645_10015649 3300025907 Bacteria 5032
200 Ga0207643_10000037 3300025908 Bacteria 89297
201 Ga0207643_10008004 3300025908 Bacteria 5673
202 Ga0207705_10017310 3300025909 Bacteria 5159
203 Ga0207705_10119778 3300025909 Bacteria 1952
204 Ga0207684_10001782 3300025910 Bacteria 22690
205 Ga0207684_10003848 3300025910 Bacteria 14442
206 Ga0207684_10040619 3300025910 Bacteria 3944
207 Ga0207684_10089336 3300025910 Bacteria 2625
208 Ga0207684_10099913 3300025910 Bacteria 2479
209 Ga0207707_10000023 3300025912 Bacteria 183706
210 Ga0207707_10046384 3300025912 Bacteria 3785
211 Ga0207695_10019091 3300025913 Bacteria 7906
212 Ga0207693_10006051 3300025915 Bacteria 10023
213 Ga0207693_10033330 3300025915 Bacteria 4064
214 Ga0207663_10020146 3300025916 Bacteria 3773
215 Ga0207663_10118993 3300025916 Bacteria 1805
216 Ga0207660_10003404 3300025917 Bacteria 10371
217 Ga0207660_10082284 3300025917 Bacteria 2368
218 Ga0207660_10191895 3300025917 Bacteria 1591
219 Ga0207662_10004219 3300025918 Bacteria 7537
220 Ga0207657_10032723 3300025919 Bacteria 4694
221 Ga0207657_10054307 3300025919 Bacteria 3465
222 Ga0207657_10133220 3300025919 Bacteria 2035
223 Ga0207649_10008226 3300025920 Bacteria 5682
224 Ga0207652_10000039 3300025921 Bacteria 131660
225 Ga0207652_10042138 3300025921 Bacteria 3883
226 Ga0207646_10000264 3300025922 Bacteria 71299
227 Ga0207646_10001334 3300025922 Bacteria 30684
228 Ga0207646_10003773 3300025922 Bacteria 16878
229 Ga0207646_10007952 3300025922 Bacteria 10699
230 Ga0207646_10061146 3300025922 Bacteria 3363
231 Ga0207646_10074356 3300025922 Bacteria 3035
232 Ga0207646_10108072 3300025922 Bacteria 2496
233 Ga0207646_10178531 3300025922 Bacteria 1917
234 Ga0207650_10000873 3300025925 Bacteria 22864
235 Ga0207659_10004144 3300025926 Bacteria 8749
236 Ga0207659_10020583 3300025926 Bacteria 4363
237 Ga0207687_10009534 3300025927 Bacteria 6349
238 Ga0207700_10007108 3300025928 Bacteria 6818
239 Ga0207700_10014331 3300025928 Bacteria 5192
240 Ga0207700_10027643 3300025928 Bacteria 3977
241 Ga0207700_10031413 3300025928 Bacteria 3773
242 Ga0207664_10000218 3300025929 Bacteria 43292
243 Ga0207664_10008062 3300025929 Bacteria 7325
244 Ga0207664_10012976 3300025929 Bacteria 5970
245 Ga0207664_10027036 3300025929 Bacteria 4345
246 Ga0207664_10047912 3300025929 Bacteria 3359
247 Ga0207664_10060279 3300025929 Bacteria 3024
248 Ga0207664_10084004 3300025929 Bacteria 2596
249 Ga0207664_10111572 3300025929 Bacteria 2275
250 Ga0207664_10190772 3300025929 Bacteria 1764
251 Ga0207644_10039647 3300025931 Bacteria 3325
252 Ga0207690_10000393 3300025932 Bacteria 28872
253 Ga0207690_10090079 3300025932 Bacteria 2164
254 Ga0207690_10090596 3300025932 Bacteria 2159
255 Ga0207706_10024004 3300025933 Bacteria 5471
256 Ga0207706_10027305 3300025933 Bacteria 5105
257 Ga0207706_10104977 3300025933 Bacteria 2486
258 Ga0207670_10096894 3300025936 Bacteria 2099
259 Ga0207665_10004519 3300025939 Bacteria 9227
260 Ga0207665_10009065 3300025939 Bacteria 6531
261 Ga0207665_10011920 3300025939 Bacteria 5709
262 Ga0207665_10029973 3300025939 Bacteria 3595
263 Ga0207691_10013128 3300025940 Bacteria 7930
264 Ga0207691_10133498 3300025940 Bacteria 2191
265 Ga0207689_10001161 3300025942 Bacteria 25352
266 Ga0207689_10011945 3300025942 Bacteria 7442
267 Ga0207689_10028353 3300025942 Bacteria 4684
268 Ga0207689_10083080 3300025942 Bacteria 2633
269 Ga0207661_10001808 3300025944 Bacteria 14611
270 Ga0207661_10008848 3300025944 Bacteria 7207
271 Ga0207661_10041617 3300025944 Bacteria 3617
272 Ga0207661_10063571 3300025944 Bacteria 2989
273 Ga0207661_10088477 3300025944 Bacteria 2575
274 Ga0207679_10002759 3300025945 Bacteria 10870
275 Ga0207668_10001164 3300025972 Bacteria 15617
276 Ga0207677_10011954 3300026023 Bacteria 4971
277 Ga0207703_10025713 3300026035 Bacteria 4631
278 Ga0207703_10159360 3300026035 Bacteria 1975
279 Ga0207678_10004448 3300026067 Bacteria 12606
280 Ga0207678_10006590 3300026067 Bacteria 10299
281 Ga0207678_10006712 3300026067 Bacteria 10208
282 Ga0207708_10001038 3300026075 Bacteria 20784
283 Ga0207708_10004711 3300026075 Bacteria 10032
284 Ga0207702_10002388 3300026078 Bacteria 17880
285 Ga0207702_10006916 3300026078 Bacteria 9713
286 Ga0207676_10066988 3300026095 Bacteria 2867
287 Ga0207674_10022739 3300026116 Bacteria 6727
288 Ga0207674_10054729 3300026116 Bacteria 4061
289 Ga0207674_10133033 3300026116 Bacteria 2450
290 Ga0207675_100026879 3300026118 Bacteria 5356
291 Ga0207675_100045144 3300026118 Bacteria 4117
292 Ga0207683_10044813 3300026121 Bacteria 3867
293 Ga0207698_10040140 3300026142 Bacteria 3474
294 Ga0207428_10010980 3300027907 Bacteria 8054
295 Ga0207428_10016826 3300027907 Bacteria 6285
296 Ga0268265_10002195 3300028380 Bacteria 15067
297 Ga0307517_10039180 3300028786 Bacteria 5215
298 Ga0307515_10000095 3300028794 Bacteria 208513
299 Ga0307515_10005285 3300028794 Bacteria 26256
300 Ga0307515_10103289 3300028794 Bacteria 3417
301 Ga0265338_10054526 3300028800 Bacteria 3564
302 Ga0307512_10007735 3300030522 Bacteria 10578
303 Ga0307512_10015066 3300030522 Bacteria 7185
304 Ga0265325_10009579 3300031241 Bacteria 5653
305 Ga0265340_10000457 3300031247 Bacteria 22102
306 Ga0265340_10013376 3300031247 Bacteria 4308
307 Ga0265339_10008669 3300031249 Bacteria 6453
308 Ga0265316_10024470 3300031344 Bacteria 5060
309 Ga0265316_10089052 3300031344 Bacteria 2356
310 Ga0307513_10048880 3300031456 Bacteria 4586
311 Ga0307513_10144174 3300031456 Bacteria 2302
312 Ga0307513_10180230 3300031456 Bacteria 1977
313 Ga0307509_10061343 3300031507 Bacteria 3970
314 Ga0307508_10006410 3300031616 Bacteria 11064
315 Ga0307508_10014514 3300031616 Bacteria 7186
316 Ga0307508_10040674 3300031616 Bacteria 4173
317 Ga0307508_10042719 3300031616 Bacteria 4065
318 Ga0307508_10134323 3300031616 Bacteria 2077
319 Ga0265342_10031016 3300031712 Bacteria 3308
320 Ga0316578_10006155 3300031728 Bacteria 5895
321 Ga0307516_10001182 3300031730 Bacteria 36492
322 Ga0307405_10005868 3300031731 Bacteria 5981
323 Ga0307413_10010370 3300031824 Bacteria 4516
324 Ga0326468_10000567 3300031889 Bacteria 3844
325 Ga0307406_10003953 3300031901 Bacteria 8054
326 Ga0307406_10006740 3300031901 Bacteria 6352
327 Ga0307406_10024910 3300031901 Bacteria 3577
328 Ga0307409_100000900 3300031995 Bacteria 13785
329 Ga0307409_100010423 3300031995 Bacteria 5780
330 Ga0307416_100018199 3300032002 Bacteria 4943
331 Ga0307411_10061973 3300032005 Bacteria 2493
332 Ga0307415_100000008 3300032126 Bacteria 90898
333 Ga0307415_100026955 3300032126 Bacteria 3633
334 Ga0307507_10139828 3300033179 Bacteria 1861
335 Ga0373938_0005385 3300034957 Bacteria 2175
336 Ga0373938_0016256 3300034957 Bacteria 1452
337 Ga0373926_0000313 3300035083 Bacteria 12025
338 Ga0373926_0000673 3300035083 Bacteria 9388
339 Ga0373934_0001413 3300035086 Bacteria 8783
340 Ga0373934_0010850 3300035086 Bacteria 3424
341 Ga0373944_0000369 3300035089 Bacteria 10184
342 Ga0373944_0002781 3300035089 Bacteria 4474
343 Ga0373951_0000035 3300035091 Bacteria 52707
344 Ga0373923_0002491 3300035111 Bacteria 5685
345 Ga0373932_0004457 3300035112 Bacteria 3308
346 Ga0373936_0003410 3300035113 Bacteria 5958
347 Ga0373936_0003491 3300035113 Bacteria 5907
348 Ga0373936_0034728 3300035113 Bacteria 2005
349 Ga0373939_0011898 3300035114 Bacteria 2208
350 Ga0373945_0001173 3300035116 Bacteria 7968
351 Ga0373953_0012605 3300035117 Bacteria 2999
352 Ga0373954_0055206 3300035118 Bacteria 1869
353 Ga0373956_0009276 3300035119 Bacteria 3997
354 Ga0373943_0000269 3300035170 Bacteria 21448
355 Ga0373943_0018423 3300035170 Bacteria 3207
356 Ga0373946_0002878 3300035171 Bacteria 6103
357 Ga0373946_0012619 3300035171 Bacteria 3166
358 Ga0373946_0049706 3300035171 Bacteria 1749
359 Ga0373955_0004654 3300035172 Bacteria 6085
360 Ga0373955_0015118 3300035172 Bacteria 3771
361 Ga0373955_0041133 3300035172 Bacteria 2475
362 Ga0373955_0059780 3300035172 Bacteria 2100
363 Ga0373942_0000279 3300035207 Bacteria 13829
364 Ga0316574_0005082 3300035398 Bacteria 6989
365 Ga0373924_0028597 3300035410 Bacteria 2222
366 Ga0373935_0000373 3300035692 Bacteria 22971
367 Ga0373935_0009413 3300035692 Bacteria 5845
368 Ga0373935_0012880 3300035692 Bacteria 5037
369 Ga0373935_0021620 3300035692 Bacteria 3940
370 Ga0373935_0026324 3300035692 Bacteria 3588
371 Ga0373927_0000125 3300035695 Bacteria 58736
372 Ga0373927_0002091 3300035695 Bacteria 14731
373 Ga0373933_0026188 3300035724 Bacteria 3348
374 Ga0373933_0026953 3300035724 Bacteria 3305
375 Ga0373947_0000007 3300035725 Bacteria 192259
376 Ga0373947_0003170 3300035725 Bacteria 9788
377 Ga0373947_0009658 3300035725 Bacteria 5537
378 Ga0373937_0010565 3300036401 Bacteria 8065
379 Ga0373937_0046900 3300036401 Bacteria 3952
380 Ga0373937_0071089 3300036401 Bacteria 3210
381 Ga0373937_0073680 3300036401 Bacteria 3150
382 Ga0373937_0091119 3300036401 Bacteria 2824
383 Ga0316584_0008056 3300036712 Bacteria 7236
384 Ga0373925_0000003 3300037068 Bacteria 362401
385 Ga0373925_0045436 3300037068 Bacteria 3262
386 Ga0373925_0093090 3300037068 Bacteria 2306
387 Ga0373925_0105067 3300037068 Bacteria 2175
388 Ga0373925_0120359 3300037068 Bacteria 2037
389 Ga0395899_0006633 3300037312 Bacteria 8970
390 Ga0395899_0031133 3300037312 Bacteria 4010
391 Ga0395900_0004495 3300037418 Bacteria 14766
392 Ga0395898_0010093 3300037466 Bacteria 9882
393 Ga0395898_0048326 3300037466 Bacteria 4173
394 Ga0395905_0014282 3300037471 Bacteria 7586
395 Ga0436364_0386143 3300037853 Bacteria 1859
396 Ga0436364_0393888 3300037853 Bacteria 62164
397 Ga0436364_0512240 3300037853 Bacteria 2950
398 Ga0436364_0538624 3300037853 Bacteria 74940
399 Ga0436364_0756837 3300037853 Bacteria 2196
400 Ga0436364_1201672 3300037853 Bacteria 1627
401 Ga0436364_1394109 3300037853 Bacteria 7390
402 Ga0395901_0013285 3300038443 Bacteria 8363
403 Ga0436365_0083635 3300039437 Bacteria 4148
404 Ga0436365_0115299 3300039437 Bacteria 40894
405 Ga0436365_0586466 3300039437 Bacteria 1822
406 Ga0436365_1781586 3300039437 Bacteria 55120
407 Ga0436363_0294318 3300039450 Bacteria 1649
408 Ga0436362_0358937 3300039453 Bacteria 43996
409 Ga0451797_1033868 3300041453 Bacteria 5431
410 Ga0451843_1154776 3300041509 Bacteria 1798
411 Ga0466972_0001392 3300044658 Bacteria 11712
412 Ga0466966_0000704 3300044684 Bacteria 21260
413 Ga0466966_0026923 3300044684 Bacteria 3750
414 Ga0466961_0013731 3300044693 Bacteria 5190
415 Ga0466961_0019066 3300044693 Bacteria 4414
416 Ga0466961_0022404 3300044693 Bacteria 4064
417 Ga0466961_0042077 3300044693 Bacteria 2929
418 Ga0466963_0093382 3300044694 Bacteria 2051
419 Ga0466971_0006211 3300044719 Bacteria 5193
420 Ga0466968_0000465 3300044735 Bacteria 13649
421 Ga0466970_0007026 3300044765 Bacteria 5634
422 Ga0466957_0000234 3300044842 Bacteria 26243
423 Ga0466957_0005441 3300044842 Bacteria 7151
424 Ga0466957_0033508 3300044842 Bacteria 3082
425 Ga0466957_0070031 3300044842 Bacteria 2167
426 Ga0466959_0043080 3300045049 Bacteria 3329
427 Ga0466958_0002622 3300045836 Bacteria 9095
428 Ga0466958_0046065 3300045836 Bacteria 2631
429 Ga0466967_0000475 3300045976 Bacteria 19428
430 Ga0466967_0024008 3300045976 Bacteria 5006
431 Ga0466967_0054920 3300045976 Bacteria 3508
432 Ga0495592_0051894 3300046454 Bacteria 3046
433 Ga0495592_0056451 3300046454 Bacteria 2902
434 Ga0495592_0063346 3300046454 Bacteria 2712
435 Ga0495603_0005396 3300046455 Bacteria 7629
436 Ga0495629_0000833 3300046459 Bacteria 25000
437 Ga0495629_0058089 3300046459 Bacteria 2704
438 Ga0495629_0072822 3300046459 Bacteria 2399
439 Ga0495641_0003291 3300046461 Bacteria 12200
440 Ga0495641_0011042 3300046461 Bacteria 5175
441 Ga0495641_0032936 3300046461 Bacteria 2463
442 Ga0495651_0002251 3300046462 Bacteria 14907
443 Ga0495651_0011791 3300046462 Bacteria 6718
444 Ga0495651_0021678 3300046462 Bacteria 4994
445 Ga0495651_0056889 3300046462 Bacteria 3003
446 Ga0495653_0001970 3300046463 Bacteria 16162
447 Ga0495653_0002205 3300046463 Bacteria 15402
448 Ga0495653_0016859 3300046463 Bacteria 5945
449 Ga0495653_0093678 3300046463 Bacteria 2190
450 Ga0495580_0007445 3300046472 Bacteria 8799
451 Ga0495580_0049530 3300046472 Bacteria 2972
452 Ga0495582_0031128 3300046473 Bacteria 2931
453 Ga0495639_0001638 3300046475 Bacteria 9972
454 Ga0495662_0010392 3300046476 Bacteria 4559
455 Ga0495662_0068676 3300046476 Bacteria 1716
456 Ga0495664_0000535 3300046477 Bacteria 19109
457 Ga0495664_0010056 3300046477 Bacteria 5306
458 Ga0495664_0010569 3300046477 Bacteria 5180
459 Ga0495664_0039665 3300046477 Bacteria 2783
460 Ga0495664_0046676 3300046477 Bacteria 2570
461 Ga0495594_0002852 3300046499 Bacteria 8982
462 Ga0495606_0001924 3300046507 Bacteria 25800
463 Ga0495608_0002854 3300046511 Bacteria 12378
464 Ga0495608_0028155 3300046511 Bacteria 3819
465 Ga0495608_0030892 3300046511 Bacteria 3623
466 Ga0495618_0005766 3300046514 Bacteria 7525
467 Ga0495618_0039204 3300046514 Bacteria 2978
468 Ga0495618_0093896 3300046514 Bacteria 1918
469 Ga0495628_0103559 3300046516 Bacteria 2194
470 Ga0495630_0000611 3300046517 Bacteria 25878
471 Ga0495630_0072650 3300046517 Bacteria 2590
472 Ga0495630_0074696 3300046517 Bacteria 2553
473 Ga0495666_0000522 3300046526 Bacteria 17099
474 Ga0495666_0001378 3300046526 Bacteria 11779
475 Ga0495652_0008598 3300046529 Bacteria 9307
476 Ga0495652_0017031 3300046529 Bacteria 6492
477 Ga0495652_0023765 3300046529 Bacteria 5432
478 Ga0495652_0045084 3300046529 Bacteria 3794
479 Ga0495652_0130161 3300046529 Bacteria 1993
480 Ga0495665_0003264 3300046531 Bacteria 8780
481 Ga0495665_0004535 3300046531 Bacteria 7497
482 Ga0495665_0013813 3300046531 Bacteria 4361
483 Ga0495640_0008966 3300046533 Bacteria 7812
484 Ga0495640_0027185 3300046533 Bacteria 4129
485 Ga0495640_0027891 3300046533 Bacteria 4068
486 Ga0495640_0064571 3300046533 Bacteria 2474
487 Ga0495586_0000603 3300046535 Bacteria 20817
488 Ga0495586_0011264 3300046535 Bacteria 4755
489 Ga0495587_0005840 3300046536 Bacteria 8014
490 Ga0495587_0014155 3300046536 Bacteria 5009
491 Ga0495587_0019352 3300046536 Bacteria 4214
492 Ga0495587_0057252 3300046536 Bacteria 2292
493 Ga0495645_0002366 3300046543 Bacteria 12784
494 Ga0495645_0013718 3300046543 Bacteria 5741
495 Ga0495645_0114808 3300046543 Bacteria 1902
496 Ga0495667_0000254 3300046559 Bacteria 34663
497 Ga0495667_0002719 3300046559 Bacteria 11829
498 Ga0495667_0004095 3300046559 Bacteria 9793
499 Ga0495667_0034225 3300046559 Bacteria 3397
500 Ga0495667_0069432 3300046559 Bacteria 2299
501 Ga0495668_0000907 3300046616 Bacteria 33233
502 Ga0495634_0008438 3300046642 Bacteria 7667
503 Ga0495634_0027604 3300046642 Bacteria 3948
504 Ga0495625_0001756 3300046660 Bacteria 25058
505 Ga0495635_0007100 3300046663 Bacteria 7831
506 Ga0495635_0009213 3300046663 Bacteria 6896
507 Ga0495635_0012135 3300046663 Bacteria 6040
508 Ga0495635_0043071 3300046663 Bacteria 3115
509 Ga0495657_0008452 3300046675 Bacteria 7871
510 Ga0495657_0019052 3300046675 Bacteria 4958
511 Ga0495657_0030415 3300046675 Bacteria 3782
512 Ga0495657_0030686 3300046675 Bacteria 3761
513 Ga0495599_0012042 3300046678 Bacteria 5323
514 Ga0495599_0012075 3300046678 Bacteria 5315
515 Ga0495599_0109598 3300046678 Bacteria 1720
516 Ga0495623_0027189 3300046679 Bacteria 3678
517 Ga0495623_0031688 3300046679 Bacteria 3398
518 Ga0495623_0058974 3300046679 Bacteria 2412
519 Ga0495646_0077780 3300046680 Bacteria 1940
520 Ga0495646_0097929 3300046680 Bacteria 1685
521 Ga0495647_0016513 3300046681 Bacteria 2599
522 Ga0495658_0006326 3300046683 Bacteria 5818
523 Ga0495658_0049336 3300046683 Bacteria 2377
524 Ga0495613_0021766 3300046689 Bacteria 4777
525 Ga0495624_0002198 3300046690 Bacteria 14890
526 Ga0495624_0005267 3300046690 Bacteria 9339
527 Ga0495624_0035154 3300046690 Bacteria 3235
528 Ga0495600_0003900 3300046809 Bacteria 8856
529 Ga0495600_0022120 3300046809 Bacteria 4080
530 Ga0495600_0023132 3300046809 Bacteria 3997
531 Ga0495600_0067876 3300046809 Bacteria 2330
532 Ga0495581_0023994 3300047315 Bacteria 3534
533 Ga0495581_0068957 3300047315 Bacteria 2045
534 Ga0495581_0100252 3300047315 Bacteria 1682
535 Ga0495604_0021457 3300047317 Bacteria 5156
536 Ga0495604_0035748 3300047317 Bacteria 3921
537 Ga0495604_0121789 3300047317 Bacteria 1887
538 Ga0495674_0000921 3300047319 Bacteria 28109
539 Ga0495674_0003717 3300047319 Bacteria 14838
540 Ga0495674_0029704 3300047319 Bacteria 4975
541 Ga0495674_0066029 3300047319 Bacteria 3140
542 Ga0495674_0123294 3300047319 Bacteria 2188
543 Ga0495676_0012381 3300047321 Bacteria 7685
544 Ga0495680_0001471 3300047322 Bacteria 25414
545 Ga0495680_0005235 3300047322 Bacteria 12246
546 Ga0495680_0005358 3300047322 Bacteria 12098
547 Ga0495680_0016731 3300047322 Bacteria 6288
548 Ga0495680_0028247 3300047322 Bacteria 4600
549 Ga0495680_0057334 3300047322 Bacteria 3012
550 Ga0495680_0094928 3300047322 Bacteria 2230
551 Ga0495675_0019397 3300047444 Bacteria 4321
552 Ga0495675_0042718 3300047444 Bacteria 2887
553 Ga0495675_0062178 3300047444 Bacteria 2364
554 Ga0495675_0096244 3300047444 Bacteria 1856
555 Ga0495684_0002564 3300047471 Bacteria 14445
556 Ga0495684_0034496 3300047471 Bacteria 3882
557 Ga0495684_0037337 3300047471 Bacteria 3725
558 Ga0495684_0120475 3300047471 Bacteria 1976
559 Ga0495593_0001342 3300047673 Bacteria 14392
560 Ga0495593_0003178 3300047673 Bacteria 9864
561 Ga0495602_0075206 3300048088 Bacteria 2867
562 Ga0495602_0081418 3300048088 Bacteria 2722
563 Ga0495602_0130080 3300048088 Bacteria 2009
564 Ga0495602_0144926 3300048088 Bacteria 1875
565 Ga0495614_0013563 3300048089 Bacteria 3573
566 Ga0495626_0000687 3300048091 Bacteria 32458
567 Ga0496100_0052625 3300048903 Bacteria 2648
568 Ga0496101_0053621 3300048904 Bacteria 2910
569 Ga0496102_0017605 3300048905 Bacteria 6261
570 Ga0496102_0065822 3300048905 Bacteria 3322
571 Ga0496104_0026187 3300048907 Bacteria 5381
572 Ga0496104_0112981 3300048907 Bacteria 2605
573 Ga0496105_0004921 3300048908 Bacteria 10100
574 Ga0496105_0009025 3300048908 Bacteria 7781
575 Ga0496105_0010886 3300048908 Bacteria 7163
576 Ga0496106_0160017 3300048909 Bacteria 1780
577 Ga0496107_0022648 3300048910 Bacteria 4440
578 Ga0496108_0003051 3300048911 Bacteria 13460
579 Ga0496109_0000405 3300048912 Bacteria 38562
580 Ga0496110_0005067 3300048913 Bacteria 10295
581 Ga0496110_0012887 3300048913 Bacteria 6892
582 Ga0496110_0056486 3300048913 Bacteria 3454
583 Ga0496110_0316509 3300048913 Bacteria 1421
584 Ga0496111_0000601 3300048914 Bacteria 18995
585 Ga0496111_0002094 3300048914 Bacteria 11906
586 Ga0496112_0119762 3300048915 Bacteria 2602
587 Ga0496112_0176163 3300048915 Bacteria 2104
588 Ga0496112_0185224 3300048915 Bacteria 2045
589 Ga0496113_0088429 3300048916 Bacteria 2383
590 Ga0496114_0037990 3300048917 Bacteria 3983
591 Ga0496114_0143310 3300048917 Bacteria 2070
592 Ga0496115_0089529 3300048918 Bacteria 2513
593 Ga0496126_0000022 3300048929 Bacteria 464393
594 Ga0501037_0025648 3300049573 Bacteria 4355
595 Ga0501047_0013662 3300049581 Bacteria 7707
596 Ga0501047_0019565 3300049581 Bacteria 6496
597 Ga0501069_0001080 3300049585 Bacteria 13107
598 Ga0501070_0001163 3300049586 Bacteria 23531
599 Ga0501070_0008460 3300049586 Bacteria 8692
600 Ga0501071_0121598 3300049587 Bacteria 1935
601 Ga0501074_0006228 3300049590 Bacteria 8610
602 Ga0501074_0109770 3300049590 Bacteria 1974
603 Ga0501075_0095243 3300049591 Bacteria 2259
604 Ga0501077_0029415 3300049593 Bacteria 3492
605 Ga0501079_0000971 3300049741 Bacteria 19779
606 Ga0501080_0000278 3300049742 Bacteria 38585
607 Ga0501080_0016523 3300049742 Bacteria 6818
608 Ga0501080_0070587 3300049742 Bacteria 3249
609 Ga0501080_0071420 3300049742 Bacteria 3229
610 Ga0501080_0202951 3300049742 Bacteria 1820
611 nmdc:mga05p37_302149_c1 3300050507 Bacteria 1901
612 nmdc:mga05p37_30312_c1 3300050507 Bacteria 6600
613 nmdc:mga05p37_4438_c1 3300050507 Bacteria 16397
614 nmdc:mga05p37_57310_c1 3300050507 Bacteria 4798
615 nmdc:mga05p37_61_c1 3300050507 Bacteria 94943
616 nmdc:mga09592_17_c1 3300050508 Bacteria 95560
617 nmdc:mga09592_96400_c1 3300050508 Bacteria 2530
618 nmdc:mga0qj67_1305_c1 3300050509 Bacteria 17488
619 nmdc:mga0qj67_32_c1 3300050509 Bacteria 98555
620 nmdc:mga06r32_19359_c1 3300050510 Bacteria 6244
621 nmdc:mga06r32_26_c1 3300050510 Bacteria 90558
622 nmdc:mga08y16_15394_c1 3300050511 Bacteria 8045
623 nmdc:mga08y16_65187_c1 3300050511 Bacteria 3803
624 nmdc:mga0n895_154302_c1 3300050512 Bacteria 2327
625 nmdc:mga0n895_9045_c1 3300050512 Bacteria 8689
626 nmdc:mga0rr50_1354_c1 3300050513 Bacteria 13386
627 nmdc:mga0rr50_15487_c1 3300050513 Bacteria 5036
628 nmdc:mga08x19_11432_c1 3300050514 Bacteria 5342
629 nmdc:mga08x19_7000_c1 3300050514 Bacteria 6696
630 nmdc:mga0a205_27716_c1 3300050515 Bacteria 5410
631 Ga0495601_0077222 3300053077 Bacteria 2132
632 Ga0495612_0004980 3300053078 Bacteria 5497
633 Ga0495612_0042196 3300053078 Bacteria 1861
634 Ga0495595_0001189 3300053084 Bacteria 10120
635 Ga0495595_0037066 3300053084 Bacteria 2216
636 Ga0495595_0064449 3300053084 Bacteria 1722
637 Ga0495619_0011582 3300053085 Bacteria 5557
638 Ga0500646_0000143 3300053090 Bacteria 21040
639 Ga0500569_007291 3300053109 Bacteria 2473
640 Ga0500568_0001871 3300053139 Bacteria 12963
641 Ga0500588_0000517 3300053146 Bacteria 6189
642 Ga0466962_0029201 3300061719 Bacteria 2639
643 Ga0530510_0021801 3300061734 Bacteria 4559

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0586466 Ga0436365_0586466_635_1753 330
2 3300046454 Ga0495592_0056451 Ga0495592_0056451_584_1843 378
3 3300046514 Ga0495618_0093896 Ga0495618_0093896_416_1675 378
4 3300046529 Ga0495652_0130161 Ga0495652_0130161_196_1455 378
5 3300046536 Ga0495587_0057252 Ga0495587_0057252_532_1791 378
6 3300046559 Ga0495667_0069432 Ga0495667_0069432_487_1746 378
7 3300047322 Ga0495680_0094928 Ga0495680_0094928_592_1851 378
8 3300047471 Ga0495684_0034496 Ga0495684_0034496_2384_3643 378
9 3300048913 Ga0496110_0316509 Ga0496110_0316509_131_1402 380
10 3300005327 Ga0070658_10042607 Ga0070658_100426074 381
11 3300005441 Ga0070700_100112604 Ga0070700_1001126041 381
12 3300005563 Ga0068855_100224284 Ga0068855_1002242842 381
13 3300005577 Ga0068857_100221950 Ga0068857_1002219502 381
14 3300006173 Ga0070716_100044210 Ga0070716_1000442101 381
15 3300009174 Ga0105241_10069806 Ga0105241_100698063 381
16 3300025939 Ga0207665_10029973 Ga0207665_100299733 381
17 3300026121 Ga0207683_10044813 Ga0207683_100448134 381
18 3300048909 Ga0496106_0160017 Ga0496106_0160017_478_1752 381
19 3300005435 Ga0070714_100083193 Ga0070714_1000831932 382
20 3300005437 Ga0070710_10073193 Ga0070710_100731931 382
21 3300005530 Ga0070679_100091365 Ga0070679_1000913651 382
22 3300025929 Ga0207664_10060279 Ga0207664_100602792 382
23 3300005339 Ga0070660_100025036 Ga0070660_1000250363 383
24 3300025919 Ga0207657_10032723 Ga0207657_100327235 383
25 3300048088 Ga0495602_0130080 Ga0495602_0130080_225_1499 383
26 3300021384 Ga0213876_10000552 Ga0213876_1000055216 384
27 3300039437 Ga0436365_1781586 Ga0436365_1781586_32469_33740 384
28 3300046477 Ga0495664_0046676 Ga0495664_0046676_519_1859 385
29 3300047319 Ga0495674_0123294 Ga0495674_0123294_98_1438 385
30 3300047322 Ga0495680_0005235 Ga0495680_0005235_15_1292 385
31 3300005435 Ga0070714_100193533 Ga0070714_1001935332 386
32 3300025929 Ga0207664_10190772 Ga0207664_101907721 386
33 3300006847 Ga0075431_100120206 Ga0075431_1001202063 387
34 3300005336 Ga0070680_100002227 Ga0070680_1000022276 389
35 3300006844 Ga0075428_100000598 Ga0075428_1000005985 389
36 3300050510 nmdc:mga06r32_19359_c1 nmdc:mga06r32_19359_c1_501_1832 390
37 3300005468 Ga0070707_100197809 Ga0070707_1001978093 391
38 3300006028 Ga0070717_10015393 Ga0070717_100153936 391
39 3300007265 Ga0099794_10006625 Ga0099794_100066253 391
40 3300009147 Ga0114129_10000272 Ga0114129_1000027244 391
41 3300025922 Ga0207646_10061146 Ga0207646_100611461 391
42 3300050507 nmdc:mga05p37_4438_c1 nmdc:mga05p37_4438_c1_3995_5302 391
43 3300005354 Ga0070675_100183577 Ga0070675_1001835772 392
44 3300006844 Ga0075428_100029853 Ga0075428_1000298532 394
45 3300006847 Ga0075431_100011144 Ga0075431_1000111445 394
46 3300006880 Ga0075429_100003184 Ga0075429_10000318414 394
47 3300050507 nmdc:mga05p37_30312_c1 nmdc:mga05p37_30312_c1_1550_2845 394
48 3300013308 Ga0157375_10050374 Ga0157375_100503743 395
49 3300048905 Ga0496102_0065822 Ga0496102_0065822_1096_2436 395
50 3300048915 Ga0496112_0119762 Ga0496112_0119762_935_2275 395
51 3300006880 Ga0075429_100033013 Ga0075429_1000330132 396
52 3300009147 Ga0114129_10020083 Ga0114129_100200839 396
53 3300049573 Ga0501037_0025648 Ga0501037_0025648_2385_3740 396
54 3300049742 Ga0501080_0202951 Ga0501080_0202951_317_1699 396
55 3300046477 Ga0495664_0039665 Ga0495664_0039665_667_2052 397
56 3300053139 Ga0500568_0001871 Ga0500568_0001871_10383_11720 397
57 3300005471 Ga0070698_100061318 Ga0070698_1000613184 398
58 3300034957 Ga0373938_0016256 Ga0373938_0016256_35_1366 398
59 3300044684 Ga0466966_0000704 Ga0466966_0000704_12300_13643 398
60 3300044842 Ga0466957_0000234 Ga0466957_0000234_10170_11513 398
61 3300045836 Ga0466958_0002622 Ga0466958_0002622_1989_3332 398
62 3300045976 Ga0466967_0054920 Ga0466967_0054920_1161_2504 398
63 iso_pu_bacteria 2856741275 2856743151 398
64 iso_pu_bacteria 2856858025 2856859730 398
65 iso_pu_bacteria 2891395885 2891401155 398
66 iso_pu_bacteria 2891554331 2891559845 398
67 iso_pu_bacteria 2891562705 2891566054 398
68 iso_pu_bacteria 3002998708 3002999615 398
69 iso_pu_bacteria 8053945823 8053946516 398
70 3300005334 Ga0068869_100068633 Ga0068869_1000686332 399
71 3300005338 Ga0068868_100020944 Ga0068868_1000209444 399
72 3300005366 Ga0070659_100000886 Ga0070659_10000088622 399
73 3300005435 Ga0070714_100000319 Ga0070714_1000003196 399
74 3300005436 Ga0070713_100046651 Ga0070713_1000466512 399
75 3300005983 Ga0081540_1000207 Ga0081540_100020759 399
76 3300005983 Ga0081540_1018761 Ga0081540_10187612 399
77 3300006028 Ga0070717_10026141 Ga0070717_100261413 399
78 3300013105 Ga0157369_10008009 Ga0157369_1000800910 399
79 3300021384 Ga0213876_10000193 Ga0213876_1000019346 399
80 3300025928 Ga0207700_10027643 Ga0207700_100276433 399
81 3300025929 Ga0207664_10000218 Ga0207664_1000021836 399
82 3300025932 Ga0207690_10000393 Ga0207690_1000039321 399
83 3300025942 Ga0207689_10083080 Ga0207689_100830802 399
84 3300026023 Ga0207677_10011954 Ga0207677_100119543 399
85 3300031616 Ga0307508_10042719 Ga0307508_100427193 399
86 3300034957 Ga0373938_0005385 Ga0373938_0005385_569_1912 399
87 3300035695 Ga0373927_0000125 Ga0373927_0000125_49574_50920 399
88 3300037068 Ga0373925_0000003 Ga0373925_0000003_230889_232235 399
89 3300037853 Ga0436364_1201672 Ga0436364_1201672_125_1450 399
90 3300039437 Ga0436365_0115299 Ga0436365_0115299_25479_26804 399
91 3300039450 Ga0436363_0294318 Ga0436363_0294318_214_1539 399
92 3300044735 Ga0466968_0000465 Ga0466968_0000465_404_1741 399
93 3300045976 Ga0466967_0000475 Ga0466967_0000475_5460_6797 399
94 3300046459 Ga0495629_0072822 Ga0495629_0072822_690_2039 399
95 3300046499 Ga0495594_0002852 Ga0495594_0002852_5576_6925 399
96 3300005985 Ga0081539_10003770 Ga0081539_1000377018 400
97 3300013102 Ga0157371_10067364 Ga0157371_100673642 400
98 3300021388 Ga0213875_10000218 Ga0213875_1000021832 400
99 3300028794 Ga0307515_10103289 Ga0307515_101032893 400
100 3300031247 Ga0265340_10000457 Ga0265340_1000045723 400
101 3300031616 Ga0307508_10006410 Ga0307508_100064103 400
102 3300035086 Ga0373934_0010850 Ga0373934_0010850_1410_2741 400
103 3300035089 Ga0373944_0002781 Ga0373944_0002781_2675_4006 400
104 3300035111 Ga0373923_0002491 Ga0373923_0002491_3644_4975 400
105 3300035114 Ga0373939_0011898 Ga0373939_0011898_234_1565 400
106 3300035170 Ga0373943_0018423 Ga0373943_0018423_304_1635 400
107 3300035171 Ga0373946_0012619 Ga0373946_0012619_228_1559 400
108 3300035171 Ga0373946_0049706 Ga0373946_0049706_50_1381 400
109 3300035172 Ga0373955_0041133 Ga0373955_0041133_228_1559 400
110 3300035410 Ga0373924_0028597 Ga0373924_0028597_59_1390 400
111 3300035692 Ga0373935_0021620 Ga0373935_0021620_1037_2368 400
112 3300035725 Ga0373947_0009658 Ga0373947_0009658_1334_2665 400
113 3300037068 Ga0373925_0045436 Ga0373925_0045436_1334_2665 400
114 3300037312 Ga0395899_0006633 Ga0395899_0006633_1563_2903 400
115 3300037853 Ga0436364_0538624 Ga0436364_0538624_41370_42707 400
116 3300039437 Ga0436365_0083635 Ga0436365_0083635_2039_3376 400
117 3300046454 Ga0495592_0063346 Ga0495592_0063346_1231_2562 400
118 3300046455 Ga0495603_0005396 Ga0495603_0005396_4135_5466 400
119 3300046459 Ga0495629_0058089 Ga0495629_0058089_117_1448 400
120 3300046461 Ga0495641_0032936 Ga0495641_0032936_76_1407 400
121 3300046463 Ga0495653_0016859 Ga0495653_0016859_4202_5533 400
122 3300046472 Ga0495580_0049530 Ga0495580_0049530_109_1440 400
123 3300046473 Ga0495582_0031128 Ga0495582_0031128_94_1425 400
124 3300046475 Ga0495639_0001638 Ga0495639_0001638_3946_5277 400
125 3300046476 Ga0495662_0010392 Ga0495662_0010392_2184_3515 400
126 3300046477 Ga0495664_0010056 Ga0495664_0010056_2873_4204 400
127 3300046511 Ga0495608_0028155 Ga0495608_0028155_1231_2562 400
128 3300046514 Ga0495618_0005766 Ga0495618_0005766_598_1929 400
129 3300046517 Ga0495630_0000611 Ga0495630_0000611_11037_12368 400
130 3300046526 Ga0495666_0001378 Ga0495666_0001378_2420_3751 400
131 3300046529 Ga0495652_0045084 Ga0495652_0045084_1334_2665 400
132 3300046531 Ga0495665_0003264 Ga0495665_0003264_7296_8627 400
133 3300046533 Ga0495640_0008966 Ga0495640_0008966_541_1872 400
134 3300046535 Ga0495586_0000603 Ga0495586_0000603_4603_5934 400
135 3300046536 Ga0495587_0014155 Ga0495587_0014155_2318_3649 400
136 3300046543 Ga0495645_0002366 Ga0495645_0002366_11383_12714 400
137 3300046642 Ga0495634_0008438 Ga0495634_0008438_519_1850 400
138 3300046663 Ga0495635_0012135 Ga0495635_0012135_4031_5362 400
139 3300046675 Ga0495657_0030686 Ga0495657_0030686_103_1434 400
140 3300046678 Ga0495599_0012075 Ga0495599_0012075_1369_2700 400
141 3300046679 Ga0495623_0031688 Ga0495623_0031688_1920_3251 400
142 3300046680 Ga0495646_0097929 Ga0495646_0097929_253_1584 400
143 3300046681 Ga0495647_0016513 Ga0495647_0016513_12_1343 400
144 3300046683 Ga0495658_0006326 Ga0495658_0006326_35_1366 400
145 3300046690 Ga0495624_0035154 Ga0495624_0035154_104_1435 400
146 3300046809 Ga0495600_0067876 Ga0495600_0067876_71_1402 400
147 3300047315 Ga0495581_0100252 Ga0495581_0100252_99_1430 400
148 3300047322 Ga0495680_0016731 Ga0495680_0016731_4577_5908 400
149 3300047471 Ga0495684_0037337 Ga0495684_0037337_1793_3124 400
150 3300047673 Ga0495593_0001342 Ga0495593_0001342_12837_14168 400
151 3300048089 Ga0495614_0013563 Ga0495614_0013563_2205_3536 400
152 3300048908 Ga0496105_0009025 Ga0496105_0009025_594_1925 400
153 3300048913 Ga0496110_0056486 Ga0496110_0056486_272_1603 400
154 3300048918 Ga0496115_0089529 Ga0496115_0089529_1147_2478 400
155 3300053077 Ga0495601_0077222 Ga0495601_0077222_325_1656 400
156 3300053078 Ga0495612_0004980 Ga0495612_0004980_3749_5080 400
157 3300053084 Ga0495595_0064449 Ga0495595_0064449_72_1403 400
158 3300053085 Ga0495619_0011582 Ga0495619_0011582_4112_5443 400
159 iso_pu_bacteria 2861520306 2861526612 400
160 iso_pu_bacteria 8002811521 8002813553 400
161 iso_pu_bacteria 8057568493 8057574530 400
162 3300005347 Ga0070668_100181420 Ga0070668_1001814201 401
163 3300005843 Ga0068860_100014937 Ga0068860_1000149374 401
164 3300031507 Ga0307509_10061343 Ga0307509_100613432 401
165 3300044765 Ga0466970_0007026 Ga0466970_0007026_311_1648 401
166 3300046472 Ga0495580_0007445 Ga0495580_0007445_2816_4153 401
167 3300046526 Ga0495666_0000522 Ga0495666_0000522_15036_16373 401
168 3300046531 Ga0495665_0004535 Ga0495665_0004535_2955_4292 401
169 3300003203 JGI25406J46586_10001944 JGI25406J46586_100019444 402
170 3300005327 Ga0070658_10045142 Ga0070658_100451423 402
171 3300005329 Ga0070683_100000557 Ga0070683_1000005579 402
172 3300005329 Ga0070683_100059441 Ga0070683_1000594413 402
173 3300005367 Ga0070667_100158779 Ga0070667_1001587792 402
174 3300005435 Ga0070714_100060055 Ga0070714_1000600553 402
175 3300005445 Ga0070708_100096977 Ga0070708_1000969773 402
176 3300005458 Ga0070681_10065012 Ga0070681_100650123 402
177 3300005459 Ga0068867_100025176 Ga0068867_1000251763 402
178 3300005468 Ga0070707_100048768 Ga0070707_1000487683 402
179 3300005518 Ga0070699_100277324 Ga0070699_1002773241 402
180 3300005535 Ga0070684_100007875 Ga0070684_1000078754 402
181 3300005983 Ga0081540_1000517 Ga0081540_100051712 402
182 3300005985 Ga0081539_10000809 Ga0081539_1000080936 402
183 3300006844 Ga0075428_100007643 Ga0075428_1000076433 402
184 3300006844 Ga0075428_100197116 Ga0075428_1001971162 402
185 3300006846 Ga0075430_100001817 Ga0075430_1000018177 402
186 3300006846 Ga0075430_100004049 Ga0075430_1000040493 402
187 3300006847 Ga0075431_100004612 Ga0075431_1000046125 402
188 3300006880 Ga0075429_100001920 Ga0075429_10000192014 402
189 3300009147 Ga0114129_10000557 Ga0114129_1000055716 402
190 3300020081 Ga0206354_10180487 Ga0206354_101804872 402
191 3300020082 Ga0206353_10443563 Ga0206353_104435632 402
192 3300021358 Ga0213873_10000068 Ga0213873_1000006816 402
193 3300025909 Ga0207705_10119778 Ga0207705_101197782 402
194 3300025917 Ga0207660_10191895 Ga0207660_101918952 402
195 3300025929 Ga0207664_10027036 Ga0207664_100270362 402
196 3300025944 Ga0207661_10041617 Ga0207661_100416173 402
197 3300025944 Ga0207661_10063571 Ga0207661_100635712 402
198 3300028800 Ga0265338_10054526 Ga0265338_100545264 402
199 3300031241 Ga0265325_10009579 Ga0265325_100095795 402
200 3300031344 Ga0265316_10024470 Ga0265316_100244702 402
201 3300031456 Ga0307513_10048880 Ga0307513_100488802 402
202 3300031456 Ga0307513_10144174 Ga0307513_101441742 402
203 3300031456 Ga0307513_10180230 Ga0307513_101802302 402
204 3300031616 Ga0307508_10040674 Ga0307508_100406741 402
205 3300033179 Ga0307507_10139828 Ga0307507_101398282 402
206 3300035112 Ga0373932_0004457 Ga0373932_0004457_419_1759 402
207 3300035207 Ga0373942_0000279 Ga0373942_0000279_1904_3241 402
208 3300036401 Ga0373937_0071089 Ga0373937_0071089_996_2339 402
209 3300037853 Ga0436364_1394109 Ga0436364_1394109_956_2512 402
210 3300039453 Ga0436362_0358937 Ga0436362_0358937_6496_7833 402
211 3300044694 Ga0466963_0093382 Ga0466963_0093382_188_1531 402
212 3300045976 Ga0466967_0024008 Ga0466967_0024008_274_1617 402
213 3300049581 Ga0501047_0019565 Ga0501047_0019565_2265_3605 402
214 3300049593 Ga0501077_0029415 Ga0501077_0029415_166_1506 402
215 3300050507 nmdc:mga05p37_61_c1 nmdc:mga05p37_61_c1_72931_74268 402
216 3300050508 nmdc:mga09592_17_c1 nmdc:mga09592_17_c1_17266_18603 402
217 3300050509 nmdc:mga0qj67_1305_c1 nmdc:mga0qj67_1305_c1_10161_11498 402
218 3300050509 nmdc:mga0qj67_32_c1 nmdc:mga0qj67_32_c1_20261_21598 402
219 3300050510 nmdc:mga06r32_26_c1 nmdc:mga06r32_26_c1_16290_17627 402
220 3300053084 Ga0495595_0037066 Ga0495595_0037066_322_1650 402
221 3300053090 Ga0500646_0000143 Ga0500646_0000143_14710_16053 402
222 3300053146 Ga0500588_0000517 Ga0500588_0000517_1160_2503 402
223 iso_pu_bacteria 2515154088 2515498034 402
224 iso_pu_bacteria 2515154129 2515721804 402
225 iso_pu_bacteria 2515154137 2515756209 402
226 iso_pu_bacteria 2515154202 2516086836 402
227 iso_pu_bacteria 2515154203 2516092154 402
228 iso_pu_bacteria 2675903059 2676486935 402
229 iso_pu_bacteria 2772190715 2772642777 402
230 iso_pu_bacteria 2831935698 2831940948 402
231 iso_pu_bacteria 2832004796 2832005278 402
232 iso_pu_bacteria 2855670206 2855674368 402
233 iso_pu_bacteria 2855676851 2855679709 402
234 iso_pu_bacteria 2855683550 2855685710 402
235 iso_pu_bacteria 2857288857 2857290616 402
236 iso_pu_bacteria 2858848962 2858854632 402
237 iso_pu_bacteria 2858882152 2858885032 402
238 iso_pu_bacteria 2858888857 2858891828 402
239 iso_pu_bacteria 2858895516 2858899605 402
240 iso_pu_bacteria 2866065130 2866069593 402
241 iso_pu_bacteria 2867312974 2867318952 402
242 iso_pu_bacteria 2867319477 2867323898 402
243 iso_pu_bacteria 2869048445 2869049318 402
244 iso_pu_bacteria 2869061728 2869064065 402
245 iso_pu_bacteria 2869068681 2869072711 402
246 iso_pu_bacteria 2873314349 2873317087 402
247 iso_pu_bacteria 2880489317 2880494412 402
248 iso_pu_bacteria 2880495981 2880497898 402
249 iso_pu_bacteria 2887478801 2887484383 402
250 iso_pu_bacteria 2902582711 2902588588 402
251 iso_pu_bacteria 2929219909 2929219958 402
252 iso_pu_bacteria 2929226422 2929226473 402
253 iso_pu_bacteria 2996221748 2996225908 402
254 iso_pu_bacteria 8001781756 8001782886 402
255 iso_pu_bacteria 8054704163 8054710547 402
256 iso_pu_bacteria 8054734606 8054740535 402
257 3300005439 Ga0070711_100166223 Ga0070711_1001662231 403
258 3300005445 Ga0070708_100060710 Ga0070708_1000607103 403
259 3300005467 Ga0070706_100011220 Ga0070706_1000112203 403
260 3300005468 Ga0070707_100001180 Ga0070707_1000011804 403
261 3300005536 Ga0070697_100039861 Ga0070697_1000398614 403
262 3300005985 Ga0081539_10001196 Ga0081539_1000119643 403
263 3300009147 Ga0114129_10132722 Ga0114129_101327223 403
264 3300013306 Ga0163162_10085493 Ga0163162_100854933 403
265 3300025910 Ga0207684_10040619 Ga0207684_100406194 403
266 3300025922 Ga0207646_10003773 Ga0207646_100037734 403
267 3300028786 Ga0307517_10039180 Ga0307517_100391803 403
268 3300028794 Ga0307515_10005285 Ga0307515_100052853 403
269 3300030522 Ga0307512_10007735 Ga0307512_100077356 403
270 3300030522 Ga0307512_10015066 Ga0307512_100150662 403
271 3300031616 Ga0307508_10014514 Ga0307508_100145143 403
272 3300031616 Ga0307508_10134323 Ga0307508_101343232 403
273 3300031824 Ga0307413_10010370 Ga0307413_100103704 403
274 3300031889 Ga0326468_10000567 Ga0326468_100005673 403
275 3300031901 Ga0307406_10006740 Ga0307406_100067403 403
276 3300031901 Ga0307406_10024910 Ga0307406_100249101 403
277 3300031995 Ga0307409_100010423 Ga0307409_1000104233 403
278 3300032005 Ga0307411_10061973 Ga0307411_100619733 403
279 3300035091 Ga0373951_0000035 Ga0373951_0000035_12733_14070 403
280 3300035172 Ga0373955_0059780 Ga0373955_0059780_607_1950 403
281 3300036401 Ga0373937_0091119 Ga0373937_0091119_506_1876 403
282 3300037068 Ga0373925_0120359 Ga0373925_0120359_216_1601 403
283 3300037312 Ga0395899_0031133 Ga0395899_0031133_2373_3731 403
284 3300037418 Ga0395900_0004495 Ga0395900_0004495_3450_4808 403
285 3300037466 Ga0395898_0010093 Ga0395898_0010093_69_1427 403
286 3300037471 Ga0395905_0014282 Ga0395905_0014282_2386_3744 403
287 3300037853 Ga0436364_0386143 Ga0436364_0386143_162_1520 403
288 3300038443 Ga0395901_0013285 Ga0395901_0013285_69_1427 403
289 3300044658 Ga0466972_0001392 Ga0466972_0001392_474_1847 403
290 3300044684 Ga0466966_0026923 Ga0466966_0026923_331_1704 403
291 3300044719 Ga0466971_0006211 Ga0466971_0006211_2212_3585 403
292 3300046462 Ga0495651_0002251 Ga0495651_0002251_11653_13023 403
293 3300046463 Ga0495653_0001970 Ga0495653_0001970_7301_8671 403
294 3300046511 Ga0495608_0002854 Ga0495608_0002854_8744_10114 403
295 3300046516 Ga0495628_0103559 Ga0495628_0103559_377_1747 403
296 3300046529 Ga0495652_0008598 Ga0495652_0008598_7161_8531 403
297 3300046533 Ga0495640_0027185 Ga0495640_0027185_2327_3697 403
298 3300046536 Ga0495587_0019352 Ga0495587_0019352_1854_3224 403
299 3300046559 Ga0495667_0000254 Ga0495667_0000254_2261_3631 403
300 3300046663 Ga0495635_0043071 Ga0495635_0043071_1085_2455 403
301 3300046675 Ga0495657_0008452 Ga0495657_0008452_319_1689 403
302 3300046809 Ga0495600_0003900 Ga0495600_0003900_5991_7361 403
303 3300047317 Ga0495604_0021457 Ga0495604_0021457_261_1631 403
304 3300047319 Ga0495674_0003717 Ga0495674_0003717_5976_7346 403
305 3300047322 Ga0495680_0001471 Ga0495680_0001471_24004_25374 403
306 3300047444 Ga0495675_0062178 Ga0495675_0062178_764_2134 403
307 3300047471 Ga0495684_0120475 Ga0495684_0120475_236_1606 403
308 3300048088 Ga0495602_0075206 Ga0495602_0075206_236_1606 403
309 3300048917 Ga0496114_0037990 Ga0496114_0037990_903_2243 403
310 3300049581 Ga0501047_0013662 Ga0501047_0013662_625_1974 403
311 3300049586 Ga0501070_0001163 Ga0501070_0001163_9012_10346 403
312 3300049590 Ga0501074_0006228 Ga0501074_0006228_6450_7784 403
313 3300049741 Ga0501079_0000971 Ga0501079_0000971_5434_6768 403
314 3300049742 Ga0501080_0000278 Ga0501080_0000278_28969_30303 403
315 3300050507 nmdc:mga05p37_302149_c1 nmdc:mga05p37_302149_c1_353_1732 403
316 3300053109 Ga0500569_007291 Ga0500569_007291_854_2191 403
317 iso_pu_bacteria 8003870546 8003873731 403
318 iso_pu_bacteria 8055066027 8055073391 403
319 iso_pu_bacteria 8055172936 8055175846 403
320 3300005329 Ga0070683_100006507 Ga0070683_1000065076 404
321 3300005334 Ga0068869_100004358 Ga0068869_1000043584 404
322 3300005339 Ga0070660_100021974 Ga0070660_1000219745 404
323 3300005343 Ga0070687_100077703 Ga0070687_1000777031 404
324 3300005347 Ga0070668_100006041 Ga0070668_1000060416 404
325 3300005354 Ga0070675_100000851 Ga0070675_1000008519 404
326 3300005364 Ga0070673_100078002 Ga0070673_1000780021 404
327 3300005366 Ga0070659_100016339 Ga0070659_1000163392 404
328 3300005366 Ga0070659_100120145 Ga0070659_1001201452 404
329 3300005440 Ga0070705_100046324 Ga0070705_1000463243 404
330 3300005441 Ga0070700_100004088 Ga0070700_1000040886 404
331 3300005455 Ga0070663_100014634 Ga0070663_1000146342 404
332 3300005457 Ga0070662_100098811 Ga0070662_1000988112 404
333 3300005471 Ga0070698_100107989 Ga0070698_1001079891 404
334 3300005535 Ga0070684_100004299 Ga0070684_1000042991 404
335 3300005539 Ga0068853_100042610 Ga0068853_1000426104 404
336 3300005543 Ga0070672_100011916 Ga0070672_1000119163 404
337 3300005545 Ga0070695_100022226 Ga0070695_1000222262 404
338 3300005564 Ga0070664_100000617 Ga0070664_10000061716 404
339 3300005577 Ga0068857_100045321 Ga0068857_1000453214 404
340 3300005578 Ga0068854_100058231 Ga0068854_1000582313 404
341 3300005615 Ga0070702_100060131 Ga0070702_1000601312 404
342 3300005719 Ga0068861_100032455 Ga0068861_1000324554 404
343 3300005719 Ga0068861_100070616 Ga0068861_1000706163 404
344 3300005844 Ga0068862_100020398 Ga0068862_1000203982 404
345 3300005985 Ga0081539_10096472 Ga0081539_100964722 404
346 3300006880 Ga0075429_100247561 Ga0075429_1002475612 404
347 3300007788 Ga0099795_10028181 Ga0099795_100281811 404
348 3300009093 Ga0105240_10273158 Ga0105240_102731582 404
349 3300009094 Ga0111539_10007767 Ga0111539_100077678 404
350 3300009098 Ga0105245_10011036 Ga0105245_100110365 404
351 3300010375 Ga0105239_10190039 Ga0105239_101900392 404
352 3300013105 Ga0157369_10007654 Ga0157369_100076547 404
353 3300021388 Ga0213875_10000428 Ga0213875_1000042834 404
354 3300025901 Ga0207688_10006713 Ga0207688_100067135 404
355 3300025908 Ga0207643_10008004 Ga0207643_100080045 404
356 3300025912 Ga0207707_10046384 Ga0207707_100463842 404
357 3300025915 Ga0207693_10006051 Ga0207693_100060519 404
358 3300025916 Ga0207663_10118993 Ga0207663_101189932 404
359 3300025918 Ga0207662_10004219 Ga0207662_100042195 404
360 3300025919 Ga0207657_10054307 Ga0207657_100543073 404
361 3300025926 Ga0207659_10004144 Ga0207659_100041447 404
362 3300025927 Ga0207687_10009534 Ga0207687_100095343 404
363 3300025929 Ga0207664_10012976 Ga0207664_100129763 404
364 3300025932 Ga0207690_10090079 Ga0207690_100900792 404
365 3300025932 Ga0207690_10090596 Ga0207690_100905962 404
366 3300025933 Ga0207706_10027305 Ga0207706_100273053 404
367 3300025933 Ga0207706_10104977 Ga0207706_101049773 404
368 3300025939 Ga0207665_10011920 Ga0207665_100119201 404
369 3300025940 Ga0207691_10013128 Ga0207691_100131284 404
370 3300025942 Ga0207689_10001161 Ga0207689_100011615 404
371 3300025942 Ga0207689_10011945 Ga0207689_100119455 404
372 3300025944 Ga0207661_10008848 Ga0207661_100088483 404
373 3300025945 Ga0207679_10002759 Ga0207679_100027592 404
374 3300025972 Ga0207668_10001164 Ga0207668_100011643 404
375 3300026035 Ga0207703_10159360 Ga0207703_101593603 404
376 3300026067 Ga0207678_10004448 Ga0207678_100044483 404
377 3300026067 Ga0207678_10006712 Ga0207678_100067126 404
378 3300026075 Ga0207708_10001038 Ga0207708_1000103810 404
379 3300026095 Ga0207676_10066988 Ga0207676_100669883 404
380 3300026116 Ga0207674_10054729 Ga0207674_100547292 404
381 3300026118 Ga0207675_100026879 Ga0207675_1000268795 404
382 3300026118 Ga0207675_100045144 Ga0207675_1000451442 404
383 3300026142 Ga0207698_10040140 Ga0207698_100401403 404
384 3300027907 Ga0207428_10010980 Ga0207428_100109802 404
385 3300028380 Ga0268265_10002195 Ga0268265_100021954 404
386 3300028794 Ga0307515_10000095 Ga0307515_1000009528 404
387 3300031731 Ga0307405_10005868 Ga0307405_100058686 404
388 3300031995 Ga0307409_100000900 Ga0307409_10000090010 404
389 3300032002 Ga0307416_100018199 Ga0307416_1000181994 404
390 3300032126 Ga0307415_100000008 Ga0307415_10000000848 404
391 3300036401 Ga0373937_0010565 Ga0373937_0010565_4631_5974 404
392 3300037068 Ga0373925_0093090 Ga0373925_0093090_18_1361 404
393 3300037853 Ga0436364_0393888 Ga0436364_0393888_27180_28523 404
394 3300044693 Ga0466961_0022404 Ga0466961_0022404_981_2321 404
395 3300044842 Ga0466957_0005441 Ga0466957_0005441_2409_3749 404
396 3300044842 Ga0466957_0033508 Ga0466957_0033508_1214_2563 404
397 3300046462 Ga0495651_0021678 Ga0495651_0021678_2145_3488 404
398 3300046507 Ga0495606_0001924 Ga0495606_0001924_6161_7498 404
399 3300046559 Ga0495667_0002719 Ga0495667_0002719_4887_6230 404
400 3300046616 Ga0495668_0000907 Ga0495668_0000907_21877_23214 404
401 3300046660 Ga0495625_0001756 Ga0495625_0001756_2290_3627 404
402 3300046663 Ga0495635_0009213 Ga0495635_0009213_5405_6748 404
403 3300046675 Ga0495657_0019052 Ga0495657_0019052_506_1849 404
404 3300047322 Ga0495680_0005358 Ga0495680_0005358_6209_7552 404
405 3300048091 Ga0495626_0000687 Ga0495626_0000687_21124_22461 404
406 3300048904 Ga0496101_0053621 Ga0496101_0053621_1254_2597 404
407 3300048915 Ga0496112_0185224 Ga0496112_0185224_104_1462 404
408 3300049742 Ga0501080_0070587 Ga0501080_0070587_290_1630 404
409 3300050508 nmdc:mga09592_96400_c1 nmdc:mga09592_96400_c1_757_2136 404
410 3300050511 nmdc:mga08y16_65187_c1 nmdc:mga08y16_65187_c1_2188_3534 404
411 3300061719 Ga0466962_0029201 Ga0466962_0029201_75_1415 404
412 3300061734 Ga0530510_0021801 Ga0530510_0021801_2862_4202 404
413 3300005336 Ga0070680_100057742 Ga0070680_1000577424 405
414 3300005336 Ga0070680_100109379 Ga0070680_1001093792 405
415 3300005435 Ga0070714_100101008 Ga0070714_1001010083 405
416 3300005445 Ga0070708_100001787 Ga0070708_1000017871 405
417 3300005467 Ga0070706_100105958 Ga0070706_1001059581 405
418 3300006028 Ga0070717_10007692 Ga0070717_100076924 405
419 3300013105 Ga0157369_10034539 Ga0157369_100345396 405
420 3300014969 Ga0157376_10161328 Ga0157376_101613282 405
421 3300022467 Ga0224712_10019476 Ga0224712_100194762 405
422 3300025910 Ga0207684_10099913 Ga0207684_100999133 405
423 3300025915 Ga0207693_10033330 Ga0207693_100333302 405
424 3300025917 Ga0207660_10082284 Ga0207660_100822842 405
425 3300025922 Ga0207646_10178531 Ga0207646_101785311 405
426 3300025944 Ga0207661_10088477 Ga0207661_100884772 405
427 3300026116 Ga0207674_10022739 Ga0207674_100227392 405
428 3300031730 Ga0307516_10001182 Ga0307516_1000118213 405
429 3300031901 Ga0307406_10003953 Ga0307406_100039532 405
430 3300032126 Ga0307415_100026955 Ga0307415_1000269553 405
431 3300035083 Ga0373926_0000673 Ga0373926_0000673_5138_6481 405
432 3300035089 Ga0373944_0000369 Ga0373944_0000369_3744_5087 405
433 3300035113 Ga0373936_0003410 Ga0373936_0003410_2810_4153 405
434 3300035116 Ga0373945_0001173 Ga0373945_0001173_1235_2578 405
435 3300035170 Ga0373943_0000269 Ga0373943_0000269_11719_13062 405
436 3300035171 Ga0373946_0002878 Ga0373946_0002878_2730_4073 405
437 3300035692 Ga0373935_0012880 Ga0373935_0012880_1523_2866 405
438 3300035695 Ga0373927_0002091 Ga0373927_0002091_13017_14360 405
439 3300035725 Ga0373947_0003170 Ga0373947_0003170_6309_7652 405
440 3300037068 Ga0373925_0105067 Ga0373925_0105067_541_1884 405
441 3300044693 Ga0466961_0013731 Ga0466961_0013731_3205_4563 405
442 3300044693 Ga0466961_0042077 Ga0466961_0042077_528_1868 405
443 3300045049 Ga0466959_0043080 Ga0466959_0043080_692_2050 405
444 3300046461 Ga0495641_0011042 Ga0495641_0011042_3350_4693 405
445 3300046463 Ga0495653_0002205 Ga0495653_0002205_8853_10196 405
446 3300046477 Ga0495664_0000535 Ga0495664_0000535_8510_9853 405
447 3300046514 Ga0495618_0039204 Ga0495618_0039204_1604_2947 405
448 3300046517 Ga0495630_0072650 Ga0495630_0072650_1186_2529 405
449 3300046529 Ga0495652_0017031 Ga0495652_0017031_3626_4969 405
450 3300046559 Ga0495667_0004095 Ga0495667_0004095_953_2296 405
451 3300046663 Ga0495635_0007100 Ga0495635_0007100_6102_7445 405
452 3300046678 Ga0495599_0012042 Ga0495599_0012042_3748_5091 405
453 3300046680 Ga0495646_0077780 Ga0495646_0077780_186_1529 405
454 3300046690 Ga0495624_0002198 Ga0495624_0002198_9887_11230 405
455 3300047315 Ga0495581_0023994 Ga0495581_0023994_1938_3281 405
456 3300047315 Ga0495581_0068957 Ga0495581_0068957_76_1428 405
457 3300047319 Ga0495674_0000921 Ga0495674_0000921_12937_14280 405
458 3300047321 Ga0495676_0012381 Ga0495676_0012381_1442_2785 405
459 3300047322 Ga0495680_0028247 Ga0495680_0028247_1066_2409 405
460 3300047471 Ga0495684_0002564 Ga0495684_0002564_4524_5867 405
461 3300048907 Ga0496104_0112981 Ga0496104_0112981_157_1575 405
462 3300048917 Ga0496114_0143310 Ga0496114_0143310_597_1937 405
463 3300049585 Ga0501069_0001080 Ga0501069_0001080_921_2264 405
464 3300049586 Ga0501070_0008460 Ga0501070_0008460_885_2225 405
465 3300049587 Ga0501071_0121598 Ga0501071_0121598_210_1550 405
466 3300049590 Ga0501074_0109770 Ga0501074_0109770_464_1807 405
467 3300049591 Ga0501075_0095243 Ga0501075_0095243_562_1902 405
468 3300049742 Ga0501080_0016523 Ga0501080_0016523_4634_5977 405
469 iso_pu_bacteria 2501939600 2501943178 405
470 iso_pu_bacteria 649633069 649810220 405
471 3300005337 Ga0070682_100137222 Ga0070682_1001372221 406
472 3300005445 Ga0070708_100015492 Ga0070708_1000154924 406
473 3300005458 Ga0070681_10001334 Ga0070681_100013343 406
474 3300005467 Ga0070706_100008084 Ga0070706_1000080847 406
475 3300005468 Ga0070707_100024871 Ga0070707_1000248713 406
476 3300005471 Ga0070698_100002462 Ga0070698_1000024625 406
477 3300005530 Ga0070679_100000273 Ga0070679_10000027321 406
478 3300025910 Ga0207684_10001782 Ga0207684_1000178214 406
479 3300025912 Ga0207707_10000023 Ga0207707_10000023189 406
480 3300025917 Ga0207660_10003404 Ga0207660_100034049 406
481 3300025921 Ga0207652_10000039 Ga0207652_1000003921 406
482 3300025922 Ga0207646_10001334 Ga0207646_1000133420 406
483 3300031249 Ga0265339_10008669 Ga0265339_100086697 406
484 3300031344 Ga0265316_10089052 Ga0265316_100890522 406
485 3300031712 Ga0265342_10031016 Ga0265342_100310163 406
486 3300041453 Ga0451797_1033868 Ga0451797_1033868_1772_3112 406
487 3300041509 Ga0451843_1154776 Ga0451843_1154776_366_1706 406
488 3300044842 Ga0466957_0070031 Ga0466957_0070031_676_2016 406
489 3300045836 Ga0466958_0046065 Ga0466958_0046065_1017_2357 406
490 3300048905 Ga0496102_0017605 Ga0496102_0017605_947_2299 406
491 3300048907 Ga0496104_0026187 Ga0496104_0026187_791_2143 406
492 3300048908 Ga0496105_0010886 Ga0496105_0010886_4559_5911 406
493 3300048911 Ga0496108_0003051 Ga0496108_0003051_5402_6754 406
494 3300048912 Ga0496109_0000405 Ga0496109_0000405_35372_36724 406
495 3300048913 Ga0496110_0012887 Ga0496110_0012887_1253_2605 406
496 3300048914 Ga0496111_0002094 Ga0496111_0002094_7315_8667 406
497 3300048915 Ga0496112_0176163 Ga0496112_0176163_734_2086 406
498 3300048916 Ga0496113_0088429 Ga0496113_0088429_193_1545 406
499 3300049742 Ga0501080_0071420 Ga0501080_0071420_695_2035 406
500 3300005434 Ga0070709_10005114 Ga0070709_100051146 407
501 3300005435 Ga0070714_100024889 Ga0070714_1000248896 407
502 3300005436 Ga0070713_100050364 Ga0070713_1000503645 407
503 3300005437 Ga0070710_10008962 Ga0070710_100089623 407
504 3300005439 Ga0070711_100038791 Ga0070711_1000387911 407
505 3300005445 Ga0070708_100039236 Ga0070708_1000392362 407
506 3300005467 Ga0070706_100010390 Ga0070706_1000103903 407
507 3300005467 Ga0070706_100030034 Ga0070706_1000300345 407
508 3300005468 Ga0070707_100000127 Ga0070707_10000012756 407
509 3300005468 Ga0070707_100006664 Ga0070707_1000066643 407
510 3300005471 Ga0070698_100000597 Ga0070698_10000059714 407
511 3300005471 Ga0070698_100008768 Ga0070698_1000087682 407
512 3300005471 Ga0070698_100090154 Ga0070698_1000901543 407
513 3300006028 Ga0070717_10051767 Ga0070717_100517672 407
514 3300006028 Ga0070717_10068380 Ga0070717_100683802 407
515 3300006175 Ga0070712_100109771 Ga0070712_1001097712 407
516 3300006871 Ga0075434_100012318 Ga0075434_1000123184 407
517 3300007076 Ga0075435_100005790 Ga0075435_1000057904 407
518 3300009545 Ga0105237_10105256 Ga0105237_101052562 407
519 3300013105 Ga0157369_10154261 Ga0157369_101542613 407
520 3300022467 Ga0224712_10001312 Ga0224712_100013123 407
521 3300024225 Ga0224572_1002342 Ga0224572_10023422 407
522 3300025898 Ga0207692_10003021 Ga0207692_100030214 407
523 3300025906 Ga0207699_10002673 Ga0207699_100026736 407
524 3300025909 Ga0207705_10017310 Ga0207705_100173106 407
525 3300025910 Ga0207684_10003848 Ga0207684_100038483 407
526 3300025910 Ga0207684_10089336 Ga0207684_100893362 407
527 3300025922 Ga0207646_10000264 Ga0207646_1000026410 407
528 3300025922 Ga0207646_10007952 Ga0207646_100079523 407
529 3300025922 Ga0207646_10074356 Ga0207646_100743562 407
530 3300025922 Ga0207646_10108072 Ga0207646_101080723 407
531 3300025928 Ga0207700_10007108 Ga0207700_100071083 407
532 3300025928 Ga0207700_10031413 Ga0207700_100314133 407
533 3300025929 Ga0207664_10008062 Ga0207664_100080626 407
534 3300025929 Ga0207664_10084004 Ga0207664_100840042 407
535 3300025939 Ga0207665_10004519 Ga0207665_100045196 407
536 3300035083 Ga0373926_0000313 Ga0373926_0000313_4705_6045 407
537 3300035086 Ga0373934_0001413 Ga0373934_0001413_6616_7956 407
538 3300035113 Ga0373936_0003491 Ga0373936_0003491_2334_3674 407
539 3300035119 Ga0373956_0009276 Ga0373956_0009276_2162_3502 407
540 3300035172 Ga0373955_0004654 Ga0373955_0004654_3866_5206 407
541 3300035172 Ga0373955_0015118 Ga0373955_0015118_616_1956 407
542 3300035692 Ga0373935_0000373 Ga0373935_0000373_15183_16523 407
543 3300035692 Ga0373935_0026324 Ga0373935_0026324_192_1532 407
544 3300035724 Ga0373933_0026188 Ga0373933_0026188_215_1555 407
545 3300035724 Ga0373933_0026953 Ga0373933_0026953_825_2165 407
546 3300035725 Ga0373947_0000007 Ga0373947_0000007_73377_74717 407
547 3300036401 Ga0373937_0046900 Ga0373937_0046900_697_2037 407
548 3300036401 Ga0373937_0073680 Ga0373937_0073680_880_2220 407
549 3300037853 Ga0436364_0512240 Ga0436364_0512240_650_1990 407
550 3300037853 Ga0436364_0756837 Ga0436364_0756837_292_1647 407
551 3300044693 Ga0466961_0019066 Ga0466961_0019066_330_1670 407
552 3300046459 Ga0495629_0000833 Ga0495629_0000833_20532_21872 407
553 3300046461 Ga0495641_0003291 Ga0495641_0003291_2138_3478 407
554 3300046462 Ga0495651_0011791 Ga0495651_0011791_2255_3595 407
555 3300046462 Ga0495651_0056889 Ga0495651_0056889_374_1714 407
556 3300046463 Ga0495653_0093678 Ga0495653_0093678_183_1523 407
557 3300046476 Ga0495662_0068676 Ga0495662_0068676_188_1528 407
558 3300046477 Ga0495664_0010569 Ga0495664_0010569_3607_4947 407
559 3300046511 Ga0495608_0030892 Ga0495608_0030892_2136_3476 407
560 3300046517 Ga0495630_0074696 Ga0495630_0074696_196_1536 407
561 3300046529 Ga0495652_0023765 Ga0495652_0023765_1824_3164 407
562 3300046531 Ga0495665_0013813 Ga0495665_0013813_2990_4330 407
563 3300046533 Ga0495640_0064571 Ga0495640_0064571_127_1467 407
564 3300046535 Ga0495586_0011264 Ga0495586_0011264_98_1438 407
565 3300046536 Ga0495587_0005840 Ga0495587_0005840_5434_6774 407
566 3300046543 Ga0495645_0013718 Ga0495645_0013718_3154_4494 407
567 3300046559 Ga0495667_0034225 Ga0495667_0034225_1763_3103 407
568 3300046642 Ga0495634_0027604 Ga0495634_0027604_1633_2973 407
569 3300046675 Ga0495657_0030415 Ga0495657_0030415_258_1598 407
570 3300046678 Ga0495599_0109598 Ga0495599_0109598_218_1558 407
571 3300046679 Ga0495623_0027189 Ga0495623_0027189_1018_2358 407
572 3300046679 Ga0495623_0058974 Ga0495623_0058974_324_1664 407
573 3300046683 Ga0495658_0049336 Ga0495658_0049336_996_2336 407
574 3300046689 Ga0495613_0021766 Ga0495613_0021766_458_1798 407
575 3300046690 Ga0495624_0005267 Ga0495624_0005267_1156_2496 407
576 3300046809 Ga0495600_0022120 Ga0495600_0022120_825_2165 407
577 3300047317 Ga0495604_0035748 Ga0495604_0035748_2348_3688 407
578 3300047317 Ga0495604_0121789 Ga0495604_0121789_137_1477 407
579 3300047319 Ga0495674_0066029 Ga0495674_0066029_825_2165 407
580 3300047322 Ga0495680_0057334 Ga0495680_0057334_848_2188 407
581 3300047444 Ga0495675_0019397 Ga0495675_0019397_654_1994 407
582 3300047444 Ga0495675_0042718 Ga0495675_0042718_530_1870 407
583 3300047673 Ga0495593_0003178 Ga0495593_0003178_7549_8889 407
584 3300048088 Ga0495602_0081418 Ga0495602_0081418_488_1828 407
585 3300048088 Ga0495602_0144926 Ga0495602_0144926_164_1504 407
586 3300048929 Ga0496126_0000022 Ga0496126_0000022_278460_279818 407
587 3300050512 nmdc:mga0n895_9045_c1 nmdc:mga0n895_9045_c1_3070_4410 407
588 3300050513 nmdc:mga0rr50_15487_c1 nmdc:mga0rr50_15487_c1_1254_2594 407
589 3300050514 nmdc:mga08x19_11432_c1 nmdc:mga08x19_11432_c1_3413_4753 407
590 3300053084 Ga0495595_0001189 Ga0495595_0001189_4131_5471 407
591 3300005364 Ga0070673_100152433 Ga0070673_1001524333 408
592 3300005435 Ga0070714_100077075 Ga0070714_1000770755 408
593 3300005437 Ga0070710_10011538 Ga0070710_100115382 408
594 3300005539 Ga0068853_100128392 Ga0068853_1001283923 408
595 3300006028 Ga0070717_10281038 Ga0070717_102810382 408
596 3300006173 Ga0070716_100003008 Ga0070716_1000030083 408
597 3300006175 Ga0070712_100052502 Ga0070712_1000525021 408
598 3300025906 Ga0207699_10015277 Ga0207699_100152775 408
599 3300025916 Ga0207663_10020146 Ga0207663_100201465 408
600 3300025929 Ga0207664_10111572 Ga0207664_101115722 408
601 3300025939 Ga0207665_10009065 Ga0207665_100090654 408
602 3300031728 Ga0316578_10006155 Ga0316578_100061554 408
603 3300035113 Ga0373936_0034728 Ga0373936_0034728_515_1861 408
604 3300035117 Ga0373953_0012605 Ga0373953_0012605_395_1741 408
605 3300035118 Ga0373954_0055206 Ga0373954_0055206_450_1796 408
606 3300035398 Ga0316574_0005082 Ga0316574_0005082_1292_2635 408
607 3300035692 Ga0373935_0009413 Ga0373935_0009413_4401_5747 408
608 3300036712 Ga0316584_0008056 Ga0316584_0008056_477_1820 408
609 3300046454 Ga0495592_0051894 Ga0495592_0051894_908_2254 408
610 3300046533 Ga0495640_0027891 Ga0495640_0027891_153_1499 408
611 3300046543 Ga0495645_0114808 Ga0495645_0114808_206_1552 408
612 3300046809 Ga0495600_0023132 Ga0495600_0023132_990_2336 408
613 3300047319 Ga0495674_0029704 Ga0495674_0029704_3398_4744 408
614 3300047444 Ga0495675_0096244 Ga0495675_0096244_175_1521 408
615 3300053078 Ga0495612_0042196 Ga0495612_0042196_218_1564 408
616 3300005337 Ga0070682_100001454 Ga0070682_1000014541 409
617 3300005338 Ga0068868_100024010 Ga0068868_1000240103 409
618 3300005344 Ga0070661_100137943 Ga0070661_1001379432 409
619 3300005366 Ga0070659_100117654 Ga0070659_1001176541 409
620 3300005563 Ga0068855_100008477 Ga0068855_1000084775 409
621 3300005563 Ga0068855_100075327 Ga0068855_1000753272 409
622 3300005578 Ga0068854_100056665 Ga0068854_1000566653 409
623 3300005840 Ga0068870_10000074 Ga0068870_100000748 409
624 3300005841 Ga0068863_100013453 Ga0068863_1000134533 409
625 3300006852 Ga0075433_10010746 Ga0075433_100107468 409
626 3300011119 Ga0105246_10000575 Ga0105246_100005756 409
627 3300013102 Ga0157371_10042577 Ga0157371_100425774 409
628 3300013104 Ga0157370_10032408 Ga0157370_100324083 409
629 3300025908 Ga0207643_10000037 Ga0207643_1000003751 409
630 3300025913 Ga0207695_10019091 Ga0207695_100190913 409
631 3300025920 Ga0207649_10008226 Ga0207649_100082262 409
632 3300025921 Ga0207652_10042138 Ga0207652_100421382 409
633 3300025944 Ga0207661_10001808 Ga0207661_1000180814 409
634 3300026116 Ga0207674_10133033 Ga0207674_101330333 409
635 3300031247 Ga0265340_10013376 Ga0265340_100133764 409
636 3300037466 Ga0395898_0048326 Ga0395898_0048326_1028_2389 409
637 3300048908 Ga0496105_0004921 Ga0496105_0004921_621_1964 409
638 3300002459 JGI24751J29686_10002661 JGI24751J29686_100026611 410
639 3300005327 Ga0070658_10135518 Ga0070658_101355181 410
640 3300005331 Ga0070670_100008036 Ga0070670_1000080362 410
641 3300005334 Ga0068869_100007210 Ga0068869_1000072105 410
642 3300005339 Ga0070660_100137197 Ga0070660_1001371971 410
643 3300005340 Ga0070689_100105407 Ga0070689_1001054073 410
644 3300005341 Ga0070691_10002921 Ga0070691_100029215 410
645 3300005345 Ga0070692_10004655 Ga0070692_100046551 410
646 3300005354 Ga0070675_100004377 Ga0070675_1000043773 410
647 3300005355 Ga0070671_100010749 Ga0070671_1000107497 410
648 3300005435 Ga0070714_100047262 Ga0070714_1000472624 410
649 3300005436 Ga0070713_100012448 Ga0070713_1000124484 410
650 3300005438 Ga0070701_10029795 Ga0070701_100297953 410
651 3300005457 Ga0070662_100086176 Ga0070662_1000861761 410
652 3300005466 Ga0070685_10007879 Ga0070685_100078794 410
653 3300005530 Ga0070679_100113334 Ga0070679_1001133344 410
654 3300005547 Ga0070693_100000804 Ga0070693_1000008046 410
655 3300005614 Ga0068856_100055156 Ga0068856_1000551562 410
656 3300005615 Ga0070702_100000979 Ga0070702_10000097913 410
657 3300005616 Ga0068852_100005693 Ga0068852_1000056938 410
658 3300005842 Ga0068858_100011258 Ga0068858_1000112583 410
659 3300006871 Ga0075434_100001385 Ga0075434_10000138517 410
660 3300007076 Ga0075435_100004313 Ga0075435_10000431312 410
661 3300009147 Ga0114129_10083012 Ga0114129_100830123 410
662 3300009148 Ga0105243_10086816 Ga0105243_100868163 410
663 3300009551 Ga0105238_10074381 Ga0105238_100743814 410
664 3300013308 Ga0157375_10134848 Ga0157375_101348483 410
665 3300025901 Ga0207688_10006817 Ga0207688_100068173 410
666 3300025907 Ga0207645_10015649 Ga0207645_100156492 410
667 3300025919 Ga0207657_10133220 Ga0207657_101332202 410
668 3300025925 Ga0207650_10000873 Ga0207650_1000087319 410
669 3300025926 Ga0207659_10020583 Ga0207659_100205831 410
670 3300025928 Ga0207700_10014331 Ga0207700_100143315 410
671 3300025929 Ga0207664_10047912 Ga0207664_100479122 410
672 3300025931 Ga0207644_10039647 Ga0207644_100396474 410
673 3300025933 Ga0207706_10024004 Ga0207706_100240045 410
674 3300025936 Ga0207670_10096894 Ga0207670_100968943 410
675 3300025940 Ga0207691_10133498 Ga0207691_101334983 410
676 3300025942 Ga0207689_10028353 Ga0207689_100283533 410
677 3300026035 Ga0207703_10025713 Ga0207703_100257134 410
678 3300026067 Ga0207678_10006590 Ga0207678_1000659012 410
679 3300026075 Ga0207708_10004711 Ga0207708_100047115 410
680 3300026078 Ga0207702_10002388 Ga0207702_100023887 410
681 3300026078 Ga0207702_10006916 Ga0207702_1000691610 410
682 3300027907 Ga0207428_10016826 Ga0207428_100168266 410
683 3300048903 Ga0496100_0052625 Ga0496100_0052625_98_1441 410
684 3300048910 Ga0496107_0022648 Ga0496107_0022648_2869_4212 410
685 3300048913 Ga0496110_0005067 Ga0496110_0005067_1248_2591 410
686 3300048914 Ga0496111_0000601 Ga0496111_0000601_13642_14985 410
687 3300050507 nmdc:mga05p37_57310_c1 nmdc:mga05p37_57310_c1_56_1399 410
688 3300050511 nmdc:mga08y16_15394_c1 nmdc:mga08y16_15394_c1_852_2195 410
689 3300050512 nmdc:mga0n895_154302_c1 nmdc:mga0n895_154302_c1_190_1533 410
690 3300050513 nmdc:mga0rr50_1354_c1 nmdc:mga0rr50_1354_c1_11213_12556 410
691 3300050514 nmdc:mga08x19_7000_c1 nmdc:mga08x19_7000_c1_4977_6320 410
692 3300050515 nmdc:mga0a205_27716_c1 nmdc:mga0a205_27716_c1_169_1512 410

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00289

Biotin_carb_N

Biotin carboxylase, N-terminal domain

1

105

0.99

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

110

319

0.99

PF02785

Biotin_carb_C

Biotin carboxylase C-terminal domain

332

438

0.98

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

117

289

0.82

PF08443

RimK

RimK-like ATP-grasp domain

108

312

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jzf-assembly1.cif.gz_A crystal structure of biotin carboxylase from e. coli in complex with benzimidazoles series 0.9783 1 409
3va7-assembly1.cif.gz_A crystal structure of the kluyveromyces lactis urea carboxylase 0.9745 2 406
3g8d-assembly1.cif.gz_A crystal structure of the biotin carboxylase subunit, e296a mutant, of acetyl-coa carboxylase from escherichia coli 0.9718 1 408
3n6r-assembly1.cif.gz_E crystal structure of the holoenzyme of propionyl-coa carboxylase (pcc) 0.9709 2 408
5mlk-assembly1.cif.gz_B biotin dependent carboxylase acca3 dimer from mycobacterium tuberculosis (rv3285) 0.9702 2 402
ID Description Score Start End Superfamily
af_A0A2R8PV58_38_157_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9933 14 130 3.40.50.20
2vqdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9799 1 84 3.40.50.20
af_A0A1D6J3D9_373_520_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9786 167 284 3.30.470.20
3n6rA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9735 2 130 3.40.50.20
af_A0A1D8PDC6_817_1059_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9698 168 406 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A323V7T1-F1-model_v4 biotin carboxylase (EC 6.3.4.14) 1.006 2 78 GO:0005524
GO:0016874
AF-A0A3M1P1Z5-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) 1 2 74 GO:0003989
GO:0005524
AF-A0A2M8PKW1-F1-model_v4 3-methylcrotonyl-CoA carboxylase 0.9989 1 105 GO:0005524
GO:0016874
AF-A0A3C1KWC0-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) 0.9983 3 84 GO:0003989
GO:0005524
AF-A0A2V8M7X3-F1-model_v4 Acetyl-CoA carboxylase biotin carboxylase subunit (EC 6.4.1.2) 0.9982 1 110 GO:0003989
GO:0005524

Feature Viewer

pLDDT pTM Quality
93.76 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map