F475452

General Info

Members Datasets Scaffolds Average Seq Length
690 339 677 296

Family's Representative Sequence

Representative Sequence 3300025900|Ga0207710_10043600|Ga0207710_100436001
Length 343
Sequence MQRRSAPMPGMLYHLIGDFPGKRVVAASLRDGARRCPWQWHKEGIVTEGIVTQTSDRELIAGAANPLGMDGIEFVEFSTSKPQALGQVLEMIGFHPIARHRSREVLLYRQGDMNVIVNAHAGGQARASPPSEIPTIAAFALRVRDAATAYRHAIDRGAWIVPSQVEVMELNIPAIHGVGASRIYFVDRYRDFSIYDVDFTLNPGVDAHPPALADMHWFGLVQYIGSDRMEDWTEFYETLFGFTALPDEQRYGILPKGRILLGPCGGFHLQLIDPKPGIFDIEPQESLQRIGFGTPDVLSAVRTLRQRGIGFVESQDVHSEARGALTQPYLGGVMFELVHDERR

Samples

Sample ID Description Type Environment
1 2547132374 Acidovorax radicis N35 Isolate Unclassified
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2643221570 Acidovorax sp. Root568 Isolate Unclassified
5 2643221596 Acidovorax sp. Root70 Isolate Unclassified
6 2643221609 Acidovorax sp. Root217 Isolate Unclassified
7 2643221611 Acidovorax sp. Root219 Isolate Unclassified
8 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
9 2643221652 Acidovorax sp. Root402 Isolate Unclassified
10 2643221717 Acidovorax sp. Root267 Isolate Unclassified
11 2738543012 Acidovorax sp. CF301 Isolate Unclassified
12 2816332133 Acidovorax radicis 2721A Isolate Unclassified
13 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
93 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
98 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
99 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
100 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
203 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
224 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
238 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
239 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
240 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
253 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
257 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
258 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
259 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
260 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
261 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
262 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
263 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
268 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
269 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
270 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
271 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
272 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
277 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
284 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
290 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
307 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
308 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
324 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
325 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
326 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
330 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
331 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
332 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
333 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
334 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
337 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
338 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.28
Nodule 0.29
Rhizoplane 2.75
Rhizosphere 79.42
Stem 0
Stem Tuber 0
Unclassified 8.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10004275 3300003215 Bacteria 7724
2 rootH1_10007111 3300003316 Bacteria 6114
3 rootL2_10005678 3300003322 Bacteria 4807
4 rootL2_10103817 3300003322 Bacteria 4747
5 Ga0055524_1000079 3300003775 Bacteria 120203
6 Ga0055530_10005160 3300003791 Bacteria 6366
7 Ga0055540_1000004 3300003792 Bacteria 395545
8 Ga0055531_10014357 3300003794 Bacteria 3570
9 Ga0065707_10087932 3300005295 Bacteria 4840
10 Ga0070676_10002095 3300005328 Bacteria 10149
11 Ga0070676_10012793 3300005328 Bacteria 4591
12 Ga0070683_100239441 3300005329 Bacteria 1726
13 Ga0070690_100000663 3300005330 Bacteria 17521
14 Ga0070670_100008053 3300005331 Bacteria 8967
15 Ga0070670_100017699 3300005331 Bacteria 6113
16 Ga0070670_100029077 3300005331 Bacteria 4755
17 Ga0070670_100080848 3300005331 Bacteria 2793
18 Ga0070677_10013640 3300005333 Bacteria 2847
19 Ga0068869_100000481 3300005334 Bacteria 22080
20 Ga0068869_100075037 3300005334 Bacteria 2512
21 Ga0068869_100125862 3300005334 Bacteria 1965
22 Ga0068869_100230042 3300005334 Bacteria 1473
23 Ga0068869_100316416 3300005334 Bacteria 1265
24 Ga0070666_10000745 3300005335 Bacteria 19736
25 Ga0070680_100049561 3300005336 Bacteria 3424
26 Ga0070680_100332264 3300005336 Bacteria 1291
27 Ga0068868_100000971 3300005338 Bacteria 19511
28 Ga0068868_100065210 3300005338 Bacteria 2893
29 Ga0068868_100179767 3300005338 Bacteria 1754
30 Ga0068868_100200106 3300005338 Unclassified 1665
31 Ga0068868_100318724 3300005338 Bacteria 1324
32 Ga0068868_100411250 3300005338 Bacteria 1169
33 Ga0070660_100025436 3300005339 Bacteria 4400
34 Ga0070660_100083033 3300005339 Bacteria 2516
35 Ga0070660_100455486 3300005339 Bacteria 1062
36 Ga0070689_100002088 3300005340 Bacteria 12972
37 Ga0070689_100019245 3300005340 Bacteria 5046
38 Ga0070689_100228338 3300005340 Bacteria 1529
39 Ga0070661_100007008 3300005344 Bacteria 7775
40 Ga0070661_100057524 3300005344 Bacteria 2849
41 Ga0070692_10019480 3300005345 Bacteria 3275
42 Ga0070668_100033478 3300005347 Bacteria 3914
43 Ga0070668_100049482 3300005347 Bacteria 3233
44 Ga0070668_100062380 3300005347 Bacteria 2888
45 Ga0070668_100417237 3300005347 Bacteria 1149
46 Ga0070669_100004947 3300005353 Bacteria 9626
47 Ga0070669_100053187 3300005353 Bacteria 2964
48 Ga0070669_100063154 3300005353 Bacteria 2725
49 Ga0070669_100122721 3300005353 Bacteria 1984
50 Ga0070669_100345896 3300005353 Bacteria 1206
51 Ga0070669_100417334 3300005353 Bacteria 1101
52 Ga0070675_100030891 3300005354 Bacteria 4327
53 Ga0070675_100033406 3300005354 Bacteria 4171
54 Ga0070675_100092616 3300005354 Bacteria 2534
55 Ga0070671_100001053 3300005355 Bacteria 20340
56 Ga0070671_100002310 3300005355 Bacteria 14715
57 Ga0070671_100007296 3300005355 Bacteria 8829
58 Ga0070671_100196745 3300005355 Bacteria 1709
59 Ga0070671_100541423 3300005355 Bacteria 1003
60 Ga0070674_100057087 3300005356 Bacteria 2709
61 Ga0070674_100099699 3300005356 Bacteria 2114
62 Ga0070673_100007976 3300005364 Bacteria 7016
63 Ga0070673_100026546 3300005364 Bacteria 4279
64 Ga0070673_100073518 3300005364 Bacteria 2752
65 Ga0070673_100211783 3300005364 Bacteria 1674
66 Ga0070688_100002954 3300005365 Bacteria 8666
67 Ga0070688_100267709 3300005365 Bacteria 1223
68 Ga0070659_100003296 3300005366 Bacteria 11497
69 Ga0070659_100086147 3300005366 Bacteria 2513
70 Ga0070659_100090741 3300005366 Bacteria 2449
71 Ga0070667_100001469 3300005367 Bacteria 21118
72 Ga0070667_100004231 3300005367 Bacteria 12120
73 Ga0070667_100020817 3300005367 Bacteria 5448
74 Ga0070667_100074494 3300005367 Bacteria 2896
75 Ga0070667_100282042 3300005367 Bacteria 1492
76 Ga0070709_10077929 3300005434 Bacteria 2155
77 Ga0070714_100052026 3300005435 Bacteria 3493
78 Ga0070713_100003384 3300005436 Bacteria 10534
79 Ga0070713_100216577 3300005436 Bacteria 1736
80 Ga0070701_10007050 3300005438 Bacteria 4771
81 Ga0070711_100004626 3300005439 Bacteria 8146
82 Ga0070705_100004377 3300005440 Bacteria 6877
83 Ga0070705_100114283 3300005440 Unclassified 1731
84 Ga0070700_100060479 3300005441 Bacteria 2388
85 Ga0070694_100025464 3300005444 Bacteria 3827
86 Ga0070708_100000792 3300005445 Bacteria 23848
87 Ga0070708_100031577 3300005445 Bacteria 4585
88 Ga0070708_100309855 3300005445 Bacteria 1487
89 Ga0070663_100021054 3300005455 Bacteria 4330
90 Ga0070678_100249031 3300005456 Bacteria 1489
91 Ga0070662_100001177 3300005457 Bacteria 16048
92 Ga0070662_100060606 3300005457 Bacteria 2760
93 Ga0070681_10076070 3300005458 Bacteria 3316
94 Ga0070681_10193585 3300005458 Bacteria 1953
95 Ga0068867_100000114 3300005459 Bacteria 51011
96 Ga0068867_100003168 3300005459 Bacteria 11602
97 Ga0068867_100007271 3300005459 Bacteria 7832
98 Ga0068867_100121786 3300005459 Bacteria 2017
99 Ga0068867_100213831 3300005459 Bacteria 1550
100 Ga0070685_10011495 3300005466 Bacteria 4634
101 Ga0070706_100003222 3300005467 Bacteria 16122
102 Ga0070707_100184969 3300005468 Bacteria 2031
103 Ga0070698_100448861 3300005471 Bacteria 1225
104 Ga0070699_100258697 3300005518 Bacteria 1556
105 Ga0070679_100037311 3300005530 Bacteria 4826
106 Ga0070684_100169006 3300005535 Bacteria 1986
107 Ga0070697_100149793 3300005536 Bacteria 1966
108 Ga0068853_100002005 3300005539 Bacteria 15041
109 Ga0068853_100011875 3300005539 Bacteria 7082
110 Ga0068853_100251738 3300005539 Bacteria 1621
111 Ga0068853_100286500 3300005539 Bacteria 1519
112 Ga0070672_100083034 3300005543 Bacteria 2571
113 Ga0070672_100091803 3300005543 Bacteria 2450
114 Ga0070672_100094808 3300005543 Bacteria 2413
115 Ga0070672_100121904 3300005543 Bacteria 2135
116 Ga0070672_100190163 3300005543 Bacteria 1713
117 Ga0070672_100199499 3300005543 Bacteria 1673
118 Ga0070686_100087863 3300005544 Bacteria 2073
119 Ga0070696_100069276 3300005546 Bacteria 2478
120 Ga0070693_100016671 3300005547 Bacteria 3806
121 Ga0070693_100098940 3300005547 Bacteria 1773
122 Ga0070693_100208420 3300005547 Bacteria 1274
123 Ga0070665_100001402 3300005548 Bacteria 28337
124 Ga0070665_100007136 3300005548 Bacteria 11361
125 Ga0070665_100158672 3300005548 Bacteria 2263
126 Ga0070665_100499930 3300005548 Bacteria 1227
127 Ga0070704_100278957 3300005549 Bacteria 1384
128 Ga0068855_100003898 3300005563 Bacteria 18217
129 Ga0068855_100118801 3300005563 Bacteria 3027
130 Ga0068855_100129567 3300005563 Bacteria 2882
131 Ga0068855_100154798 3300005563 Bacteria 2605
132 Ga0070664_100023803 3300005564 Bacteria 5059
133 Ga0070664_100184031 3300005564 Bacteria 1858
134 Ga0068857_100007102 3300005577 Bacteria 9645
135 Ga0068857_100026898 3300005577 Bacteria 5072
136 Ga0068857_100283073 3300005577 Bacteria 1525
137 Ga0068857_100451502 3300005577 Bacteria 1202
138 Ga0068854_100047229 3300005578 Bacteria 3068
139 Ga0068854_100095261 3300005578 Bacteria 2222
140 Ga0068854_100161072 3300005578 Bacteria 1738
141 Ga0068854_100163922 3300005578 Bacteria 1724
142 Ga0068856_100001796 3300005614 Bacteria 22411
143 Ga0068856_100171183 3300005614 Bacteria 2184
144 Ga0070702_100010808 3300005615 Bacteria 4514
145 Ga0070702_100109450 3300005615 Bacteria 1710
146 Ga0070702_100262853 3300005615 Bacteria 1176
147 Ga0068852_100110416 3300005616 Bacteria 2499
148 Ga0068852_100212494 3300005616 Bacteria 1836
149 Ga0068859_100000893 3300005617 Bacteria 30367
150 Ga0068859_100001169 3300005617 Bacteria 26837
151 Ga0068859_100115911 3300005617 Bacteria 2744
152 Ga0068859_100340151 3300005617 Bacteria 1595
153 Ga0068859_100430372 3300005617 Bacteria 1416
154 Ga0068864_100001446 3300005618 Bacteria 19579
155 Ga0068864_100002752 3300005618 Bacteria 14500
156 Ga0068864_100009929 3300005618 Bacteria 7852
157 Ga0068866_10022409 3300005718 Bacteria 2923
158 Ga0068866_10058754 3300005718 Bacteria 1987
159 Ga0068866_10170551 3300005718 Bacteria 1277
160 Ga0068861_100001611 3300005719 Bacteria 14383
161 Ga0068861_100002388 3300005719 Bacteria 12231
162 Ga0068861_100133512 3300005719 Bacteria 2017
163 Ga0068861_100225580 3300005719 Bacteria 1586
164 Ga0068861_100272877 3300005719 Bacteria 1453
165 Ga0068870_10022611 3300005840 Bacteria 3091
166 Ga0068870_10071014 3300005840 Bacteria 1899
167 Ga0068863_100000521 3300005841 Bacteria 39214
168 Ga0068863_100003595 3300005841 Bacteria 15301
169 Ga0068863_100027188 3300005841 Bacteria 5456
170 Ga0068863_100110964 3300005841 Bacteria 2612
171 Ga0068863_100158509 3300005841 Bacteria 2167
172 Ga0068858_100003010 3300005842 Bacteria 16901
173 Ga0068858_100012873 3300005842 Bacteria 7889
174 Ga0068858_100275380 3300005842 Bacteria 1602
175 Ga0068860_100001084 3300005843 Bacteria 30014
176 Ga0068860_100003063 3300005843 Bacteria 17272
177 Ga0068860_100005415 3300005843 Bacteria 12950
178 Ga0068860_100198079 3300005843 Bacteria 1946
179 Ga0068860_100281001 3300005843 Bacteria 1627
180 Ga0068860_100443456 3300005843 Bacteria 1290
181 Ga0068862_100013035 3300005844 Bacteria 6877
182 Ga0068862_100025057 3300005844 Bacteria 5007
183 Ga0075365_10041051 3300006038 Bacteria 3020
184 Ga0075368_10018558 3300006042 Bacteria 2615
185 Ga0075368_10112944 3300006042 Bacteria 1121
186 Ga0075364_10243040 3300006051 Bacteria 1223
187 Ga0070716_100005733 3300006173 Bacteria 6032
188 Ga0070712_100014560 3300006175 Bacteria 5048
189 Ga0075367_10025491 3300006178 Bacteria 3345
190 Ga0075367_10033023 3300006178 Bacteria 2981
191 Ga0075367_10044392 3300006178 Bacteria 2605
192 Ga0075366_10000810 3300006195 Bacteria 14996
193 Ga0075366_10002594 3300006195 Bacteria 9288
194 Ga0075366_10011317 3300006195 Bacteria 5035
195 Ga0075366_10016722 3300006195 Bacteria 4217
196 Ga0075366_10029487 3300006195 Bacteria 3223
197 Ga0075366_10037164 3300006195 Bacteria 2873
198 Ga0075366_10041574 3300006195 Bacteria 2722
199 Ga0097621_100014273 3300006237 Bacteria 5941
200 Ga0097621_100345009 3300006237 Bacteria 1323
201 Ga0075370_10001742 3300006353 Bacteria 9690
202 Ga0075370_10002345 3300006353 Bacteria 8754
203 Ga0075370_10079598 3300006353 Bacteria 1882
204 Ga0075370_10147441 3300006353 Bacteria 1378
205 Ga0075370_10207202 3300006353 Bacteria 1157
206 Ga0068871_100017564 3300006358 Bacteria 5417
207 Ga0075428_100012423 3300006844 Bacteria 9472
208 Ga0075428_100548448 3300006844 Bacteria 1236
209 Ga0075430_100087012 3300006846 Bacteria 2615
210 Ga0075434_100757284 3300006871 Unclassified 988
211 Ga0068865_100003419 3300006881 Bacteria 9497
212 Ga0075436_100030838 3300006914 Bacteria 3690
213 Ga0097620_100000893 3300006931 Bacteria 30367
214 Ga0097620_100001169 3300006931 Bacteria 26837
215 Ga0097620_100115908 3300006931 Bacteria 2744
216 Ga0097620_100340139 3300006931 Bacteria 1595
217 Ga0097620_100430429 3300006931 Bacteria 1416
218 Ga0079104_1000352 3300006946 Bacteria 55479
219 Ga0105240_10027731 3300009093 Bacteria 7412
220 Ga0105240_10030931 3300009093 Bacteria 6952
221 Ga0105240_10038834 3300009093 Bacteria 6103
222 Ga0111539_10021763 3300009094 Bacteria 7883
223 Ga0111539_10092046 3300009094 Bacteria 3563
224 Ga0111539_10154655 3300009094 Bacteria 2684
225 Ga0105245_10001644 3300009098 Bacteria 20337
226 Ga0105245_10007857 3300009098 Bacteria 9331
227 Ga0105245_10057243 3300009098 Bacteria 3506
228 Ga0105245_10073690 3300009098 Bacteria 3105
229 Ga0105247_10064396 3300009101 Bacteria 2277
230 Ga0105247_10200821 3300009101 Bacteria 1340
231 Ga0114129_10321911 3300009147 Bacteria 2055
232 Ga0114129_10697670 3300009147 Bacteria 1305
233 Ga0105243_10014110 3300009148 Bacteria 6044
234 Ga0105243_10347556 3300009148 Bacteria 1361
235 Ga0105241_10067553 3300009174 Bacteria 2767
236 Ga0105241_10154351 3300009174 Bacteria 1881
237 Ga0105248_10008045 3300009177 Bacteria 11575
238 Ga0105248_10013123 3300009177 Bacteria 9124
239 Ga0105248_10035492 3300009177 Bacteria 5577
240 Ga0105237_10000076 3300009545 Bacteria 131773
241 Ga0105237_10016342 3300009545 Bacteria 7713
242 Ga0105237_10044581 3300009545 Bacteria 4466
243 Ga0105238_10007384 3300009551 Bacteria 11012
244 Ga0105249_10109533 3300009553 Bacteria 2609
245 Ga0105239_10008182 3300010375 Bacteria 11927
246 Ga0105239_10126723 3300010375 Bacteria 2838
247 Ga0105239_10817732 3300010375 Bacteria 1068
248 Ga0105246_10029964 3300011119 Bacteria 3589
249 Ga0157373_10006303 3300013100 Bacteria 8864
250 Ga0157371_10000194 3300013102 Bacteria 90011
251 Ga0157370_10013405 3300013104 Bacteria 8445
252 Ga0157369_10303625 3300013105 Bacteria 1660
253 Ga0157374_10002838 3300013296 Bacteria 14535
254 Ga0157378_10001679 3300013297 Bacteria 19946
255 Ga0157378_10005473 3300013297 Bacteria 11126
256 Ga0157378_10094210 3300013297 Bacteria 2727
257 Ga0157378_10505201 3300013297 Bacteria 1208
258 Ga0163162_10001712 3300013306 Bacteria 20568
259 Ga0163162_10001908 3300013306 Bacteria 19644
260 Ga0163162_10118849 3300013306 Bacteria 2745
261 Ga0157372_10005627 3300013307 Bacteria 13324
262 Ga0157375_10019566 3300013308 Bacteria 6162
263 Ga0157375_10025955 3300013308 Bacteria 5454
264 Ga0157375_10031086 3300013308 Bacteria 5041
265 Ga0157375_10161320 3300013308 Bacteria 2384
266 Ga0157375_10228948 3300013308 Bacteria 2018
267 Ga0157375_10298682 3300013308 Bacteria 1774
268 Ga0157375_10400246 3300013308 Bacteria 1540
269 Ga0163163_10009939 3300014325 Bacteria 8532
270 Ga0163163_10311104 3300014325 Bacteria 1628
271 Ga0157380_10000875 3300014326 Bacteria 18931
272 Ga0157380_10071614 3300014326 Bacteria 2805
273 Ga0157380_10076760 3300014326 Bacteria 2720
274 Ga0157380_10427889 3300014326 Bacteria 1264
275 Ga0157377_10000016 3300014745 Bacteria 190613
276 Ga0157377_10104944 3300014745 Bacteria 1690
277 Ga0157377_10311090 3300014745 Bacteria 1043
278 Ga0157379_10001362 3300014968 Bacteria 20016
279 Ga0157379_10002571 3300014968 Bacteria 15232
280 Ga0157379_10025337 3300014968 Bacteria 5269
281 Ga0157379_10066080 3300014968 Bacteria 3233
282 Ga0157379_10102095 3300014968 Bacteria 2574
283 Ga0157376_10001750 3300014969 Bacteria 14458
284 Ga0157376_10033776 3300014969 Bacteria 4123
285 Ga0157376_10707566 3300014969 Bacteria 1013
286 Ga0163161_10020125 3300017792 Bacteria 4680
287 Ga0209676_1043215 3300025292 Bacteria 1245
288 Ga0209758_1000122 3300025297 Bacteria 190970
289 Ga0209050_1000677 3300025298 Bacteria 51357
290 Ga0209050_1028295 3300025298 Bacteria 1822
291 Ga0209256_1000011 3300025299 Bacteria 865309
292 Ga0209051_1000016 3300025303 Bacteria 541891
293 Ga0209257_1000102 3300025304 Bacteria 251074
294 Ga0207656_10133863 3300025321 Bacteria 1163
295 Ga0207682_10016029 3300025893 Bacteria 2920
296 Ga0207642_10089583 3300025899 Bacteria 1516
297 Ga0207710_10043600 3300025900 Bacteria 1996
298 Ga0207710_10074938 3300025900 Bacteria 1559
299 Ga0207688_10138650 3300025901 Bacteria 1430
300 Ga0207688_10261430 3300025901 Bacteria 1050
301 Ga0207680_10000783 3300025903 Bacteria 15039
302 Ga0207680_10039758 3300025903 Bacteria 2732
303 Ga0207680_10301950 3300025903 Bacteria 1116
304 Ga0207685_10170595 3300025905 Unclassified 1001
305 Ga0207699_10078508 3300025906 Bacteria 2039
306 Ga0207699_10361416 3300025906 Unclassified 1027
307 Ga0207645_10001729 3300025907 Bacteria 17698
308 Ga0207645_10045451 3300025907 Bacteria 2806
309 Ga0207645_10046267 3300025907 Bacteria 2779
310 Ga0207643_10018090 3300025908 Bacteria 3861
311 Ga0207643_10032638 3300025908 Bacteria 2909
312 Ga0207643_10079987 3300025908 Bacteria 1893
313 Ga0207684_10002424 3300025910 Bacteria 18808
314 Ga0207654_10137587 3300025911 Bacteria 1553
315 Ga0207707_10069217 3300025912 Bacteria 3076
316 Ga0207707_10427262 3300025912 Bacteria 1135
317 Ga0207695_10021153 3300025913 Bacteria 7431
318 Ga0207695_10029322 3300025913 Bacteria 6083
319 Ga0207695_10107478 3300025913 Bacteria 2775
320 Ga0207671_10005377 3300025914 Bacteria 11831
321 Ga0207671_10014637 3300025914 Bacteria 6189
322 Ga0207693_10001071 3300025915 Bacteria 24521
323 Ga0207663_10246971 3300025916 Bacteria 1312
324 Ga0207663_10280088 3300025916 Bacteria 1238
325 Ga0207660_10060768 3300025917 Bacteria 2718
326 Ga0207662_10032204 3300025918 Bacteria 3050
327 Ga0207662_10051405 3300025918 Bacteria 2452
328 Ga0207657_10003940 3300025919 Bacteria 15763
329 Ga0207657_10022507 3300025919 Bacteria 5894
330 Ga0207657_10041190 3300025919 Bacteria 4085
331 Ga0207649_10001247 3300025920 Bacteria 15210
332 Ga0207649_10057355 3300025920 Bacteria 2435
333 Ga0207652_10145470 3300025921 Bacteria 2121
334 Ga0207646_10047710 3300025922 Bacteria 3841
335 Ga0207681_10008779 3300025923 Bacteria 6175
336 Ga0207694_10011637 3300025924 Bacteria 6639
337 Ga0207650_10008631 3300025925 Bacteria 6958
338 Ga0207650_10011427 3300025925 Bacteria 6112
339 Ga0207650_10024159 3300025925 Bacteria 4318
340 Ga0207650_10038924 3300025925 Bacteria 3475
341 Ga0207650_10043358 3300025925 Bacteria 3302
342 Ga0207659_10008305 3300025926 Bacteria 6438
343 Ga0207687_10000226 3300025927 Bacteria 38452
344 Ga0207687_10003096 3300025927 Bacteria 11280
345 Ga0207687_10020926 3300025927 Bacteria 4342
346 Ga0207687_10042968 3300025927 Bacteria 3113
347 Ga0207687_10443291 3300025927 Bacteria 1076
348 Ga0207700_10029862 3300025928 Bacteria 3852
349 Ga0207700_10044625 3300025928 Bacteria 3265
350 Ga0207664_10009233 3300025929 Bacteria 6910
351 Ga0207644_10001985 3300025931 Bacteria 13227
352 Ga0207644_10007852 3300025931 Bacteria 6970
353 Ga0207644_10044136 3300025931 Bacteria 3166
354 Ga0207644_10058835 3300025931 Bacteria 2778
355 Ga0207644_10063586 3300025931 Bacteria 2680
356 Ga0207690_10006609 3300025932 Bacteria 6868
357 Ga0207690_10066524 3300025932 Bacteria 2468
358 Ga0207706_10000002 3300025933 Bacteria 360309
359 Ga0207706_10001944 3300025933 Bacteria 20292
360 Ga0207706_10046447 3300025933 Bacteria 3844
361 Ga0207706_10093004 3300025933 Bacteria 2652
362 Ga0207706_10109511 3300025933 Bacteria 2431
363 Ga0207686_10003018 3300025934 Bacteria 9072
364 Ga0207709_10052527 3300025935 Bacteria 2504
365 Ga0207709_10114981 3300025935 Bacteria 1806
366 Ga0207670_10031264 3300025936 Bacteria 3409
367 Ga0207670_10035858 3300025936 Bacteria 3221
368 Ga0207670_10250291 3300025936 Bacteria 1369
369 Ga0207669_10121511 3300025937 Bacteria 1774
370 Ga0207669_10279444 3300025937 Bacteria 1258
371 Ga0207669_10292471 3300025937 Bacteria 1234
372 Ga0207704_10002798 3300025938 Bacteria 7868
373 Ga0207665_10060503 3300025939 Bacteria 2565
374 Ga0207691_10003696 3300025940 Bacteria 14837
375 Ga0207691_10029845 3300025940 Bacteria 5099
376 Ga0207691_10062634 3300025940 Bacteria 3374
377 Ga0207691_10074024 3300025940 Bacteria 3072
378 Ga0207691_10075440 3300025940 Bacteria 3040
379 Ga0207691_10124161 3300025940 Bacteria 2285
380 Ga0207691_10310597 3300025940 Bacteria 1353
381 Ga0207711_10000654 3300025941 Bacteria 34558
382 Ga0207711_10008005 3300025941 Bacteria 8841
383 Ga0207711_10019605 3300025941 Bacteria 5630
384 Ga0207689_10001081 3300025942 Bacteria 26272
385 Ga0207689_10026863 3300025942 Bacteria 4819
386 Ga0207689_10037463 3300025942 Bacteria 4022
387 Ga0207661_10072017 3300025944 Bacteria 2827
388 Ga0207679_10000404 3300025945 Bacteria 30976
389 Ga0207679_10005738 3300025945 Bacteria 7790
390 Ga0207679_10121147 3300025945 Bacteria 2083
391 Ga0207667_10002797 3300025949 Bacteria 21604
392 Ga0207667_10165607 3300025949 Bacteria 2273
393 Ga0207651_10001587 3300025960 Bacteria 10408
394 Ga0207651_10007695 3300025960 Bacteria 5757
395 Ga0207651_10035662 3300025960 Bacteria 3238
396 Ga0207651_10052487 3300025960 Bacteria 2780
397 Ga0207651_10117798 3300025960 Bacteria 2007
398 Ga0207712_10018508 3300025961 Bacteria 4539
399 Ga0207668_10002950 3300025972 Bacteria 9968
400 Ga0207668_10034452 3300025972 Bacteria 3363
401 Ga0207640_10044617 3300025981 Bacteria 2842
402 Ga0207640_10056692 3300025981 Bacteria 2574
403 Ga0207640_10103978 3300025981 Bacteria 1998
404 Ga0207640_10478336 3300025981 Bacteria 1032
405 Ga0207658_10006949 3300025986 Bacteria 7704
406 Ga0207658_10022771 3300025986 Bacteria 4364
407 Ga0207658_10058879 3300025986 Bacteria 2861
408 Ga0207658_10079113 3300025986 Bacteria 2514
409 Ga0207677_10000162 3300026023 Bacteria 53309
410 Ga0207677_10020074 3300026023 Bacteria 4049
411 Ga0207677_10120407 3300026023 Bacteria 1973
412 Ga0207677_10197178 3300026023 Bacteria 1597
413 Ga0207677_10560265 3300026023 Bacteria 997
414 Ga0207703_10001919 3300026035 Bacteria 18425
415 Ga0207703_10006661 3300026035 Bacteria 9215
416 Ga0207703_10217221 3300026035 Bacteria 1708
417 Ga0207703_10262531 3300026035 Bacteria 1561
418 Ga0207639_10181280 3300026041 Bacteria 1792
419 Ga0207678_10032495 3300026067 Bacteria 4548
420 Ga0207678_10167518 3300026067 Bacteria 1876
421 Ga0207708_10036611 3300026075 Bacteria 3737
422 Ga0207702_10006364 3300026078 Bacteria 10193
423 Ga0207702_10270514 3300026078 Bacteria 1602
424 Ga0207641_10001702 3300026088 Bacteria 21403
425 Ga0207641_10014054 3300026088 Bacteria 6563
426 Ga0207641_10045270 3300026088 Bacteria 3705
427 Ga0207641_10225869 3300026088 Bacteria 1738
428 Ga0207648_10000343 3300026089 Bacteria 51081
429 Ga0207648_10002633 3300026089 Bacteria 19203
430 Ga0207648_10003584 3300026089 Bacteria 16250
431 Ga0207648_10008152 3300026089 Bacteria 10184
432 Ga0207648_10035446 3300026089 Bacteria 4396
433 Ga0207648_10050801 3300026089 Bacteria 3625
434 Ga0207648_10220136 3300026089 Bacteria 1687
435 Ga0207676_10000451 3300026095 Bacteria 34663
436 Ga0207676_10003663 3300026095 Bacteria 10865
437 Ga0207676_10182574 3300026095 Bacteria 1838
438 Ga0207676_10391478 3300026095 Bacteria 1296
439 Ga0207676_10647995 3300026095 Bacteria 1019
440 Ga0207674_10003102 3300026116 Bacteria 20519
441 Ga0207674_10018325 3300026116 Bacteria 7612
442 Ga0207674_10019808 3300026116 Bacteria 7281
443 Ga0207674_10026307 3300026116 Bacteria 6184
444 Ga0207674_10131513 3300026116 Bacteria 2465
445 Ga0207674_10154073 3300026116 Bacteria 2254
446 Ga0207675_100003236 3300026118 Bacteria 15974
447 Ga0207675_100013521 3300026118 Bacteria 7617
448 Ga0207675_100024008 3300026118 Bacteria 5668
449 Ga0207675_100080982 3300026118 Bacteria 3044
450 Ga0207675_100207949 3300026118 Bacteria 1881
451 Ga0207683_10085353 3300026121 Bacteria 2806
452 Ga0207683_10172285 3300026121 Bacteria 1960
453 Ga0209281_1000454 3300027111 Bacteria 58234
454 Ga0209982_1019615 3300027552 Bacteria 1037
455 Ga0209970_1001012 3300027614 Bacteria 4991
456 Ga0210002_1011274 3300027617 Bacteria 1381
457 Ga0209983_1002922 3300027665 Bacteria 3693
458 Ga0209971_1028964 3300027682 Bacteria 1325
459 Ga0209966_1004389 3300027695 Bacteria 2389
460 Ga0209813_10005461 3300027866 Bacteria 3086
461 Ga0209974_10006322 3300027876 Bacteria 4141
462 Ga0209974_10007375 3300027876 Bacteria 3790
463 Ga0207428_10251550 3300027907 Bacteria 1318
464 Ga0268266_10147323 3300028379 Bacteria 2118
465 Ga0268266_10210787 3300028379 Bacteria 1781
466 Ga0268265_10003999 3300028380 Bacteria 10378
467 Ga0268265_10006699 3300028380 Bacteria 7798
468 Ga0268265_10074241 3300028380 Bacteria 2659
469 Ga0268265_10310188 3300028380 Bacteria 1424
470 Ga0268264_10001000 3300028381 Bacteria 28759
471 Ga0268264_10002760 3300028381 Bacteria 15322
472 Ga0268264_10049555 3300028381 Bacteria 3494
473 Ga0268264_10089344 3300028381 Bacteria 2653
474 Ga0307517_10000358 3300028786 Bacteria 78437
475 Ga0307515_10000417 3300028794 Bacteria 102343
476 Ga0307515_10000459 3300028794 Bacteria 97482
477 Ga0307515_10003649 3300028794 Bacteria 32350
478 Ga0307515_10003668 3300028794 Bacteria 32257
479 Ga0307515_10009465 3300028794 Bacteria 18830
480 Ga0307515_10010929 3300028794 Bacteria 17310
481 Ga0307515_10025898 3300028794 Bacteria 10121
482 Ga0307515_10091248 3300028794 Bacteria 3809
483 Ga0307512_10031625 3300030522 Bacteria 4578
484 Ga0307512_10055700 3300030522 Bacteria 3115
485 Ga0265332_10010522 3300031238 Bacteria 4119
486 Ga0265316_10000632 3300031344 Bacteria 39227
487 Ga0307513_10000006 3300031456 Bacteria 470848
488 Ga0307513_10002513 3300031456 Bacteria 25362
489 Ga0307513_10005054 3300031456 Bacteria 17463
490 Ga0307513_10009552 3300031456 Bacteria 12262
491 Ga0307513_10025822 3300031456 Bacteria 6793
492 Ga0307513_10076015 3300031456 Bacteria 3485
493 Ga0307513_10183534 3300031456 Bacteria 1952
494 Ga0307513_10190247 3300031456 Bacteria 1905
495 Ga0307509_10001694 3300031507 Bacteria 36817
496 Ga0307509_10005213 3300031507 Bacteria 18216
497 Ga0307509_10017599 3300031507 Bacteria 8218
498 Ga0307509_10052291 3300031507 Bacteria 4361
499 Ga0307509_10096881 3300031507 Bacteria 3000
500 Ga0307408_100000008 3300031548 Bacteria 456355
501 Ga0307408_100000072 3300031548 Bacteria 115918
502 Ga0307408_100050732 3300031548 Bacteria 2985
503 Ga0307408_100057624 3300031548 Bacteria 2821
504 Ga0307408_100064711 3300031548 Bacteria 2679
505 Ga0307408_100086284 3300031548 Bacteria 2359
506 Ga0307508_10000466 3300031616 Bacteria 48802
507 Ga0307508_10007101 3300031616 Bacteria 10443
508 Ga0307514_10000979 3300031649 Bacteria 42521
509 Ga0307514_10001625 3300031649 Bacteria 26325
510 Ga0307514_10004420 3300031649 Bacteria 12940
511 Ga0307514_10056335 3300031649 Bacteria 3018
512 Ga0307516_10000705 3300031730 Bacteria 45448
513 Ga0307516_10018606 3300031730 Bacteria 7215
514 Ga0307516_10023079 3300031730 Bacteria 6384
515 Ga0307516_10123621 3300031730 Bacteria 2374
516 Ga0307516_10190063 3300031730 Bacteria 1780
517 Ga0307405_10001883 3300031731 Bacteria 9015
518 Ga0307405_10013240 3300031731 Bacteria 4396
519 Ga0307413_10004852 3300031824 Bacteria 5909
520 Ga0307413_10005108 3300031824 Bacteria 5808
521 Ga0307410_10079866 3300031852 Bacteria 2293
522 Ga0307406_10000278 3300031901 Bacteria 30154
523 Ga0307406_10004015 3300031901 Bacteria 8006
524 Ga0307406_10004493 3300031901 Bacteria 7594
525 Ga0307406_10023208 3300031901 Bacteria 3688
526 Ga0307407_10012937 3300031903 Bacteria 4031
527 Ga0307412_10004381 3300031911 Bacteria 7870
528 Ga0307412_10034999 3300031911 Bacteria 3205
529 Ga0307409_100010785 3300031995 Bacteria 5711
530 Ga0307409_100163392 3300031995 Bacteria 1950
531 Ga0307416_100011599 3300032002 Bacteria 5888
532 Ga0307416_100022062 3300032002 Bacteria 4586
533 Ga0307414_10316971 3300032004 Bacteria 1326
534 Ga0307411_10001006 3300032005 Bacteria 10872
535 Ga0307415_100096447 3300032126 Bacteria 2155
536 Ga0307507_10058912 3300033179 Bacteria 3600
537 Ga0307507_10142012 3300033179 Bacteria 1838
538 Ga0373929_0020793 3300035085 Bacteria 1326
539 Ga0373944_0048338 3300035089 Bacteria 1335
540 Ga0373941_0131040 3300035115 Unclassified 903
541 Ga0373953_0003327 3300035117 Bacteria 4988
542 Ga0373954_0027596 3300035118 Bacteria 2607
543 Ga0373946_0019107 3300035171 Bacteria 2638
544 Ga0373955_0039097 3300035172 Bacteria 2530
545 Ga0373955_0214555 3300035172 Bacteria 1148
546 Ga0373931_0044447 3300035691 Bacteria 2343
547 Ga0373935_0081080 3300035692 Bacteria 2109
548 Ga0373935_0092233 3300035692 Bacteria 1984
549 Ga0373927_0040065 3300035695 Bacteria 3040
550 Ga0373933_0004441 3300035724 Bacteria 7697
551 Ga0373947_0057524 3300035725 Bacteria 2353
552 Ga0373937_0027808 3300036401 Bacteria 5116
553 Ga0373937_0102170 3300036401 Bacteria 2661
554 Ga0373925_0052445 3300037068 Bacteria 3047
555 Ga0373925_0054821 3300037068 Bacteria 2982
556 Ga0373925_0064722 3300037068 Bacteria 2753
557 Ga0373925_0152105 3300037068 Bacteria 1818
558 Ga0436361_1141598 3300039447 Bacteria 1600
559 Ga0451793_0421724 3300041452 Bacteria 3400
560 Ga0451853_3400648 3300041512 Bacteria 1889
561 Ga0439431_0009732 3300041997 Bacteria 2174
562 Ga0439445_0022983 3300042004 Bacteria 1576
563 Ga0439455_0058532 3300042012 Bacteria 1018
564 Ga0450919_002868 3300042121 Bacteria 2211
565 Ga0450923_025616 3300042125 Bacteria 1176
566 Ga0450891_006399 3300042129 Bacteria 1086
567 Ga0439434_0026031 3300042435 Bacteria 1767
568 Ga0439464_0058301 3300042439 Bacteria 1127
569 Ga0450918_001141 3300042531 Bacteria 5446
570 Ga0451577_0003070 3300042876 Bacteria 18890
571 Ga0451577_0067920 3300042876 Bacteria 3180
572 Ga0451577_0102691 3300042876 Bacteria 2555
573 Ga0453683_0022728 3300044673 Bacteria 3998
574 Ga0466963_0129886 3300044694 Bacteria 1740
575 Ga0453684_0006395 3300044712 Bacteria 22435
576 Ga0453684_0009366 3300044712 Bacteria 17157
577 Ga0453684_0030654 3300044712 Bacteria 7589
578 Ga0451576_0005545 3300045051 Bacteria 15763
579 Ga0451576_0298557 3300045051 Bacteria 1684
580 Ga0495592_0000264 3300046454 Bacteria 44823
581 Ga0495590_0018748 3300046457 Bacteria 2475
582 Ga0495650_0004943 3300046471 Bacteria 8892
583 Ga0495580_0070957 3300046472 Bacteria 2433
584 Ga0495664_0033908 3300046477 Bacteria 3001
585 Ga0495608_0120732 3300046511 Bacteria 1681
586 Ga0495610_0036459 3300046512 Bacteria 2513
587 Ga0495630_0058507 3300046517 Bacteria 2890
588 Ga0495632_0002891 3300046519 Bacteria 12629
589 Ga0495632_0026840 3300046519 Bacteria 3024
590 Ga0495632_0084916 3300046519 Bacteria 1506
591 Ga0495648_0076904 3300046524 Bacteria 1915
592 Ga0495654_0002750 3300046530 Bacteria 11091
593 Ga0495645_0019219 3300046543 Bacteria 4919
594 Ga0495622_0079260 3300046557 Bacteria 1512
595 Ga0495656_0002817 3300046615 Bacteria 5815
596 Ga0495625_0001726 3300046660 Bacteria 25344
597 Ga0495625_0139522 3300046660 Bacteria 1636
598 Ga0495623_0106309 3300046679 Bacteria 1705
599 Ga0495669_0042227 3300046684 Bacteria 2027
600 Ga0495624_0199029 3300046690 Bacteria 1217
601 Ga0495670_0216111 3300046691 Archaea 1018
602 Ga0495649_0015742 3300046694 Bacteria 4299
603 Ga0495649_0025268 3300046694 Bacteria 3309
604 Ga0495676_0289302 3300047321 Bacteria 1107
605 Ga0495687_000212 3300047443 Bacteria 83406
606 Ga0495687_044482 3300047443 Bacteria 1929
607 Ga0495593_0022467 3300047673 Bacteria 3514
608 Ga0495602_0275707 3300048088 Bacteria 1241
609 Ga0496102_0003078 3300048905 Bacteria 14125
610 Ga0496102_0005035 3300048905 Bacteria 11191
611 Ga0496102_0038160 3300048905 Bacteria 4334
612 Ga0496102_0205363 3300048905 Bacteria 1857
613 Ga0496104_0007078 3300048907 Bacteria 9893
614 Ga0496105_0001968 3300048908 Bacteria 14776
615 Ga0496106_0002588 3300048909 Bacteria 13468
616 Ga0496106_0084117 3300048909 Bacteria 2448
617 Ga0496106_0188970 3300048909 Bacteria 1637
618 Ga0496107_0002385 3300048910 Bacteria 12156
619 Ga0496107_0143787 3300048910 Bacteria 1763
620 Ga0496108_0017714 3300048911 Bacteria 5826
621 Ga0496110_0101718 3300048913 Bacteria 2576
622 Ga0496110_0685235 3300048913 Bacteria 926
623 Ga0496112_0000241 3300048915 Bacteria 35206
624 Ga0496113_0209016 3300048916 Bacteria 1553
625 Ga0496114_0003680 3300048917 Bacteria 11790
626 Ga0496115_0079611 3300048918 Bacteria 2667
627 Ga0496118_0184943 3300048921 Bacteria 1254
628 Ga0496121_0116335 3300048924 Bacteria 2028
629 Ga0496124_0003260 3300048927 Bacteria 20044
630 Ga0496125_0005292 3300048928 Bacteria 14432
631 Ga0496125_0113669 3300048928 Bacteria 1953
632 Ga0496125_0125014 3300048928 Bacteria 1825
633 Ga0501300_017066 3300049523 Bacteria 1059
634 Ga0501047_0172215 3300049581 Bacteria 2033
635 Ga0501079_0509046 3300049741 Bacteria 947
636 Ga0501080_0063841 3300049742 Bacteria 3426
637 Ga0501083_0010480 3300049744 Bacteria 6525
638 nmdc:mga03683_36318_c1 3300050489 Bacteria 2004
639 nmdc:mga0k408_13359_c1 3300050493 Bacteria 4502
640 nmdc:mga0k408_20709_c1 3300050493 Bacteria 3689
641 nmdc:mga0k408_37110_c1 3300050493 Bacteria 2797
642 nmdc:mga0k408_51204_c1 3300050493 Bacteria 2392
643 nmdc:mga0k408_585_c1 3300050493 Bacteria 20193
644 nmdc:mga0k408_81863_c1 3300050493 Bacteria 1891
645 nmdc:mga06z11_135992_c1 3300050494 Bacteria 1385
646 nmdc:mga06z11_14050_c1 3300050494 Bacteria 3534
647 nmdc:mga06z11_37007_c1 3300050494 Bacteria 2414
648 nmdc:mga06z11_5847_c1 3300050494 Bacteria 4965
649 nmdc:mga04h51_23644_c1 3300050495 Bacteria 1873
650 nmdc:mga07m45_247_c1 3300050496 Bacteria 21997
651 nmdc:mga07m45_41439_c1 3300050496 Bacteria 2579
652 nmdc:mga09592_3236_c1 3300050508 Bacteria 13180
653 nmdc:mga0qj67_115994_c1 3300050509 Bacteria 2164
654 nmdc:mga08y16_120385_c1 3300050511 Bacteria 2731
655 nmdc:mga08y16_24913_c1 3300050511 Bacteria 6311
656 nmdc:mga08y16_74087_c1 3300050511 Bacteria 3547
657 nmdc:mga0n895_296568_c1 3300050512 Bacteria 1639
658 nmdc:mga08x19_15991_c1 3300050514 Bacteria 4571
659 Ga0500578_0010158 3300053086 Bacteria 6104
660 Ga0500644_0154548 3300053088 Bacteria 922
661 Ga0500646_0001709 3300053090 Bacteria 5790
662 Ga0500583_0051795 3300053092 Bacteria 1909
663 Ga0500651_0027117 3300053093 Bacteria 3601
664 Ga0500566_0004435 3300053094 Bacteria 8380
665 Ga0500566_0014401 3300053094 Bacteria 4650
666 Ga0500650_0033793 3300053098 Bacteria 2334
667 Ga0500593_000435 3300053117 Bacteria 16452
668 Ga0500652_001537 3300053131 Bacteria 7060
669 Ga0500658_0022941 3300053134 Bacteria 2379
670 Ga0500559_0000092 3300053136 Bacteria 71917
671 Ga0500559_0218527 3300053136 Bacteria 899
672 Ga0500603_000602 3300053150 Bacteria 8950
673 Ga0500604_0005487 3300053151 Bacteria 3348
674 Ga0500622_0001110 3300053156 Bacteria 22450
675 Ga0500645_000474 3300053730 Bacteria 27453
676 Ga0500587_001176 3300053739 Bacteria 3617
677 Ga0501082_0101187 3300060353 Bacteria 2493

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035115 Ga0373941_0131040 Ga0373941_0131040_125_892 252
2 3300053136 Ga0500559_0218527 Ga0500559_0218527_13_777 253
3 3300048913 Ga0496110_0685235 Ga0496110_0685235_29_856 275
4 3300048921 Ga0496118_0184943 Ga0496118_0184943_194_1027 275
5 3300048924 Ga0496121_0116335 Ga0496121_0116335_913_1746 275
6 3300048928 Ga0496125_0125014 Ga0496125_0125014_321_1154 275
7 3300049741 Ga0501079_0509046 Ga0501079_0509046_92_934 278
8 iso_pu_bacteria 2643221644 2644244522 279
9 3300005459 Ga0068867_100000114 Ga0068867_10000011450 280
10 3300009148 Ga0105243_10014110 Ga0105243_100141103 280
11 3300014745 Ga0157377_10000016 Ga0157377_10000016133 280
12 3300025935 Ga0207709_10052527 Ga0207709_100525272 280
13 3300026089 Ga0207648_10000343 Ga0207648_1000034351 280
14 3300046691 Ga0495670_0216111 Ga0495670_0216111_119_973 280
15 3300014326 Ga0157380_10076760 Ga0157380_100767603 282
16 3300003775 Ga0055524_1000079 Ga0055524_100007982 283
17 3300003791 Ga0055530_10005160 Ga0055530_100051602 283
18 3300003792 Ga0055540_1000004 Ga0055540_1000004156 283
19 3300003794 Ga0055531_10014357 Ga0055531_100143573 283
20 3300005339 Ga0070660_100025436 Ga0070660_1000254362 283
21 3300005344 Ga0070661_100007008 Ga0070661_1000070089 283
22 3300005564 Ga0070664_100184031 Ga0070664_1001840312 283
23 3300006946 Ga0079104_1000352 Ga0079104_100035214 283
24 3300025298 Ga0209050_1000677 Ga0209050_100067721 283
25 3300025298 Ga0209050_1028295 Ga0209050_10282952 283
26 3300025299 Ga0209256_1000011 Ga0209256_100001183 283
27 3300025303 Ga0209051_1000016 Ga0209051_1000016249 283
28 3300025304 Ga0209257_1000102 Ga0209257_100010244 283
29 3300025919 Ga0207657_10041190 Ga0207657_100411902 283
30 3300025920 Ga0207649_10001247 Ga0207649_1000124714 283
31 3300025932 Ga0207690_10066524 Ga0207690_100665243 283
32 3300025945 Ga0207679_10000404 Ga0207679_100004047 283
33 3300027111 Ga0209281_1000454 Ga0209281_100045443 283
34 3300033179 Ga0307507_10142012 Ga0307507_101420122 283
35 3300042121 Ga0450919_002868 Ga0450919_002868_1229_2080 283
36 3300042125 Ga0450923_025616 Ga0450923_025616_108_959 283
37 3300042531 Ga0450918_001141 Ga0450918_001141_919_1770 283
38 3300048905 Ga0496102_0005035 Ga0496102_0005035_6464_7384 283
39 3300048917 Ga0496114_0003680 Ga0496114_0003680_8020_8871 283
40 3300053117 Ga0500593_000435 Ga0500593_000435_1984_2904 283
41 3300003322 rootL2_10103817 rootL2_101038174 284
42 3300006038 Ga0075365_10041051 Ga0075365_100410512 284
43 3300006051 Ga0075364_10243040 Ga0075364_102430402 284
44 3300005718 Ga0068866_10058754 Ga0068866_100587542 286
45 3300026118 Ga0207675_100080982 Ga0207675_1000809822 286
46 3300031548 Ga0307408_100050732 Ga0307408_1000507321 286
47 3300031901 Ga0307406_10023208 Ga0307406_100232082 286
48 3300053086 Ga0500578_0010158 Ga0500578_0010158_329_1201 286
49 3300053094 Ga0500566_0004435 Ga0500566_0004435_7222_8115 286
50 3300053150 Ga0500603_000602 Ga0500603_000602_4346_5239 286
51 3300006914 Ga0075436_100030838 Ga0075436_1000308383 287
52 3300025905 Ga0207685_10170595 Ga0207685_101705951 287
53 3300025937 Ga0207669_10292471 Ga0207669_102924711 287
54 3300027614 Ga0209970_1001012 Ga0209970_10010121 287
55 3300035691 Ga0373931_0044447 Ga0373931_0044447_500_1390 287
56 3300046684 Ga0495669_0042227 Ga0495669_0042227_320_1195 287
57 3300050514 nmdc:mga08x19_15991_c1 nmdc:mga08x19_15991_c1_1856_2731 287
58 3300053730 Ga0500645_000474 Ga0500645_000474_11106_12053 287
59 3300031456 Ga0307513_10190247 Ga0307513_101902472 288
60 iso_pu_bacteria 2643221609 2644058240 288
61 iso_pu_bacteria 2643221611 2644073293 288
62 iso_pu_bacteria 2738543012 2739244419 288
63 iso_pu_bacteria 2816332133 2816469850 288
64 3300005340 Ga0070689_100019245 Ga0070689_1000192455 289
65 3300005438 Ga0070701_10007050 Ga0070701_100070503 289
66 3300005440 Ga0070705_100114283 Ga0070705_1001142831 289
67 3300005615 Ga0070702_100109450 Ga0070702_1001094502 289
68 3300005617 Ga0068859_100430372 Ga0068859_1004303721 289
69 3300006931 Ga0097620_100430429 Ga0097620_1004304291 289
70 3300014326 Ga0157380_10000875 Ga0157380_100008756 289
71 3300025918 Ga0207662_10032204 Ga0207662_100322041 289
72 3300025936 Ga0207670_10031264 Ga0207670_100312643 289
73 3300025942 Ga0207689_10026863 Ga0207689_100268634 289
74 3300031456 Ga0307513_10000006 Ga0307513_10000006412 289
75 3300031548 Ga0307408_100000008 Ga0307408_100000008271 289
76 3300031730 Ga0307516_10018606 Ga0307516_100186067 289
77 3300042876 Ga0451577_0003070 Ga0451577_0003070_2562_3473 289
78 3300042876 Ga0451577_0067920 Ga0451577_0067920_1611_2510 289
79 3300044673 Ga0453683_0022728 Ga0453683_0022728_456_1355 289
80 3300044712 Ga0453684_0009366 Ga0453684_0009366_3560_4471 289
81 3300044712 Ga0453684_0030654 Ga0453684_0030654_2244_3143 289
82 3300045051 Ga0451576_0005545 Ga0451576_0005545_1852_2751 289
83 iso_pu_bacteria 2547132374 2548500442 289
84 iso_pu_bacteria 2585428062 2587757047 289
85 iso_pu_bacteria 2643221570 2643864548 289
86 iso_pu_bacteria 2643221596 2643992840 289
87 iso_pu_bacteria 2643221652 2644291763 289
88 iso_pu_bacteria 2643221717 2644647011 289
89 iso_pu_bacteria 2990710928 2990715127 289
90 3300005539 Ga0068853_100011875 Ga0068853_1000118757 290
91 3300005841 Ga0068863_100027188 Ga0068863_1000271882 290
92 3300006844 Ga0075428_100012423 Ga0075428_1000124238 290
93 3300009093 Ga0105240_10027731 Ga0105240_100277315 290
94 3300009094 Ga0111539_10021763 Ga0111539_100217636 290
95 3300009545 Ga0105237_10000076 Ga0105237_100000769 290
96 3300009551 Ga0105238_10007384 Ga0105238_100073849 290
97 3300010375 Ga0105239_10008182 Ga0105239_100081829 290
98 3300025911 Ga0207654_10137587 Ga0207654_101375872 290
99 3300025913 Ga0207695_10021153 Ga0207695_100211534 290
100 3300025914 Ga0207671_10005377 Ga0207671_100053775 290
101 3300025916 Ga0207663_10246971 Ga0207663_102469712 290
102 3300025924 Ga0207694_10011637 Ga0207694_100116373 290
103 3300026088 Ga0207641_10225869 Ga0207641_102258692 290
104 3300028794 Ga0307515_10025898 Ga0307515_100258983 290
105 3300039447 Ga0436361_1141598 Ga0436361_1141598_640_1527 290
106 3300042439 Ga0439464_0058301 Ga0439464_0058301_51_926 290
107 3300046471 Ga0495650_0004943 Ga0495650_0004943_2908_3783 290
108 3300046615 Ga0495656_0002817 Ga0495656_0002817_3773_4657 290
109 3300048928 Ga0496125_0113669 Ga0496125_0113669_24_896 290
110 3300049581 Ga0501047_0172215 Ga0501047_0172215_202_1092 290
111 3300049742 Ga0501080_0063841 Ga0501080_0063841_487_1377 290
112 3300049744 Ga0501083_0010480 Ga0501083_0010480_831_1721 290
113 3300050511 nmdc:mga08y16_24913_c1 nmdc:mga08y16_24913_c1_942_1826 290
114 3300060353 Ga0501082_0101187 Ga0501082_0101187_1543_2433 290
115 3300005331 Ga0070670_100029077 Ga0070670_1000290773 291
116 3300005336 Ga0070680_100332264 Ga0070680_1003322641 291
117 3300005458 Ga0070681_10193585 Ga0070681_101935852 291
118 3300005563 Ga0068855_100154798 Ga0068855_1001547982 291
119 3300006195 Ga0075366_10000810 Ga0075366_100008105 291
120 3300006195 Ga0075366_10002594 Ga0075366_100025943 291
121 3300006846 Ga0075430_100087012 Ga0075430_1000870122 291
122 3300013104 Ga0157370_10013405 Ga0157370_100134055 291
123 3300014326 Ga0157380_10427889 Ga0157380_104278892 291
124 3300025292 Ga0209676_1043215 Ga0209676_10432152 291
125 3300025912 Ga0207707_10069217 Ga0207707_100692173 291
126 3300025925 Ga0207650_10024159 Ga0207650_100241592 291
127 3300025949 Ga0207667_10165607 Ga0207667_101656072 291
128 3300028794 Ga0307515_10000459 Ga0307515_1000045987 291
129 3300031456 Ga0307513_10005054 Ga0307513_100050544 291
130 3300031548 Ga0307408_100064711 Ga0307408_1000647113 291
131 3300031649 Ga0307514_10001625 Ga0307514_1000162522 291
132 3300031731 Ga0307405_10001883 Ga0307405_100018834 291
133 3300031824 Ga0307413_10004852 Ga0307413_100048526 291
134 3300031852 Ga0307410_10079866 Ga0307410_100798662 291
135 3300031901 Ga0307406_10004015 Ga0307406_100040152 291
136 3300031903 Ga0307407_10012937 Ga0307407_100129374 291
137 3300031911 Ga0307412_10034999 Ga0307412_100349993 291
138 3300031995 Ga0307409_100163392 Ga0307409_1001633922 291
139 3300032002 Ga0307416_100011599 Ga0307416_1000115993 291
140 3300032004 Ga0307414_10316971 Ga0307414_103169712 291
141 3300032005 Ga0307411_10001006 Ga0307411_1000100611 291
142 3300032126 Ga0307415_100096447 Ga0307415_1000964473 291
143 3300044694 Ga0466963_0129886 Ga0466963_0129886_692_1567 291
144 3300050493 nmdc:mga0k408_585_c1 nmdc:mga0k408_585_c1_9249_10124 291
145 3300050508 nmdc:mga09592_3236_c1 nmdc:mga09592_3236_c1_9140_10021 291
146 3300050509 nmdc:mga0qj67_115994_c1 nmdc:mga0qj67_115994_c1_1154_2035 291
147 iso_pu_bacteria 2585428058 2587736261 291
148 3300005331 Ga0070670_100080848 Ga0070670_1000808481 292
149 3300005338 Ga0068868_100200106 Ga0068868_1002001062 292
150 3300005338 Ga0068868_100318724 Ga0068868_1003187241 292
151 3300005338 Ga0068868_100411250 Ga0068868_1004112501 292
152 3300005339 Ga0070660_100455486 Ga0070660_1004554861 292
153 3300005340 Ga0070689_100228338 Ga0070689_1002283382 292
154 3300005347 Ga0070668_100049482 Ga0070668_1000494822 292
155 3300005347 Ga0070668_100417237 Ga0070668_1004172372 292
156 3300005353 Ga0070669_100063154 Ga0070669_1000631542 292
157 3300005353 Ga0070669_100122721 Ga0070669_1001227212 292
158 3300005354 Ga0070675_100030891 Ga0070675_1000308915 292
159 3300005355 Ga0070671_100002310 Ga0070671_10000231010 292
160 3300005355 Ga0070671_100007296 Ga0070671_1000072968 292
161 3300005355 Ga0070671_100541423 Ga0070671_1005414231 292
162 3300005364 Ga0070673_100026546 Ga0070673_1000265465 292
163 3300005364 Ga0070673_100073518 Ga0070673_1000735182 292
164 3300005365 Ga0070688_100267709 Ga0070688_1002677092 292
165 3300005366 Ga0070659_100003296 Ga0070659_1000032969 292
166 3300005366 Ga0070659_100090741 Ga0070659_1000907412 292
167 3300005367 Ga0070667_100282042 Ga0070667_1002820422 292
168 3300005445 Ga0070708_100000792 Ga0070708_10000079211 292
169 3300005445 Ga0070708_100309855 Ga0070708_1003098552 292
170 3300005455 Ga0070663_100021054 Ga0070663_1000210543 292
171 3300005457 Ga0070662_100001177 Ga0070662_1000011775 292
172 3300005459 Ga0068867_100121786 Ga0068867_1001217862 292
173 3300005530 Ga0070679_100037311 Ga0070679_1000373112 292
174 3300005539 Ga0068853_100002005 Ga0068853_10000200517 292
175 3300005543 Ga0070672_100199499 Ga0070672_1001994992 292
176 3300005547 Ga0070693_100208420 Ga0070693_1002084202 292
177 3300005548 Ga0070665_100007136 Ga0070665_1000071366 292
178 3300005563 Ga0068855_100003898 Ga0068855_1000038984 292
179 3300005563 Ga0068855_100118801 Ga0068855_1001188013 292
180 3300005564 Ga0070664_100023803 Ga0070664_1000238037 292
181 3300005577 Ga0068857_100451502 Ga0068857_1004515022 292
182 3300005578 Ga0068854_100161072 Ga0068854_1001610722 292
183 3300005614 Ga0068856_100001796 Ga0068856_10000179612 292
184 3300005617 Ga0068859_100340151 Ga0068859_1003401511 292
185 3300005618 Ga0068864_100001446 Ga0068864_10000144629 292
186 3300005718 Ga0068866_10170551 Ga0068866_101705512 292
187 3300005719 Ga0068861_100133512 Ga0068861_1001335122 292
188 3300005719 Ga0068861_100272877 Ga0068861_1002728772 292
189 3300005841 Ga0068863_100158509 Ga0068863_1001585093 292
190 3300005842 Ga0068858_100275380 Ga0068858_1002753802 292
191 3300005843 Ga0068860_100198079 Ga0068860_1001980793 292
192 3300005843 Ga0068860_100281001 Ga0068860_1002810012 292
193 3300005844 Ga0068862_100025057 Ga0068862_1000250574 292
194 3300006195 Ga0075366_10037164 Ga0075366_100371644 292
195 3300006353 Ga0075370_10147441 Ga0075370_101474412 292
196 3300006844 Ga0075428_100548448 Ga0075428_1005484482 292
197 3300006871 Ga0075434_100757284 Ga0075434_1007572841 292
198 3300006931 Ga0097620_100340139 Ga0097620_1003401391 292
199 3300009094 Ga0111539_10154655 Ga0111539_101546552 292
200 3300009098 Ga0105245_10057243 Ga0105245_100572431 292
201 3300009147 Ga0114129_10697670 Ga0114129_106976702 292
202 3300009174 Ga0105241_10154351 Ga0105241_101543512 292
203 3300009177 Ga0105248_10013123 Ga0105248_100131236 292
204 3300013100 Ga0157373_10006303 Ga0157373_100063038 292
205 3300013102 Ga0157371_10000194 Ga0157371_1000019414 292
206 3300013297 Ga0157378_10094210 Ga0157378_100942103 292
207 3300013306 Ga0163162_10118849 Ga0163162_101188493 292
208 3300013307 Ga0157372_10005627 Ga0157372_1000562713 292
209 3300013308 Ga0157375_10019566 Ga0157375_100195668 292
210 3300013308 Ga0157375_10298682 Ga0157375_102986822 292
211 3300013308 Ga0157375_10400246 Ga0157375_104002461 292
212 3300014968 Ga0157379_10025337 Ga0157379_100253373 292
213 3300014968 Ga0157379_10102095 Ga0157379_101020952 292
214 3300014969 Ga0157376_10033776 Ga0157376_100337762 292
215 3300014969 Ga0157376_10707566 Ga0157376_107075662 292
216 3300025901 Ga0207688_10261430 Ga0207688_102614301 292
217 3300025903 Ga0207680_10039758 Ga0207680_100397581 292
218 3300025903 Ga0207680_10301950 Ga0207680_103019501 292
219 3300025906 Ga0207699_10361416 Ga0207699_103614161 292
220 3300025919 Ga0207657_10003940 Ga0207657_1000394021 292
221 3300025919 Ga0207657_10022507 Ga0207657_100225071 292
222 3300025920 Ga0207649_10057355 Ga0207649_100573552 292
223 3300025921 Ga0207652_10145470 Ga0207652_101454702 292
224 3300025925 Ga0207650_10043358 Ga0207650_100433581 292
225 3300025927 Ga0207687_10042968 Ga0207687_100429681 292
226 3300025931 Ga0207644_10001985 Ga0207644_100019858 292
227 3300025931 Ga0207644_10044136 Ga0207644_100441363 292
228 3300025931 Ga0207644_10058835 Ga0207644_100588352 292
229 3300025932 Ga0207690_10006609 Ga0207690_100066096 292
230 3300025933 Ga0207706_10000002 Ga0207706_10000002287 292
231 3300025933 Ga0207706_10093004 Ga0207706_100930043 292
232 3300025940 Ga0207691_10075440 Ga0207691_100754402 292
233 3300025941 Ga0207711_10019605 Ga0207711_100196053 292
234 3300025942 Ga0207689_10037463 Ga0207689_100374634 292
235 3300025945 Ga0207679_10005738 Ga0207679_1000573811 292
236 3300025945 Ga0207679_10121147 Ga0207679_101211472 292
237 3300025949 Ga0207667_10002797 Ga0207667_1000279716 292
238 3300025960 Ga0207651_10007695 Ga0207651_100076953 292
239 3300025960 Ga0207651_10035662 Ga0207651_100356623 292
240 3300025972 Ga0207668_10034452 Ga0207668_100344522 292
241 3300025986 Ga0207658_10058879 Ga0207658_100588793 292
242 3300026023 Ga0207677_10120407 Ga0207677_101204072 292
243 3300026023 Ga0207677_10560265 Ga0207677_105602651 292
244 3300026035 Ga0207703_10262531 Ga0207703_102625312 292
245 3300026067 Ga0207678_10032495 Ga0207678_100324954 292
246 3300026078 Ga0207702_10006364 Ga0207702_100063645 292
247 3300026078 Ga0207702_10270514 Ga0207702_102705142 292
248 3300026089 Ga0207648_10220136 Ga0207648_102201362 292
249 3300026095 Ga0207676_10182574 Ga0207676_101825741 292
250 3300026095 Ga0207676_10391478 Ga0207676_103914782 292
251 3300026095 Ga0207676_10647995 Ga0207676_106479951 292
252 3300026116 Ga0207674_10131513 Ga0207674_101315133 292
253 3300026116 Ga0207674_10154073 Ga0207674_101540732 292
254 3300026118 Ga0207675_100207949 Ga0207675_1002079492 292
255 3300027552 Ga0209982_1019615 Ga0209982_10196152 292
256 3300027617 Ga0210002_1011274 Ga0210002_10112741 292
257 3300027665 Ga0209983_1002922 Ga0209983_10029222 292
258 3300027682 Ga0209971_1028964 Ga0209971_10289642 292
259 3300027695 Ga0209966_1004389 Ga0209966_10043892 292
260 3300027876 Ga0209974_10007375 Ga0209974_100073752 292
261 3300028379 Ga0268266_10210787 Ga0268266_102107872 292
262 3300028380 Ga0268265_10074241 Ga0268265_100742413 292
263 3300028381 Ga0268264_10089344 Ga0268264_100893443 292
264 3300028794 Ga0307515_10000417 Ga0307515_100004172 292
265 3300028794 Ga0307515_10091248 Ga0307515_100912482 292
266 3300030522 Ga0307512_10031625 Ga0307512_100316253 292
267 3300031456 Ga0307513_10002513 Ga0307513_1000251315 292
268 3300031507 Ga0307509_10001694 Ga0307509_1000169410 292
269 3300031507 Ga0307509_10096881 Ga0307509_100968812 292
270 3300031548 Ga0307408_100000072 Ga0307408_10000007226 292
271 3300031548 Ga0307408_100057624 Ga0307408_1000576242 292
272 3300031548 Ga0307408_100086284 Ga0307408_1000862842 292
273 3300031649 Ga0307514_10056335 Ga0307514_100563352 292
274 3300031730 Ga0307516_10000705 Ga0307516_1000070520 292
275 3300031731 Ga0307405_10013240 Ga0307405_100132404 292
276 3300031824 Ga0307413_10005108 Ga0307413_100051086 292
277 3300031901 Ga0307406_10000278 Ga0307406_1000027826 292
278 3300031901 Ga0307406_10004493 Ga0307406_100044932 292
279 3300031911 Ga0307412_10004381 Ga0307412_100043818 292
280 3300031995 Ga0307409_100010785 Ga0307409_1000107856 292
281 3300032002 Ga0307416_100022062 Ga0307416_1000220622 292
282 3300035085 Ga0373929_0020793 Ga0373929_0020793_397_1281 292
283 3300037068 Ga0373925_0152105 Ga0373925_0152105_515_1393 292
284 3300041997 Ga0439431_0009732 Ga0439431_0009732_360_1301 292
285 3300042004 Ga0439445_0022983 Ga0439445_0022983_303_1244 292
286 3300042012 Ga0439455_0058532 Ga0439455_0058532_26_910 292
287 3300042129 Ga0450891_006399 Ga0450891_006399_11_952 292
288 3300042435 Ga0439434_0026031 Ga0439434_0026031_784_1725 292
289 3300046454 Ga0495592_0000264 Ga0495592_0000264_9111_9989 292
290 3300046457 Ga0495590_0018748 Ga0495590_0018748_1130_2017 292
291 3300046512 Ga0495610_0036459 Ga0495610_0036459_226_1104 292
292 3300046690 Ga0495624_0199029 Ga0495624_0199029_313_1191 292
293 3300046694 Ga0495649_0025268 Ga0495649_0025268_1539_2432 292
294 3300047321 Ga0495676_0289302 Ga0495676_0289302_143_1021 292
295 3300047673 Ga0495593_0022467 Ga0495593_0022467_1939_2817 292
296 3300048088 Ga0495602_0275707 Ga0495602_0275707_239_1117 292
297 3300048905 Ga0496102_0003078 Ga0496102_0003078_4662_5546 292
298 3300048905 Ga0496102_0205363 Ga0496102_0205363_550_1431 292
299 3300048909 Ga0496106_0002588 Ga0496106_0002588_8990_9874 292
300 3300048909 Ga0496106_0084117 Ga0496106_0084117_1276_2157 292
301 3300048910 Ga0496107_0002385 Ga0496107_0002385_347_1231 292
302 3300048927 Ga0496124_0003260 Ga0496124_0003260_3085_3966 292
303 3300048928 Ga0496125_0005292 Ga0496125_0005292_11105_11986 292
304 3300049523 Ga0501300_017066 Ga0501300_017066_32_1003 292
305 3300050493 nmdc:mga0k408_81863_c1 nmdc:mga0k408_81863_c1_436_1314 292
306 3300050511 nmdc:mga08y16_120385_c1 nmdc:mga08y16_120385_c1_592_1470 292
307 3300050512 nmdc:mga0n895_296568_c1 nmdc:mga0n895_296568_c1_75_956 292
308 3300053093 Ga0500651_0027117 Ga0500651_0027117_2067_2945 292
309 3300053136 Ga0500559_0000092 Ga0500559_0000092_40132_41010 292
310 3300005328 Ga0070676_10012793 Ga0070676_100127933 293
311 3300005329 Ga0070683_100239441 Ga0070683_1002394412 293
312 3300005330 Ga0070690_100000663 Ga0070690_1000006636 293
313 3300005331 Ga0070670_100008053 Ga0070670_1000080535 293
314 3300005331 Ga0070670_100017699 Ga0070670_1000176991 293
315 3300005334 Ga0068869_100000481 Ga0068869_10000048111 293
316 3300005334 Ga0068869_100075037 Ga0068869_1000750373 293
317 3300005334 Ga0068869_100125862 Ga0068869_1001258622 293
318 3300005335 Ga0070666_10000745 Ga0070666_100007455 293
319 3300005336 Ga0070680_100049561 Ga0070680_1000495613 293
320 3300005338 Ga0068868_100000971 Ga0068868_10000097112 293
321 3300005338 Ga0068868_100065210 Ga0068868_1000652103 293
322 3300005339 Ga0070660_100083033 Ga0070660_1000830332 293
323 3300005340 Ga0070689_100002088 Ga0070689_1000020885 293
324 3300005344 Ga0070661_100057524 Ga0070661_1000575243 293
325 3300005345 Ga0070692_10019480 Ga0070692_100194804 293
326 3300005347 Ga0070668_100033478 Ga0070668_1000334783 293
327 3300005347 Ga0070668_100062380 Ga0070668_1000623802 293
328 3300005353 Ga0070669_100004947 Ga0070669_1000049472 293
329 3300005353 Ga0070669_100053187 Ga0070669_1000531872 293
330 3300005353 Ga0070669_100417334 Ga0070669_1004173342 293
331 3300005355 Ga0070671_100001053 Ga0070671_10000105320 293
332 3300005355 Ga0070671_100196745 Ga0070671_1001967451 293
333 3300005356 Ga0070674_100057087 Ga0070674_1000570872 293
334 3300005364 Ga0070673_100007976 Ga0070673_1000079764 293
335 3300005364 Ga0070673_100211783 Ga0070673_1002117831 293
336 3300005365 Ga0070688_100002954 Ga0070688_10000295410 293
337 3300005366 Ga0070659_100086147 Ga0070659_1000861472 293
338 3300005367 Ga0070667_100001469 Ga0070667_10000146911 293
339 3300005367 Ga0070667_100004231 Ga0070667_10000423112 293
340 3300005367 Ga0070667_100020817 Ga0070667_1000208175 293
341 3300005434 Ga0070709_10077929 Ga0070709_100779292 293
342 3300005435 Ga0070714_100052026 Ga0070714_1000520265 293
343 3300005436 Ga0070713_100003384 Ga0070713_1000033841 293
344 3300005436 Ga0070713_100216577 Ga0070713_1002165772 293
345 3300005439 Ga0070711_100004626 Ga0070711_1000046266 293
346 3300005440 Ga0070705_100004377 Ga0070705_1000043775 293
347 3300005441 Ga0070700_100060479 Ga0070700_1000604792 293
348 3300005444 Ga0070694_100025464 Ga0070694_1000254645 293
349 3300005445 Ga0070708_100031577 Ga0070708_1000315776 293
350 3300005458 Ga0070681_10076070 Ga0070681_100760703 293
351 3300005459 Ga0068867_100003168 Ga0068867_1000031686 293
352 3300005459 Ga0068867_100007271 Ga0068867_1000072713 293
353 3300005466 Ga0070685_10011495 Ga0070685_100114955 293
354 3300005468 Ga0070707_100184969 Ga0070707_1001849692 293
355 3300005471 Ga0070698_100448861 Ga0070698_1004488612 293
356 3300005518 Ga0070699_100258697 Ga0070699_1002586972 293
357 3300005535 Ga0070684_100169006 Ga0070684_1001690062 293
358 3300005536 Ga0070697_100149793 Ga0070697_1001497932 293
359 3300005539 Ga0068853_100286500 Ga0068853_1002865001 293
360 3300005543 Ga0070672_100083034 Ga0070672_1000830342 293
361 3300005543 Ga0070672_100094808 Ga0070672_1000948082 293
362 3300005543 Ga0070672_100121904 Ga0070672_1001219042 293
363 3300005544 Ga0070686_100087863 Ga0070686_1000878632 293
364 3300005546 Ga0070696_100069276 Ga0070696_1000692763 293
365 3300005547 Ga0070693_100016671 Ga0070693_1000166711 293
366 3300005547 Ga0070693_100098940 Ga0070693_1000989401 293
367 3300005548 Ga0070665_100001402 Ga0070665_10000140219 293
368 3300005548 Ga0070665_100158672 Ga0070665_1001586722 293
369 3300005548 Ga0070665_100499930 Ga0070665_1004999302 293
370 3300005549 Ga0070704_100278957 Ga0070704_1002789572 293
371 3300005563 Ga0068855_100129567 Ga0068855_1001295673 293
372 3300005577 Ga0068857_100007102 Ga0068857_1000071029 293
373 3300005578 Ga0068854_100047229 Ga0068854_1000472292 293
374 3300005614 Ga0068856_100171183 Ga0068856_1001711831 293
375 3300005615 Ga0070702_100010808 Ga0070702_1000108085 293
376 3300005615 Ga0070702_100262853 Ga0070702_1002628532 293
377 3300005616 Ga0068852_100110416 Ga0068852_1001104161 293
378 3300005616 Ga0068852_100212494 Ga0068852_1002124942 293
379 3300005617 Ga0068859_100000893 Ga0068859_10000089325 293
380 3300005617 Ga0068859_100001169 Ga0068859_10000116911 293
381 3300005618 Ga0068864_100002752 Ga0068864_10000275210 293
382 3300005618 Ga0068864_100009929 Ga0068864_1000099299 293
383 3300005718 Ga0068866_10022409 Ga0068866_100224094 293
384 3300005719 Ga0068861_100001611 Ga0068861_10000161110 293
385 3300005719 Ga0068861_100002388 Ga0068861_10000238810 293
386 3300005719 Ga0068861_100225580 Ga0068861_1002255802 293
387 3300005840 Ga0068870_10022611 Ga0068870_100226112 293
388 3300005840 Ga0068870_10071014 Ga0068870_100710142 293
389 3300005841 Ga0068863_100000521 Ga0068863_10000052126 293
390 3300005841 Ga0068863_100003595 Ga0068863_10000359510 293
391 3300005842 Ga0068858_100003010 Ga0068858_10000301014 293
392 3300005842 Ga0068858_100012873 Ga0068858_1000128737 293
393 3300005843 Ga0068860_100001084 Ga0068860_10000108417 293
394 3300005843 Ga0068860_100003063 Ga0068860_10000306312 293
395 3300005843 Ga0068860_100005415 Ga0068860_1000054159 293
396 3300005844 Ga0068862_100013035 Ga0068862_1000130356 293
397 3300006042 Ga0075368_10112944 Ga0075368_101129442 293
398 3300006173 Ga0070716_100005733 Ga0070716_1000057337 293
399 3300006175 Ga0070712_100014560 Ga0070712_1000145602 293
400 3300006178 Ga0075367_10033023 Ga0075367_100330233 293
401 3300006178 Ga0075367_10044392 Ga0075367_100443924 293
402 3300006195 Ga0075366_10011317 Ga0075366_100113176 293
403 3300006195 Ga0075366_10016722 Ga0075366_100167225 293
404 3300006195 Ga0075366_10041574 Ga0075366_100415743 293
405 3300006237 Ga0097621_100014273 Ga0097621_1000142736 293
406 3300006353 Ga0075370_10002345 Ga0075370_1000234510 293
407 3300006353 Ga0075370_10207202 Ga0075370_102072022 293
408 3300006358 Ga0068871_100017564 Ga0068871_1000175642 293
409 3300006881 Ga0068865_100003419 Ga0068865_1000034198 293
410 3300006931 Ga0097620_100000893 Ga0097620_10000089325 293
411 3300006931 Ga0097620_100001169 Ga0097620_10000116917 293
412 3300009093 Ga0105240_10038834 Ga0105240_100388343 293
413 3300009094 Ga0111539_10092046 Ga0111539_100920462 293
414 3300009098 Ga0105245_10001644 Ga0105245_100016442 293
415 3300009098 Ga0105245_10007857 Ga0105245_100078573 293
416 3300009101 Ga0105247_10064396 Ga0105247_100643962 293
417 3300009101 Ga0105247_10200821 Ga0105247_102008212 293
418 3300009147 Ga0114129_10321911 Ga0114129_103219112 293
419 3300009174 Ga0105241_10067553 Ga0105241_100675532 293
420 3300009177 Ga0105248_10008045 Ga0105248_1000804510 293
421 3300009177 Ga0105248_10035492 Ga0105248_100354926 293
422 3300009545 Ga0105237_10016342 Ga0105237_100163426 293
423 3300009553 Ga0105249_10109533 Ga0105249_101095333 293
424 3300010375 Ga0105239_10817732 Ga0105239_108177322 293
425 3300013105 Ga0157369_10303625 Ga0157369_103036252 293
426 3300013296 Ga0157374_10002838 Ga0157374_100028384 293
427 3300013297 Ga0157378_10001679 Ga0157378_1000167910 293
428 3300013297 Ga0157378_10005473 Ga0157378_100054736 293
429 3300013297 Ga0157378_10505201 Ga0157378_105052011 293
430 3300013306 Ga0163162_10001712 Ga0163162_100017127 293
431 3300013306 Ga0163162_10001908 Ga0163162_1000190815 293
432 3300013308 Ga0157375_10025955 Ga0157375_100259556 293
433 3300013308 Ga0157375_10161320 Ga0157375_101613202 293
434 3300013308 Ga0157375_10228948 Ga0157375_102289481 293
435 3300014325 Ga0163163_10009939 Ga0163163_100099396 293
436 3300014325 Ga0163163_10311104 Ga0163163_103111041 293
437 3300014326 Ga0157380_10071614 Ga0157380_100716142 293
438 3300014745 Ga0157377_10104944 Ga0157377_101049442 293
439 3300014968 Ga0157379_10001362 Ga0157379_1000136217 293
440 3300014968 Ga0157379_10002571 Ga0157379_1000257110 293
441 3300014968 Ga0157379_10066080 Ga0157379_100660802 293
442 3300014969 Ga0157376_10001750 Ga0157376_1000175012 293
443 3300017792 Ga0163161_10020125 Ga0163161_100201252 293
444 3300025321 Ga0207656_10133863 Ga0207656_101338631 293
445 3300025899 Ga0207642_10089583 Ga0207642_100895832 293
446 3300025900 Ga0207710_10043600 Ga0207710_100436001 293
447 3300025900 Ga0207710_10074938 Ga0207710_100749382 293
448 3300025903 Ga0207680_10000783 Ga0207680_100007836 293
449 3300025906 Ga0207699_10078508 Ga0207699_100785082 293
450 3300025907 Ga0207645_10045451 Ga0207645_100454512 293
451 3300025907 Ga0207645_10046267 Ga0207645_100462673 293
452 3300025908 Ga0207643_10032638 Ga0207643_100326382 293
453 3300025908 Ga0207643_10079987 Ga0207643_100799872 293
454 3300025912 Ga0207707_10427262 Ga0207707_104272621 293
455 3300025913 Ga0207695_10029322 Ga0207695_100293222 293
456 3300025915 Ga0207693_10001071 Ga0207693_100010719 293
457 3300025916 Ga0207663_10280088 Ga0207663_102800881 293
458 3300025917 Ga0207660_10060768 Ga0207660_100607684 293
459 3300025918 Ga0207662_10051405 Ga0207662_100514051 293
460 3300025923 Ga0207681_10008779 Ga0207681_100087792 293
461 3300025925 Ga0207650_10008631 Ga0207650_100086314 293
462 3300025925 Ga0207650_10011427 Ga0207650_100114279 293
463 3300025926 Ga0207659_10008305 Ga0207659_100083053 293
464 3300025927 Ga0207687_10000226 Ga0207687_1000022612 293
465 3300025927 Ga0207687_10003096 Ga0207687_1000309610 293
466 3300025927 Ga0207687_10443291 Ga0207687_104432911 293
467 3300025928 Ga0207700_10029862 Ga0207700_100298624 293
468 3300025928 Ga0207700_10044625 Ga0207700_100446253 293
469 3300025929 Ga0207664_10009233 Ga0207664_100092337 293
470 3300025931 Ga0207644_10007852 Ga0207644_100078527 293
471 3300025933 Ga0207706_10001944 Ga0207706_1000194413 293
472 3300025934 Ga0207686_10003018 Ga0207686_100030183 293
473 3300025935 Ga0207709_10114981 Ga0207709_101149812 293
474 3300025936 Ga0207670_10035858 Ga0207670_100358582 293
475 3300025936 Ga0207670_10250291 Ga0207670_102502912 293
476 3300025937 Ga0207669_10121511 Ga0207669_101215112 293
477 3300025937 Ga0207669_10279444 Ga0207669_102794442 293
478 3300025938 Ga0207704_10002798 Ga0207704_100027986 293
479 3300025939 Ga0207665_10060503 Ga0207665_100605032 293
480 3300025940 Ga0207691_10062634 Ga0207691_100626342 293
481 3300025940 Ga0207691_10074024 Ga0207691_100740243 293
482 3300025940 Ga0207691_10124161 Ga0207691_101241612 293
483 3300025941 Ga0207711_10000654 Ga0207711_1000065415 293
484 3300025941 Ga0207711_10008005 Ga0207711_100080058 293
485 3300025942 Ga0207689_10001081 Ga0207689_1000108112 293
486 3300025944 Ga0207661_10072017 Ga0207661_100720172 293
487 3300025960 Ga0207651_10052487 Ga0207651_100524872 293
488 3300025960 Ga0207651_10117798 Ga0207651_101177982 293
489 3300025961 Ga0207712_10018508 Ga0207712_100185082 293
490 3300025972 Ga0207668_10002950 Ga0207668_100029506 293
491 3300025981 Ga0207640_10044617 Ga0207640_100446173 293
492 3300025981 Ga0207640_10478336 Ga0207640_104783362 293
493 3300025986 Ga0207658_10006949 Ga0207658_1000694912 293
494 3300025986 Ga0207658_10022771 Ga0207658_100227712 293
495 3300026023 Ga0207677_10000162 Ga0207677_1000016234 293
496 3300026023 Ga0207677_10197178 Ga0207677_101971782 293
497 3300026035 Ga0207703_10001919 Ga0207703_100019192 293
498 3300026035 Ga0207703_10006661 Ga0207703_100066619 293
499 3300026067 Ga0207678_10167518 Ga0207678_101675182 293
500 3300026075 Ga0207708_10036611 Ga0207708_100366112 293
501 3300026088 Ga0207641_10001702 Ga0207641_1000170217 293
502 3300026088 Ga0207641_10014054 Ga0207641_100140542 293
503 3300026089 Ga0207648_10002633 Ga0207648_1000263310 293
504 3300026089 Ga0207648_10008152 Ga0207648_100081524 293
505 3300026089 Ga0207648_10050801 Ga0207648_100508014 293
506 3300026095 Ga0207676_10000451 Ga0207676_1000045124 293
507 3300026095 Ga0207676_10003663 Ga0207676_100036633 293
508 3300026116 Ga0207674_10018325 Ga0207674_100183259 293
509 3300026116 Ga0207674_10026307 Ga0207674_100263072 293
510 3300026118 Ga0207675_100003236 Ga0207675_10000323610 293
511 3300026118 Ga0207675_100013521 Ga0207675_1000135215 293
512 3300027866 Ga0209813_10005461 Ga0209813_100054612 293
513 3300027876 Ga0209974_10006322 Ga0209974_100063223 293
514 3300027907 Ga0207428_10251550 Ga0207428_102515502 293
515 3300028379 Ga0268266_10147323 Ga0268266_101473231 293
516 3300028380 Ga0268265_10003999 Ga0268265_100039999 293
517 3300028380 Ga0268265_10006699 Ga0268265_100066999 293
518 3300028380 Ga0268265_10310188 Ga0268265_103101882 293
519 3300028381 Ga0268264_10001000 Ga0268264_1000100014 293
520 3300028381 Ga0268264_10002760 Ga0268264_100027606 293
521 3300028381 Ga0268264_10049555 Ga0268264_100495552 293
522 3300028786 Ga0307517_10000358 Ga0307517_100003588 293
523 3300028794 Ga0307515_10003649 Ga0307515_1000364931 293
524 3300028794 Ga0307515_10003668 Ga0307515_1000366819 293
525 3300028794 Ga0307515_10009465 Ga0307515_100094659 293
526 3300028794 Ga0307515_10010929 Ga0307515_1001092911 293
527 3300030522 Ga0307512_10055700 Ga0307512_100557002 293
528 3300031238 Ga0265332_10010522 Ga0265332_100105223 293
529 3300031344 Ga0265316_10000632 Ga0265316_1000063220 293
530 3300031456 Ga0307513_10009552 Ga0307513_100095522 293
531 3300031456 Ga0307513_10025822 Ga0307513_100258223 293
532 3300031456 Ga0307513_10076015 Ga0307513_100760154 293
533 3300031456 Ga0307513_10183534 Ga0307513_101835342 293
534 3300031507 Ga0307509_10005213 Ga0307509_1000521310 293
535 3300031507 Ga0307509_10017599 Ga0307509_100175992 293
536 3300031507 Ga0307509_10052291 Ga0307509_100522913 293
537 3300031616 Ga0307508_10000466 Ga0307508_1000046633 293
538 3300031616 Ga0307508_10007101 Ga0307508_100071016 293
539 3300031649 Ga0307514_10000979 Ga0307514_1000097939 293
540 3300031649 Ga0307514_10004420 Ga0307514_100044209 293
541 3300031730 Ga0307516_10023079 Ga0307516_100230797 293
542 3300033179 Ga0307507_10058912 Ga0307507_100589122 293
543 3300035089 Ga0373944_0048338 Ga0373944_0048338_204_1163 293
544 3300035117 Ga0373953_0003327 Ga0373953_0003327_1324_2310 293
545 3300035118 Ga0373954_0027596 Ga0373954_0027596_194_1180 293
546 3300035171 Ga0373946_0019107 Ga0373946_0019107_1244_2203 293
547 3300035172 Ga0373955_0039097 Ga0373955_0039097_260_1246 293
548 3300035172 Ga0373955_0214555 Ga0373955_0214555_222_1103 293
549 3300035692 Ga0373935_0081080 Ga0373935_0081080_193_1074 293
550 3300035692 Ga0373935_0092233 Ga0373935_0092233_98_1084 293
551 3300035695 Ga0373927_0040065 Ga0373927_0040065_448_1407 293
552 3300035724 Ga0373933_0004441 Ga0373933_0004441_5284_6270 293
553 3300035725 Ga0373947_0057524 Ga0373947_0057524_923_1804 293
554 3300036401 Ga0373937_0027808 Ga0373937_0027808_3410_4291 293
555 3300036401 Ga0373937_0102170 Ga0373937_0102170_247_1233 293
556 3300037068 Ga0373925_0052445 Ga0373925_0052445_810_1751 293
557 3300037068 Ga0373925_0054821 Ga0373925_0054821_1321_2280 293
558 3300037068 Ga0373925_0064722 Ga0373925_0064722_998_1879 293
559 3300041512 Ga0451853_3400648 Ga0451853_3400648_23_904 293
560 3300042876 Ga0451577_0102691 Ga0451577_0102691_761_1702 293
561 3300044712 Ga0453684_0006395 Ga0453684_0006395_17404_18285 293
562 3300045051 Ga0451576_0298557 Ga0451576_0298557_563_1504 293
563 3300046472 Ga0495580_0070957 Ga0495580_0070957_1044_2003 293
564 3300046477 Ga0495664_0033908 Ga0495664_0033908_40_1026 293
565 3300046511 Ga0495608_0120732 Ga0495608_0120732_231_1217 293
566 3300046519 Ga0495632_0026840 Ga0495632_0026840_67_948 293
567 3300046519 Ga0495632_0084916 Ga0495632_0084916_480_1361 293
568 3300046524 Ga0495648_0076904 Ga0495648_0076904_195_1076 293
569 3300046543 Ga0495645_0019219 Ga0495645_0019219_895_1821 293
570 3300046660 Ga0495625_0001726 Ga0495625_0001726_19961_20842 293
571 3300046660 Ga0495625_0139522 Ga0495625_0139522_145_1026 293
572 3300046679 Ga0495623_0106309 Ga0495623_0106309_665_1651 293
573 3300047443 Ga0495687_044482 Ga0495687_044482_642_1523 293
574 3300048905 Ga0496102_0038160 Ga0496102_0038160_2507_3388 293
575 3300048907 Ga0496104_0007078 Ga0496104_0007078_5420_6406 293
576 3300048908 Ga0496105_0001968 Ga0496105_0001968_13190_14176 293
577 3300048909 Ga0496106_0188970 Ga0496106_0188970_713_1594 293
578 3300048910 Ga0496107_0143787 Ga0496107_0143787_514_1500 293
579 3300048911 Ga0496108_0017714 Ga0496108_0017714_3470_4351 293
580 3300048913 Ga0496110_0101718 Ga0496110_0101718_311_1192 293
581 3300048915 Ga0496112_0000241 Ga0496112_0000241_13160_14146 293
582 3300048918 Ga0496115_0079611 Ga0496115_0079611_723_1709 293
583 3300050493 nmdc:mga0k408_13359_c1 nmdc:mga0k408_13359_c1_1909_2790 293
584 3300050493 nmdc:mga0k408_51204_c1 nmdc:mga0k408_51204_c1_1332_2213 293
585 3300050494 nmdc:mga06z11_135992_c1 nmdc:mga06z11_135992_c1_440_1321 293
586 3300050494 nmdc:mga06z11_5847_c1 nmdc:mga06z11_5847_c1_2412_3293 293
587 3300050495 nmdc:mga04h51_23644_c1 nmdc:mga04h51_23644_c1_977_1858 293
588 3300050496 nmdc:mga07m45_247_c1 nmdc:mga07m45_247_c1_17775_18656 293
589 3300050496 nmdc:mga07m45_41439_c1 nmdc:mga07m45_41439_c1_548_1429 293
590 3300050511 nmdc:mga08y16_74087_c1 nmdc:mga08y16_74087_c1_2425_3306 293
591 3300053094 Ga0500566_0014401 Ga0500566_0014401_1456_2352 293
592 3300053134 Ga0500658_0022941 Ga0500658_0022941_630_1511 293
593 3300053739 Ga0500587_001176 Ga0500587_001176_818_1699 293
594 3300003316 rootH1_10007111 rootH1_100071117 294
595 3300003322 rootL2_10005678 rootL2_100056787 294
596 3300005328 Ga0070676_10002095 Ga0070676_100020959 294
597 3300005333 Ga0070677_10013640 Ga0070677_100136403 294
598 3300005334 Ga0068869_100230042 Ga0068869_1002300422 294
599 3300005334 Ga0068869_100316416 Ga0068869_1003164162 294
600 3300005338 Ga0068868_100179767 Ga0068868_1001797672 294
601 3300005353 Ga0070669_100345896 Ga0070669_1003458961 294
602 3300005354 Ga0070675_100033406 Ga0070675_1000334064 294
603 3300005456 Ga0070678_100249031 Ga0070678_1002490312 294
604 3300005457 Ga0070662_100060606 Ga0070662_1000606062 294
605 3300005459 Ga0068867_100213831 Ga0068867_1002138312 294
606 3300005467 Ga0070706_100003222 Ga0070706_10000322213 294
607 3300005543 Ga0070672_100190163 Ga0070672_1001901632 294
608 3300005577 Ga0068857_100026898 Ga0068857_1000268986 294
609 3300005577 Ga0068857_100283073 Ga0068857_1002830732 294
610 3300005578 Ga0068854_100095261 Ga0068854_1000952612 294
611 3300005617 Ga0068859_100115911 Ga0068859_1001159112 294
612 3300005841 Ga0068863_100110964 Ga0068863_1001109642 294
613 3300006042 Ga0075368_10018558 Ga0075368_100185582 294
614 3300006178 Ga0075367_10025491 Ga0075367_100254912 294
615 3300006195 Ga0075366_10029487 Ga0075366_100294872 294
616 3300006237 Ga0097621_100345009 Ga0097621_1003450091 294
617 3300006353 Ga0075370_10001742 Ga0075370_100017425 294
618 3300006353 Ga0075370_10079598 Ga0075370_100795982 294
619 3300006931 Ga0097620_100115908 Ga0097620_1001159083 294
620 3300009093 Ga0105240_10030931 Ga0105240_100309318 294
621 3300009098 Ga0105245_10073690 Ga0105245_100736903 294
622 3300009148 Ga0105243_10347556 Ga0105243_103475561 294
623 3300009545 Ga0105237_10044581 Ga0105237_100445815 294
624 3300010375 Ga0105239_10126723 Ga0105239_101267232 294
625 3300011119 Ga0105246_10029964 Ga0105246_100299644 294
626 3300013308 Ga0157375_10031086 Ga0157375_100310867 294
627 3300014745 Ga0157377_10311090 Ga0157377_103110901 294
628 3300025893 Ga0207682_10016029 Ga0207682_100160293 294
629 3300025907 Ga0207645_10001729 Ga0207645_100017295 294
630 3300025908 Ga0207643_10018090 Ga0207643_100180904 294
631 3300025910 Ga0207684_10002424 Ga0207684_100024243 294
632 3300025913 Ga0207695_10107478 Ga0207695_101074783 294
633 3300025914 Ga0207671_10014637 Ga0207671_100146374 294
634 3300025922 Ga0207646_10047710 Ga0207646_100477104 294
635 3300025925 Ga0207650_10038924 Ga0207650_100389242 294
636 3300025927 Ga0207687_10020926 Ga0207687_100209263 294
637 3300025933 Ga0207706_10046447 Ga0207706_100464472 294
638 3300025933 Ga0207706_10109511 Ga0207706_101095112 294
639 3300025940 Ga0207691_10029845 Ga0207691_100298456 294
640 3300025940 Ga0207691_10310597 Ga0207691_103105971 294
641 3300025960 Ga0207651_10001587 Ga0207651_1000158711 294
642 3300025981 Ga0207640_10103978 Ga0207640_101039782 294
643 3300026023 Ga0207677_10020074 Ga0207677_100200745 294
644 3300026088 Ga0207641_10045270 Ga0207641_100452703 294
645 3300026089 Ga0207648_10003584 Ga0207648_1000358411 294
646 3300026116 Ga0207674_10003102 Ga0207674_1000310211 294
647 3300026116 Ga0207674_10019808 Ga0207674_100198087 294
648 3300026121 Ga0207683_10085353 Ga0207683_100853533 294
649 3300031730 Ga0307516_10190063 Ga0307516_101900632 294
650 3300046517 Ga0495630_0058507 Ga0495630_0058507_1949_2833 294
651 3300046530 Ga0495654_0002750 Ga0495654_0002750_5023_5976 294
652 3300046557 Ga0495622_0079260 Ga0495622_0079260_612_1496 294
653 3300046694 Ga0495649_0015742 Ga0495649_0015742_1426_2310 294
654 3300047443 Ga0495687_000212 Ga0495687_000212_35883_36779 294
655 3300050489 nmdc:mga03683_36318_c1 nmdc:mga03683_36318_c1_678_1562 294
656 3300050493 nmdc:mga0k408_20709_c1 nmdc:mga0k408_20709_c1_508_1392 294
657 3300050493 nmdc:mga0k408_37110_c1 nmdc:mga0k408_37110_c1_301_1185 294
658 3300050494 nmdc:mga06z11_14050_c1 nmdc:mga06z11_14050_c1_1369_2253 294
659 3300050494 nmdc:mga06z11_37007_c1 nmdc:mga06z11_37007_c1_393_1277 294
660 3300003215 JGI25153J46596_10004275 JGI25153J46596_100042751 295
661 3300005295 Ga0065707_10087932 Ga0065707_100879322 295
662 3300005354 Ga0070675_100092616 Ga0070675_1000926161 295
663 3300005356 Ga0070674_100099699 Ga0070674_1000996993 295
664 3300005367 Ga0070667_100074494 Ga0070667_1000744943 295
665 3300005539 Ga0068853_100251738 Ga0068853_1002517382 295
666 3300005543 Ga0070672_100091803 Ga0070672_1000918032 295
667 3300005578 Ga0068854_100163922 Ga0068854_1001639222 295
668 3300005843 Ga0068860_100443456 Ga0068860_1004434562 295
669 3300025297 Ga0209758_1000122 Ga0209758_100012260 295
670 3300025901 Ga0207688_10138650 Ga0207688_101386501 295
671 3300025931 Ga0207644_10063586 Ga0207644_100635863 295
672 3300025940 Ga0207691_10003696 Ga0207691_1000369618 295
673 3300025981 Ga0207640_10056692 Ga0207640_100566922 295
674 3300025986 Ga0207658_10079113 Ga0207658_100791133 295
675 3300026035 Ga0207703_10217221 Ga0207703_102172212 295
676 3300026041 Ga0207639_10181280 Ga0207639_101812802 295
677 3300026089 Ga0207648_10035446 Ga0207648_100354464 295
678 3300026118 Ga0207675_100024008 Ga0207675_1000240082 295
679 3300026121 Ga0207683_10172285 Ga0207683_101722853 295
680 3300031730 Ga0307516_10123621 Ga0307516_101236212 295
681 3300041452 Ga0451793_0421724 Ga0451793_0421724_857_1747 295
682 3300046519 Ga0495632_0002891 Ga0495632_0002891_850_1740 295
683 3300048916 Ga0496113_0209016 Ga0496113_0209016_570_1460 295
684 3300053088 Ga0500644_0154548 Ga0500644_0154548_18_908 295
685 3300053090 Ga0500646_0001709 Ga0500646_0001709_4537_5427 295
686 3300053092 Ga0500583_0051795 Ga0500583_0051795_796_1686 295
687 3300053098 Ga0500650_0033793 Ga0500650_0033793_843_1733 295
688 3300053131 Ga0500652_001537 Ga0500652_001537_5162_6052 295
689 3300053151 Ga0500604_0005487 Ga0500604_0005487_250_1140 295
690 3300053156 Ga0500622_0001110 Ga0500622_0001110_5636_6526 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14696

Glyoxalase_5

Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal

63

200

0.99

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

216

337

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x8e-assembly1.cif.gz_A crystal structure of pfhppd-y13287 complex 0.8384 15 295
7x8e-assembly3.cif.gz_D-3 crystal structure of pfhppd-y13287 complex 0.8358 15 295
7xnt-assembly1.cif.gz_B crystal structure of pfhppd-y13161 complex 0.8345 15 295
7x8e-assembly2.cif.gz_B crystal structure of pfhppd-y13287 complex 0.8337 15 295
7xnt-assembly1.cif.gz_C crystal structure of pfhppd-y13161 complex 0.8315 15 295
ID Description Score Start End Superfamily
1cjxD01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9038 15 159 3.10.180.10
1cjxD01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8697 15 159 3.10.180.10
2r5vB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7714 19 151 3.10.180.10
3zgjA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7535 165 289 3.10.180.10
2r5vB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7458 19 151 3.10.180.10
ID Description Score Start End GO Terms
AF-N6Z3L8-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9704 20 290 GO:0046872
GO:0051213
AF-K2ELF4-F1-model_v4 VOC domain-containing protein 0.9554 118 290
AF-A0A1F4B8T9-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase 0.9498 4 290 GO:0051213
AF-A0A4Q5X6D5-F1-model_v4 deleted 0.9486 101 294
AF-W8X881-F1-model_v4 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) 0.9474 17 295 GO:0003868

Feature Viewer

pLDDT pTM Quality
86.23 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map