F475452
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 339 | 677 | 296 |
Family's Representative Sequence
| Representative Sequence | 3300025900|Ga0207710_10043600|Ga0207710_100436001 |
| Length | 343 |
| Sequence | MQRRSAPMPGMLYHLIGDFPGKRVVAASLRDGARRCPWQWHKEGIVTEGIVTQTSDRELIAGAANPLGMDGIEFVEFSTSKPQALGQVLEMIGFHPIARHRSREVLLYRQGDMNVIVNAHAGGQARASPPSEIPTIAAFALRVRDAATAYRHAIDRGAWIVPSQVEVMELNIPAIHGVGASRIYFVDRYRDFSIYDVDFTLNPGVDAHPPALADMHWFGLVQYIGSDRMEDWTEFYETLFGFTALPDEQRYGILPKGRILLGPCGGFHLQLIDPKPGIFDIEPQESLQRIGFGTPDVLSAVRTLRQRGIGFVESQDVHSEARGALTQPYLGGVMFELVHDERR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 5 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 6 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 7 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 8 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 9 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 10 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 11 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 12 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 13 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 28 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 96 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 203 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 216 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 217 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 224 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 238 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 239 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 253 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 256 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 257 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 258 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 259 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 260 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 261 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 262 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 263 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 264 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 265 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 268 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 269 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 301 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 302 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 307 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 308 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 315 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 318 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 324 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 326 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 327 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 328 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 329 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 330 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 331 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 332 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 334 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 335 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 336 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 337 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 338 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 339 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.12 |
| Metatranscriptomes | 0 |
| Isolates | 1.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.28 |
| Nodule | 0.29 |
| Rhizoplane | 2.75 |
| Rhizosphere | 79.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10004275 | 3300003215 | Bacteria | 7724 |
| 2 | rootH1_10007111 | 3300003316 | Bacteria | 6114 |
| 3 | rootL2_10005678 | 3300003322 | Bacteria | 4807 |
| 4 | rootL2_10103817 | 3300003322 | Bacteria | 4747 |
| 5 | Ga0055524_1000079 | 3300003775 | Bacteria | 120203 |
| 6 | Ga0055530_10005160 | 3300003791 | Bacteria | 6366 |
| 7 | Ga0055540_1000004 | 3300003792 | Bacteria | 395545 |
| 8 | Ga0055531_10014357 | 3300003794 | Bacteria | 3570 |
| 9 | Ga0065707_10087932 | 3300005295 | Bacteria | 4840 |
| 10 | Ga0070676_10002095 | 3300005328 | Bacteria | 10149 |
| 11 | Ga0070676_10012793 | 3300005328 | Bacteria | 4591 |
| 12 | Ga0070683_100239441 | 3300005329 | Bacteria | 1726 |
| 13 | Ga0070690_100000663 | 3300005330 | Bacteria | 17521 |
| 14 | Ga0070670_100008053 | 3300005331 | Bacteria | 8967 |
| 15 | Ga0070670_100017699 | 3300005331 | Bacteria | 6113 |
| 16 | Ga0070670_100029077 | 3300005331 | Bacteria | 4755 |
| 17 | Ga0070670_100080848 | 3300005331 | Bacteria | 2793 |
| 18 | Ga0070677_10013640 | 3300005333 | Bacteria | 2847 |
| 19 | Ga0068869_100000481 | 3300005334 | Bacteria | 22080 |
| 20 | Ga0068869_100075037 | 3300005334 | Bacteria | 2512 |
| 21 | Ga0068869_100125862 | 3300005334 | Bacteria | 1965 |
| 22 | Ga0068869_100230042 | 3300005334 | Bacteria | 1473 |
| 23 | Ga0068869_100316416 | 3300005334 | Bacteria | 1265 |
| 24 | Ga0070666_10000745 | 3300005335 | Bacteria | 19736 |
| 25 | Ga0070680_100049561 | 3300005336 | Bacteria | 3424 |
| 26 | Ga0070680_100332264 | 3300005336 | Bacteria | 1291 |
| 27 | Ga0068868_100000971 | 3300005338 | Bacteria | 19511 |
| 28 | Ga0068868_100065210 | 3300005338 | Bacteria | 2893 |
| 29 | Ga0068868_100179767 | 3300005338 | Bacteria | 1754 |
| 30 | Ga0068868_100200106 | 3300005338 | Unclassified | 1665 |
| 31 | Ga0068868_100318724 | 3300005338 | Bacteria | 1324 |
| 32 | Ga0068868_100411250 | 3300005338 | Bacteria | 1169 |
| 33 | Ga0070660_100025436 | 3300005339 | Bacteria | 4400 |
| 34 | Ga0070660_100083033 | 3300005339 | Bacteria | 2516 |
| 35 | Ga0070660_100455486 | 3300005339 | Bacteria | 1062 |
| 36 | Ga0070689_100002088 | 3300005340 | Bacteria | 12972 |
| 37 | Ga0070689_100019245 | 3300005340 | Bacteria | 5046 |
| 38 | Ga0070689_100228338 | 3300005340 | Bacteria | 1529 |
| 39 | Ga0070661_100007008 | 3300005344 | Bacteria | 7775 |
| 40 | Ga0070661_100057524 | 3300005344 | Bacteria | 2849 |
| 41 | Ga0070692_10019480 | 3300005345 | Bacteria | 3275 |
| 42 | Ga0070668_100033478 | 3300005347 | Bacteria | 3914 |
| 43 | Ga0070668_100049482 | 3300005347 | Bacteria | 3233 |
| 44 | Ga0070668_100062380 | 3300005347 | Bacteria | 2888 |
| 45 | Ga0070668_100417237 | 3300005347 | Bacteria | 1149 |
| 46 | Ga0070669_100004947 | 3300005353 | Bacteria | 9626 |
| 47 | Ga0070669_100053187 | 3300005353 | Bacteria | 2964 |
| 48 | Ga0070669_100063154 | 3300005353 | Bacteria | 2725 |
| 49 | Ga0070669_100122721 | 3300005353 | Bacteria | 1984 |
| 50 | Ga0070669_100345896 | 3300005353 | Bacteria | 1206 |
| 51 | Ga0070669_100417334 | 3300005353 | Bacteria | 1101 |
| 52 | Ga0070675_100030891 | 3300005354 | Bacteria | 4327 |
| 53 | Ga0070675_100033406 | 3300005354 | Bacteria | 4171 |
| 54 | Ga0070675_100092616 | 3300005354 | Bacteria | 2534 |
| 55 | Ga0070671_100001053 | 3300005355 | Bacteria | 20340 |
| 56 | Ga0070671_100002310 | 3300005355 | Bacteria | 14715 |
| 57 | Ga0070671_100007296 | 3300005355 | Bacteria | 8829 |
| 58 | Ga0070671_100196745 | 3300005355 | Bacteria | 1709 |
| 59 | Ga0070671_100541423 | 3300005355 | Bacteria | 1003 |
| 60 | Ga0070674_100057087 | 3300005356 | Bacteria | 2709 |
| 61 | Ga0070674_100099699 | 3300005356 | Bacteria | 2114 |
| 62 | Ga0070673_100007976 | 3300005364 | Bacteria | 7016 |
| 63 | Ga0070673_100026546 | 3300005364 | Bacteria | 4279 |
| 64 | Ga0070673_100073518 | 3300005364 | Bacteria | 2752 |
| 65 | Ga0070673_100211783 | 3300005364 | Bacteria | 1674 |
| 66 | Ga0070688_100002954 | 3300005365 | Bacteria | 8666 |
| 67 | Ga0070688_100267709 | 3300005365 | Bacteria | 1223 |
| 68 | Ga0070659_100003296 | 3300005366 | Bacteria | 11497 |
| 69 | Ga0070659_100086147 | 3300005366 | Bacteria | 2513 |
| 70 | Ga0070659_100090741 | 3300005366 | Bacteria | 2449 |
| 71 | Ga0070667_100001469 | 3300005367 | Bacteria | 21118 |
| 72 | Ga0070667_100004231 | 3300005367 | Bacteria | 12120 |
| 73 | Ga0070667_100020817 | 3300005367 | Bacteria | 5448 |
| 74 | Ga0070667_100074494 | 3300005367 | Bacteria | 2896 |
| 75 | Ga0070667_100282042 | 3300005367 | Bacteria | 1492 |
| 76 | Ga0070709_10077929 | 3300005434 | Bacteria | 2155 |
| 77 | Ga0070714_100052026 | 3300005435 | Bacteria | 3493 |
| 78 | Ga0070713_100003384 | 3300005436 | Bacteria | 10534 |
| 79 | Ga0070713_100216577 | 3300005436 | Bacteria | 1736 |
| 80 | Ga0070701_10007050 | 3300005438 | Bacteria | 4771 |
| 81 | Ga0070711_100004626 | 3300005439 | Bacteria | 8146 |
| 82 | Ga0070705_100004377 | 3300005440 | Bacteria | 6877 |
| 83 | Ga0070705_100114283 | 3300005440 | Unclassified | 1731 |
| 84 | Ga0070700_100060479 | 3300005441 | Bacteria | 2388 |
| 85 | Ga0070694_100025464 | 3300005444 | Bacteria | 3827 |
| 86 | Ga0070708_100000792 | 3300005445 | Bacteria | 23848 |
| 87 | Ga0070708_100031577 | 3300005445 | Bacteria | 4585 |
| 88 | Ga0070708_100309855 | 3300005445 | Bacteria | 1487 |
| 89 | Ga0070663_100021054 | 3300005455 | Bacteria | 4330 |
| 90 | Ga0070678_100249031 | 3300005456 | Bacteria | 1489 |
| 91 | Ga0070662_100001177 | 3300005457 | Bacteria | 16048 |
| 92 | Ga0070662_100060606 | 3300005457 | Bacteria | 2760 |
| 93 | Ga0070681_10076070 | 3300005458 | Bacteria | 3316 |
| 94 | Ga0070681_10193585 | 3300005458 | Bacteria | 1953 |
| 95 | Ga0068867_100000114 | 3300005459 | Bacteria | 51011 |
| 96 | Ga0068867_100003168 | 3300005459 | Bacteria | 11602 |
| 97 | Ga0068867_100007271 | 3300005459 | Bacteria | 7832 |
| 98 | Ga0068867_100121786 | 3300005459 | Bacteria | 2017 |
| 99 | Ga0068867_100213831 | 3300005459 | Bacteria | 1550 |
| 100 | Ga0070685_10011495 | 3300005466 | Bacteria | 4634 |
| 101 | Ga0070706_100003222 | 3300005467 | Bacteria | 16122 |
| 102 | Ga0070707_100184969 | 3300005468 | Bacteria | 2031 |
| 103 | Ga0070698_100448861 | 3300005471 | Bacteria | 1225 |
| 104 | Ga0070699_100258697 | 3300005518 | Bacteria | 1556 |
| 105 | Ga0070679_100037311 | 3300005530 | Bacteria | 4826 |
| 106 | Ga0070684_100169006 | 3300005535 | Bacteria | 1986 |
| 107 | Ga0070697_100149793 | 3300005536 | Bacteria | 1966 |
| 108 | Ga0068853_100002005 | 3300005539 | Bacteria | 15041 |
| 109 | Ga0068853_100011875 | 3300005539 | Bacteria | 7082 |
| 110 | Ga0068853_100251738 | 3300005539 | Bacteria | 1621 |
| 111 | Ga0068853_100286500 | 3300005539 | Bacteria | 1519 |
| 112 | Ga0070672_100083034 | 3300005543 | Bacteria | 2571 |
| 113 | Ga0070672_100091803 | 3300005543 | Bacteria | 2450 |
| 114 | Ga0070672_100094808 | 3300005543 | Bacteria | 2413 |
| 115 | Ga0070672_100121904 | 3300005543 | Bacteria | 2135 |
| 116 | Ga0070672_100190163 | 3300005543 | Bacteria | 1713 |
| 117 | Ga0070672_100199499 | 3300005543 | Bacteria | 1673 |
| 118 | Ga0070686_100087863 | 3300005544 | Bacteria | 2073 |
| 119 | Ga0070696_100069276 | 3300005546 | Bacteria | 2478 |
| 120 | Ga0070693_100016671 | 3300005547 | Bacteria | 3806 |
| 121 | Ga0070693_100098940 | 3300005547 | Bacteria | 1773 |
| 122 | Ga0070693_100208420 | 3300005547 | Bacteria | 1274 |
| 123 | Ga0070665_100001402 | 3300005548 | Bacteria | 28337 |
| 124 | Ga0070665_100007136 | 3300005548 | Bacteria | 11361 |
| 125 | Ga0070665_100158672 | 3300005548 | Bacteria | 2263 |
| 126 | Ga0070665_100499930 | 3300005548 | Bacteria | 1227 |
| 127 | Ga0070704_100278957 | 3300005549 | Bacteria | 1384 |
| 128 | Ga0068855_100003898 | 3300005563 | Bacteria | 18217 |
| 129 | Ga0068855_100118801 | 3300005563 | Bacteria | 3027 |
| 130 | Ga0068855_100129567 | 3300005563 | Bacteria | 2882 |
| 131 | Ga0068855_100154798 | 3300005563 | Bacteria | 2605 |
| 132 | Ga0070664_100023803 | 3300005564 | Bacteria | 5059 |
| 133 | Ga0070664_100184031 | 3300005564 | Bacteria | 1858 |
| 134 | Ga0068857_100007102 | 3300005577 | Bacteria | 9645 |
| 135 | Ga0068857_100026898 | 3300005577 | Bacteria | 5072 |
| 136 | Ga0068857_100283073 | 3300005577 | Bacteria | 1525 |
| 137 | Ga0068857_100451502 | 3300005577 | Bacteria | 1202 |
| 138 | Ga0068854_100047229 | 3300005578 | Bacteria | 3068 |
| 139 | Ga0068854_100095261 | 3300005578 | Bacteria | 2222 |
| 140 | Ga0068854_100161072 | 3300005578 | Bacteria | 1738 |
| 141 | Ga0068854_100163922 | 3300005578 | Bacteria | 1724 |
| 142 | Ga0068856_100001796 | 3300005614 | Bacteria | 22411 |
| 143 | Ga0068856_100171183 | 3300005614 | Bacteria | 2184 |
| 144 | Ga0070702_100010808 | 3300005615 | Bacteria | 4514 |
| 145 | Ga0070702_100109450 | 3300005615 | Bacteria | 1710 |
| 146 | Ga0070702_100262853 | 3300005615 | Bacteria | 1176 |
| 147 | Ga0068852_100110416 | 3300005616 | Bacteria | 2499 |
| 148 | Ga0068852_100212494 | 3300005616 | Bacteria | 1836 |
| 149 | Ga0068859_100000893 | 3300005617 | Bacteria | 30367 |
| 150 | Ga0068859_100001169 | 3300005617 | Bacteria | 26837 |
| 151 | Ga0068859_100115911 | 3300005617 | Bacteria | 2744 |
| 152 | Ga0068859_100340151 | 3300005617 | Bacteria | 1595 |
| 153 | Ga0068859_100430372 | 3300005617 | Bacteria | 1416 |
| 154 | Ga0068864_100001446 | 3300005618 | Bacteria | 19579 |
| 155 | Ga0068864_100002752 | 3300005618 | Bacteria | 14500 |
| 156 | Ga0068864_100009929 | 3300005618 | Bacteria | 7852 |
| 157 | Ga0068866_10022409 | 3300005718 | Bacteria | 2923 |
| 158 | Ga0068866_10058754 | 3300005718 | Bacteria | 1987 |
| 159 | Ga0068866_10170551 | 3300005718 | Bacteria | 1277 |
| 160 | Ga0068861_100001611 | 3300005719 | Bacteria | 14383 |
| 161 | Ga0068861_100002388 | 3300005719 | Bacteria | 12231 |
| 162 | Ga0068861_100133512 | 3300005719 | Bacteria | 2017 |
| 163 | Ga0068861_100225580 | 3300005719 | Bacteria | 1586 |
| 164 | Ga0068861_100272877 | 3300005719 | Bacteria | 1453 |
| 165 | Ga0068870_10022611 | 3300005840 | Bacteria | 3091 |
| 166 | Ga0068870_10071014 | 3300005840 | Bacteria | 1899 |
| 167 | Ga0068863_100000521 | 3300005841 | Bacteria | 39214 |
| 168 | Ga0068863_100003595 | 3300005841 | Bacteria | 15301 |
| 169 | Ga0068863_100027188 | 3300005841 | Bacteria | 5456 |
| 170 | Ga0068863_100110964 | 3300005841 | Bacteria | 2612 |
| 171 | Ga0068863_100158509 | 3300005841 | Bacteria | 2167 |
| 172 | Ga0068858_100003010 | 3300005842 | Bacteria | 16901 |
| 173 | Ga0068858_100012873 | 3300005842 | Bacteria | 7889 |
| 174 | Ga0068858_100275380 | 3300005842 | Bacteria | 1602 |
| 175 | Ga0068860_100001084 | 3300005843 | Bacteria | 30014 |
| 176 | Ga0068860_100003063 | 3300005843 | Bacteria | 17272 |
| 177 | Ga0068860_100005415 | 3300005843 | Bacteria | 12950 |
| 178 | Ga0068860_100198079 | 3300005843 | Bacteria | 1946 |
| 179 | Ga0068860_100281001 | 3300005843 | Bacteria | 1627 |
| 180 | Ga0068860_100443456 | 3300005843 | Bacteria | 1290 |
| 181 | Ga0068862_100013035 | 3300005844 | Bacteria | 6877 |
| 182 | Ga0068862_100025057 | 3300005844 | Bacteria | 5007 |
| 183 | Ga0075365_10041051 | 3300006038 | Bacteria | 3020 |
| 184 | Ga0075368_10018558 | 3300006042 | Bacteria | 2615 |
| 185 | Ga0075368_10112944 | 3300006042 | Bacteria | 1121 |
| 186 | Ga0075364_10243040 | 3300006051 | Bacteria | 1223 |
| 187 | Ga0070716_100005733 | 3300006173 | Bacteria | 6032 |
| 188 | Ga0070712_100014560 | 3300006175 | Bacteria | 5048 |
| 189 | Ga0075367_10025491 | 3300006178 | Bacteria | 3345 |
| 190 | Ga0075367_10033023 | 3300006178 | Bacteria | 2981 |
| 191 | Ga0075367_10044392 | 3300006178 | Bacteria | 2605 |
| 192 | Ga0075366_10000810 | 3300006195 | Bacteria | 14996 |
| 193 | Ga0075366_10002594 | 3300006195 | Bacteria | 9288 |
| 194 | Ga0075366_10011317 | 3300006195 | Bacteria | 5035 |
| 195 | Ga0075366_10016722 | 3300006195 | Bacteria | 4217 |
| 196 | Ga0075366_10029487 | 3300006195 | Bacteria | 3223 |
| 197 | Ga0075366_10037164 | 3300006195 | Bacteria | 2873 |
| 198 | Ga0075366_10041574 | 3300006195 | Bacteria | 2722 |
| 199 | Ga0097621_100014273 | 3300006237 | Bacteria | 5941 |
| 200 | Ga0097621_100345009 | 3300006237 | Bacteria | 1323 |
| 201 | Ga0075370_10001742 | 3300006353 | Bacteria | 9690 |
| 202 | Ga0075370_10002345 | 3300006353 | Bacteria | 8754 |
| 203 | Ga0075370_10079598 | 3300006353 | Bacteria | 1882 |
| 204 | Ga0075370_10147441 | 3300006353 | Bacteria | 1378 |
| 205 | Ga0075370_10207202 | 3300006353 | Bacteria | 1157 |
| 206 | Ga0068871_100017564 | 3300006358 | Bacteria | 5417 |
| 207 | Ga0075428_100012423 | 3300006844 | Bacteria | 9472 |
| 208 | Ga0075428_100548448 | 3300006844 | Bacteria | 1236 |
| 209 | Ga0075430_100087012 | 3300006846 | Bacteria | 2615 |
| 210 | Ga0075434_100757284 | 3300006871 | Unclassified | 988 |
| 211 | Ga0068865_100003419 | 3300006881 | Bacteria | 9497 |
| 212 | Ga0075436_100030838 | 3300006914 | Bacteria | 3690 |
| 213 | Ga0097620_100000893 | 3300006931 | Bacteria | 30367 |
| 214 | Ga0097620_100001169 | 3300006931 | Bacteria | 26837 |
| 215 | Ga0097620_100115908 | 3300006931 | Bacteria | 2744 |
| 216 | Ga0097620_100340139 | 3300006931 | Bacteria | 1595 |
| 217 | Ga0097620_100430429 | 3300006931 | Bacteria | 1416 |
| 218 | Ga0079104_1000352 | 3300006946 | Bacteria | 55479 |
| 219 | Ga0105240_10027731 | 3300009093 | Bacteria | 7412 |
| 220 | Ga0105240_10030931 | 3300009093 | Bacteria | 6952 |
| 221 | Ga0105240_10038834 | 3300009093 | Bacteria | 6103 |
| 222 | Ga0111539_10021763 | 3300009094 | Bacteria | 7883 |
| 223 | Ga0111539_10092046 | 3300009094 | Bacteria | 3563 |
| 224 | Ga0111539_10154655 | 3300009094 | Bacteria | 2684 |
| 225 | Ga0105245_10001644 | 3300009098 | Bacteria | 20337 |
| 226 | Ga0105245_10007857 | 3300009098 | Bacteria | 9331 |
| 227 | Ga0105245_10057243 | 3300009098 | Bacteria | 3506 |
| 228 | Ga0105245_10073690 | 3300009098 | Bacteria | 3105 |
| 229 | Ga0105247_10064396 | 3300009101 | Bacteria | 2277 |
| 230 | Ga0105247_10200821 | 3300009101 | Bacteria | 1340 |
| 231 | Ga0114129_10321911 | 3300009147 | Bacteria | 2055 |
| 232 | Ga0114129_10697670 | 3300009147 | Bacteria | 1305 |
| 233 | Ga0105243_10014110 | 3300009148 | Bacteria | 6044 |
| 234 | Ga0105243_10347556 | 3300009148 | Bacteria | 1361 |
| 235 | Ga0105241_10067553 | 3300009174 | Bacteria | 2767 |
| 236 | Ga0105241_10154351 | 3300009174 | Bacteria | 1881 |
| 237 | Ga0105248_10008045 | 3300009177 | Bacteria | 11575 |
| 238 | Ga0105248_10013123 | 3300009177 | Bacteria | 9124 |
| 239 | Ga0105248_10035492 | 3300009177 | Bacteria | 5577 |
| 240 | Ga0105237_10000076 | 3300009545 | Bacteria | 131773 |
| 241 | Ga0105237_10016342 | 3300009545 | Bacteria | 7713 |
| 242 | Ga0105237_10044581 | 3300009545 | Bacteria | 4466 |
| 243 | Ga0105238_10007384 | 3300009551 | Bacteria | 11012 |
| 244 | Ga0105249_10109533 | 3300009553 | Bacteria | 2609 |
| 245 | Ga0105239_10008182 | 3300010375 | Bacteria | 11927 |
| 246 | Ga0105239_10126723 | 3300010375 | Bacteria | 2838 |
| 247 | Ga0105239_10817732 | 3300010375 | Bacteria | 1068 |
| 248 | Ga0105246_10029964 | 3300011119 | Bacteria | 3589 |
| 249 | Ga0157373_10006303 | 3300013100 | Bacteria | 8864 |
| 250 | Ga0157371_10000194 | 3300013102 | Bacteria | 90011 |
| 251 | Ga0157370_10013405 | 3300013104 | Bacteria | 8445 |
| 252 | Ga0157369_10303625 | 3300013105 | Bacteria | 1660 |
| 253 | Ga0157374_10002838 | 3300013296 | Bacteria | 14535 |
| 254 | Ga0157378_10001679 | 3300013297 | Bacteria | 19946 |
| 255 | Ga0157378_10005473 | 3300013297 | Bacteria | 11126 |
| 256 | Ga0157378_10094210 | 3300013297 | Bacteria | 2727 |
| 257 | Ga0157378_10505201 | 3300013297 | Bacteria | 1208 |
| 258 | Ga0163162_10001712 | 3300013306 | Bacteria | 20568 |
| 259 | Ga0163162_10001908 | 3300013306 | Bacteria | 19644 |
| 260 | Ga0163162_10118849 | 3300013306 | Bacteria | 2745 |
| 261 | Ga0157372_10005627 | 3300013307 | Bacteria | 13324 |
| 262 | Ga0157375_10019566 | 3300013308 | Bacteria | 6162 |
| 263 | Ga0157375_10025955 | 3300013308 | Bacteria | 5454 |
| 264 | Ga0157375_10031086 | 3300013308 | Bacteria | 5041 |
| 265 | Ga0157375_10161320 | 3300013308 | Bacteria | 2384 |
| 266 | Ga0157375_10228948 | 3300013308 | Bacteria | 2018 |
| 267 | Ga0157375_10298682 | 3300013308 | Bacteria | 1774 |
| 268 | Ga0157375_10400246 | 3300013308 | Bacteria | 1540 |
| 269 | Ga0163163_10009939 | 3300014325 | Bacteria | 8532 |
| 270 | Ga0163163_10311104 | 3300014325 | Bacteria | 1628 |
| 271 | Ga0157380_10000875 | 3300014326 | Bacteria | 18931 |
| 272 | Ga0157380_10071614 | 3300014326 | Bacteria | 2805 |
| 273 | Ga0157380_10076760 | 3300014326 | Bacteria | 2720 |
| 274 | Ga0157380_10427889 | 3300014326 | Bacteria | 1264 |
| 275 | Ga0157377_10000016 | 3300014745 | Bacteria | 190613 |
| 276 | Ga0157377_10104944 | 3300014745 | Bacteria | 1690 |
| 277 | Ga0157377_10311090 | 3300014745 | Bacteria | 1043 |
| 278 | Ga0157379_10001362 | 3300014968 | Bacteria | 20016 |
| 279 | Ga0157379_10002571 | 3300014968 | Bacteria | 15232 |
| 280 | Ga0157379_10025337 | 3300014968 | Bacteria | 5269 |
| 281 | Ga0157379_10066080 | 3300014968 | Bacteria | 3233 |
| 282 | Ga0157379_10102095 | 3300014968 | Bacteria | 2574 |
| 283 | Ga0157376_10001750 | 3300014969 | Bacteria | 14458 |
| 284 | Ga0157376_10033776 | 3300014969 | Bacteria | 4123 |
| 285 | Ga0157376_10707566 | 3300014969 | Bacteria | 1013 |
| 286 | Ga0163161_10020125 | 3300017792 | Bacteria | 4680 |
| 287 | Ga0209676_1043215 | 3300025292 | Bacteria | 1245 |
| 288 | Ga0209758_1000122 | 3300025297 | Bacteria | 190970 |
| 289 | Ga0209050_1000677 | 3300025298 | Bacteria | 51357 |
| 290 | Ga0209050_1028295 | 3300025298 | Bacteria | 1822 |
| 291 | Ga0209256_1000011 | 3300025299 | Bacteria | 865309 |
| 292 | Ga0209051_1000016 | 3300025303 | Bacteria | 541891 |
| 293 | Ga0209257_1000102 | 3300025304 | Bacteria | 251074 |
| 294 | Ga0207656_10133863 | 3300025321 | Bacteria | 1163 |
| 295 | Ga0207682_10016029 | 3300025893 | Bacteria | 2920 |
| 296 | Ga0207642_10089583 | 3300025899 | Bacteria | 1516 |
| 297 | Ga0207710_10043600 | 3300025900 | Bacteria | 1996 |
| 298 | Ga0207710_10074938 | 3300025900 | Bacteria | 1559 |
| 299 | Ga0207688_10138650 | 3300025901 | Bacteria | 1430 |
| 300 | Ga0207688_10261430 | 3300025901 | Bacteria | 1050 |
| 301 | Ga0207680_10000783 | 3300025903 | Bacteria | 15039 |
| 302 | Ga0207680_10039758 | 3300025903 | Bacteria | 2732 |
| 303 | Ga0207680_10301950 | 3300025903 | Bacteria | 1116 |
| 304 | Ga0207685_10170595 | 3300025905 | Unclassified | 1001 |
| 305 | Ga0207699_10078508 | 3300025906 | Bacteria | 2039 |
| 306 | Ga0207699_10361416 | 3300025906 | Unclassified | 1027 |
| 307 | Ga0207645_10001729 | 3300025907 | Bacteria | 17698 |
| 308 | Ga0207645_10045451 | 3300025907 | Bacteria | 2806 |
| 309 | Ga0207645_10046267 | 3300025907 | Bacteria | 2779 |
| 310 | Ga0207643_10018090 | 3300025908 | Bacteria | 3861 |
| 311 | Ga0207643_10032638 | 3300025908 | Bacteria | 2909 |
| 312 | Ga0207643_10079987 | 3300025908 | Bacteria | 1893 |
| 313 | Ga0207684_10002424 | 3300025910 | Bacteria | 18808 |
| 314 | Ga0207654_10137587 | 3300025911 | Bacteria | 1553 |
| 315 | Ga0207707_10069217 | 3300025912 | Bacteria | 3076 |
| 316 | Ga0207707_10427262 | 3300025912 | Bacteria | 1135 |
| 317 | Ga0207695_10021153 | 3300025913 | Bacteria | 7431 |
| 318 | Ga0207695_10029322 | 3300025913 | Bacteria | 6083 |
| 319 | Ga0207695_10107478 | 3300025913 | Bacteria | 2775 |
| 320 | Ga0207671_10005377 | 3300025914 | Bacteria | 11831 |
| 321 | Ga0207671_10014637 | 3300025914 | Bacteria | 6189 |
| 322 | Ga0207693_10001071 | 3300025915 | Bacteria | 24521 |
| 323 | Ga0207663_10246971 | 3300025916 | Bacteria | 1312 |
| 324 | Ga0207663_10280088 | 3300025916 | Bacteria | 1238 |
| 325 | Ga0207660_10060768 | 3300025917 | Bacteria | 2718 |
| 326 | Ga0207662_10032204 | 3300025918 | Bacteria | 3050 |
| 327 | Ga0207662_10051405 | 3300025918 | Bacteria | 2452 |
| 328 | Ga0207657_10003940 | 3300025919 | Bacteria | 15763 |
| 329 | Ga0207657_10022507 | 3300025919 | Bacteria | 5894 |
| 330 | Ga0207657_10041190 | 3300025919 | Bacteria | 4085 |
| 331 | Ga0207649_10001247 | 3300025920 | Bacteria | 15210 |
| 332 | Ga0207649_10057355 | 3300025920 | Bacteria | 2435 |
| 333 | Ga0207652_10145470 | 3300025921 | Bacteria | 2121 |
| 334 | Ga0207646_10047710 | 3300025922 | Bacteria | 3841 |
| 335 | Ga0207681_10008779 | 3300025923 | Bacteria | 6175 |
| 336 | Ga0207694_10011637 | 3300025924 | Bacteria | 6639 |
| 337 | Ga0207650_10008631 | 3300025925 | Bacteria | 6958 |
| 338 | Ga0207650_10011427 | 3300025925 | Bacteria | 6112 |
| 339 | Ga0207650_10024159 | 3300025925 | Bacteria | 4318 |
| 340 | Ga0207650_10038924 | 3300025925 | Bacteria | 3475 |
| 341 | Ga0207650_10043358 | 3300025925 | Bacteria | 3302 |
| 342 | Ga0207659_10008305 | 3300025926 | Bacteria | 6438 |
| 343 | Ga0207687_10000226 | 3300025927 | Bacteria | 38452 |
| 344 | Ga0207687_10003096 | 3300025927 | Bacteria | 11280 |
| 345 | Ga0207687_10020926 | 3300025927 | Bacteria | 4342 |
| 346 | Ga0207687_10042968 | 3300025927 | Bacteria | 3113 |
| 347 | Ga0207687_10443291 | 3300025927 | Bacteria | 1076 |
| 348 | Ga0207700_10029862 | 3300025928 | Bacteria | 3852 |
| 349 | Ga0207700_10044625 | 3300025928 | Bacteria | 3265 |
| 350 | Ga0207664_10009233 | 3300025929 | Bacteria | 6910 |
| 351 | Ga0207644_10001985 | 3300025931 | Bacteria | 13227 |
| 352 | Ga0207644_10007852 | 3300025931 | Bacteria | 6970 |
| 353 | Ga0207644_10044136 | 3300025931 | Bacteria | 3166 |
| 354 | Ga0207644_10058835 | 3300025931 | Bacteria | 2778 |
| 355 | Ga0207644_10063586 | 3300025931 | Bacteria | 2680 |
| 356 | Ga0207690_10006609 | 3300025932 | Bacteria | 6868 |
| 357 | Ga0207690_10066524 | 3300025932 | Bacteria | 2468 |
| 358 | Ga0207706_10000002 | 3300025933 | Bacteria | 360309 |
| 359 | Ga0207706_10001944 | 3300025933 | Bacteria | 20292 |
| 360 | Ga0207706_10046447 | 3300025933 | Bacteria | 3844 |
| 361 | Ga0207706_10093004 | 3300025933 | Bacteria | 2652 |
| 362 | Ga0207706_10109511 | 3300025933 | Bacteria | 2431 |
| 363 | Ga0207686_10003018 | 3300025934 | Bacteria | 9072 |
| 364 | Ga0207709_10052527 | 3300025935 | Bacteria | 2504 |
| 365 | Ga0207709_10114981 | 3300025935 | Bacteria | 1806 |
| 366 | Ga0207670_10031264 | 3300025936 | Bacteria | 3409 |
| 367 | Ga0207670_10035858 | 3300025936 | Bacteria | 3221 |
| 368 | Ga0207670_10250291 | 3300025936 | Bacteria | 1369 |
| 369 | Ga0207669_10121511 | 3300025937 | Bacteria | 1774 |
| 370 | Ga0207669_10279444 | 3300025937 | Bacteria | 1258 |
| 371 | Ga0207669_10292471 | 3300025937 | Bacteria | 1234 |
| 372 | Ga0207704_10002798 | 3300025938 | Bacteria | 7868 |
| 373 | Ga0207665_10060503 | 3300025939 | Bacteria | 2565 |
| 374 | Ga0207691_10003696 | 3300025940 | Bacteria | 14837 |
| 375 | Ga0207691_10029845 | 3300025940 | Bacteria | 5099 |
| 376 | Ga0207691_10062634 | 3300025940 | Bacteria | 3374 |
| 377 | Ga0207691_10074024 | 3300025940 | Bacteria | 3072 |
| 378 | Ga0207691_10075440 | 3300025940 | Bacteria | 3040 |
| 379 | Ga0207691_10124161 | 3300025940 | Bacteria | 2285 |
| 380 | Ga0207691_10310597 | 3300025940 | Bacteria | 1353 |
| 381 | Ga0207711_10000654 | 3300025941 | Bacteria | 34558 |
| 382 | Ga0207711_10008005 | 3300025941 | Bacteria | 8841 |
| 383 | Ga0207711_10019605 | 3300025941 | Bacteria | 5630 |
| 384 | Ga0207689_10001081 | 3300025942 | Bacteria | 26272 |
| 385 | Ga0207689_10026863 | 3300025942 | Bacteria | 4819 |
| 386 | Ga0207689_10037463 | 3300025942 | Bacteria | 4022 |
| 387 | Ga0207661_10072017 | 3300025944 | Bacteria | 2827 |
| 388 | Ga0207679_10000404 | 3300025945 | Bacteria | 30976 |
| 389 | Ga0207679_10005738 | 3300025945 | Bacteria | 7790 |
| 390 | Ga0207679_10121147 | 3300025945 | Bacteria | 2083 |
| 391 | Ga0207667_10002797 | 3300025949 | Bacteria | 21604 |
| 392 | Ga0207667_10165607 | 3300025949 | Bacteria | 2273 |
| 393 | Ga0207651_10001587 | 3300025960 | Bacteria | 10408 |
| 394 | Ga0207651_10007695 | 3300025960 | Bacteria | 5757 |
| 395 | Ga0207651_10035662 | 3300025960 | Bacteria | 3238 |
| 396 | Ga0207651_10052487 | 3300025960 | Bacteria | 2780 |
| 397 | Ga0207651_10117798 | 3300025960 | Bacteria | 2007 |
| 398 | Ga0207712_10018508 | 3300025961 | Bacteria | 4539 |
| 399 | Ga0207668_10002950 | 3300025972 | Bacteria | 9968 |
| 400 | Ga0207668_10034452 | 3300025972 | Bacteria | 3363 |
| 401 | Ga0207640_10044617 | 3300025981 | Bacteria | 2842 |
| 402 | Ga0207640_10056692 | 3300025981 | Bacteria | 2574 |
| 403 | Ga0207640_10103978 | 3300025981 | Bacteria | 1998 |
| 404 | Ga0207640_10478336 | 3300025981 | Bacteria | 1032 |
| 405 | Ga0207658_10006949 | 3300025986 | Bacteria | 7704 |
| 406 | Ga0207658_10022771 | 3300025986 | Bacteria | 4364 |
| 407 | Ga0207658_10058879 | 3300025986 | Bacteria | 2861 |
| 408 | Ga0207658_10079113 | 3300025986 | Bacteria | 2514 |
| 409 | Ga0207677_10000162 | 3300026023 | Bacteria | 53309 |
| 410 | Ga0207677_10020074 | 3300026023 | Bacteria | 4049 |
| 411 | Ga0207677_10120407 | 3300026023 | Bacteria | 1973 |
| 412 | Ga0207677_10197178 | 3300026023 | Bacteria | 1597 |
| 413 | Ga0207677_10560265 | 3300026023 | Bacteria | 997 |
| 414 | Ga0207703_10001919 | 3300026035 | Bacteria | 18425 |
| 415 | Ga0207703_10006661 | 3300026035 | Bacteria | 9215 |
| 416 | Ga0207703_10217221 | 3300026035 | Bacteria | 1708 |
| 417 | Ga0207703_10262531 | 3300026035 | Bacteria | 1561 |
| 418 | Ga0207639_10181280 | 3300026041 | Bacteria | 1792 |
| 419 | Ga0207678_10032495 | 3300026067 | Bacteria | 4548 |
| 420 | Ga0207678_10167518 | 3300026067 | Bacteria | 1876 |
| 421 | Ga0207708_10036611 | 3300026075 | Bacteria | 3737 |
| 422 | Ga0207702_10006364 | 3300026078 | Bacteria | 10193 |
| 423 | Ga0207702_10270514 | 3300026078 | Bacteria | 1602 |
| 424 | Ga0207641_10001702 | 3300026088 | Bacteria | 21403 |
| 425 | Ga0207641_10014054 | 3300026088 | Bacteria | 6563 |
| 426 | Ga0207641_10045270 | 3300026088 | Bacteria | 3705 |
| 427 | Ga0207641_10225869 | 3300026088 | Bacteria | 1738 |
| 428 | Ga0207648_10000343 | 3300026089 | Bacteria | 51081 |
| 429 | Ga0207648_10002633 | 3300026089 | Bacteria | 19203 |
| 430 | Ga0207648_10003584 | 3300026089 | Bacteria | 16250 |
| 431 | Ga0207648_10008152 | 3300026089 | Bacteria | 10184 |
| 432 | Ga0207648_10035446 | 3300026089 | Bacteria | 4396 |
| 433 | Ga0207648_10050801 | 3300026089 | Bacteria | 3625 |
| 434 | Ga0207648_10220136 | 3300026089 | Bacteria | 1687 |
| 435 | Ga0207676_10000451 | 3300026095 | Bacteria | 34663 |
| 436 | Ga0207676_10003663 | 3300026095 | Bacteria | 10865 |
| 437 | Ga0207676_10182574 | 3300026095 | Bacteria | 1838 |
| 438 | Ga0207676_10391478 | 3300026095 | Bacteria | 1296 |
| 439 | Ga0207676_10647995 | 3300026095 | Bacteria | 1019 |
| 440 | Ga0207674_10003102 | 3300026116 | Bacteria | 20519 |
| 441 | Ga0207674_10018325 | 3300026116 | Bacteria | 7612 |
| 442 | Ga0207674_10019808 | 3300026116 | Bacteria | 7281 |
| 443 | Ga0207674_10026307 | 3300026116 | Bacteria | 6184 |
| 444 | Ga0207674_10131513 | 3300026116 | Bacteria | 2465 |
| 445 | Ga0207674_10154073 | 3300026116 | Bacteria | 2254 |
| 446 | Ga0207675_100003236 | 3300026118 | Bacteria | 15974 |
| 447 | Ga0207675_100013521 | 3300026118 | Bacteria | 7617 |
| 448 | Ga0207675_100024008 | 3300026118 | Bacteria | 5668 |
| 449 | Ga0207675_100080982 | 3300026118 | Bacteria | 3044 |
| 450 | Ga0207675_100207949 | 3300026118 | Bacteria | 1881 |
| 451 | Ga0207683_10085353 | 3300026121 | Bacteria | 2806 |
| 452 | Ga0207683_10172285 | 3300026121 | Bacteria | 1960 |
| 453 | Ga0209281_1000454 | 3300027111 | Bacteria | 58234 |
| 454 | Ga0209982_1019615 | 3300027552 | Bacteria | 1037 |
| 455 | Ga0209970_1001012 | 3300027614 | Bacteria | 4991 |
| 456 | Ga0210002_1011274 | 3300027617 | Bacteria | 1381 |
| 457 | Ga0209983_1002922 | 3300027665 | Bacteria | 3693 |
| 458 | Ga0209971_1028964 | 3300027682 | Bacteria | 1325 |
| 459 | Ga0209966_1004389 | 3300027695 | Bacteria | 2389 |
| 460 | Ga0209813_10005461 | 3300027866 | Bacteria | 3086 |
| 461 | Ga0209974_10006322 | 3300027876 | Bacteria | 4141 |
| 462 | Ga0209974_10007375 | 3300027876 | Bacteria | 3790 |
| 463 | Ga0207428_10251550 | 3300027907 | Bacteria | 1318 |
| 464 | Ga0268266_10147323 | 3300028379 | Bacteria | 2118 |
| 465 | Ga0268266_10210787 | 3300028379 | Bacteria | 1781 |
| 466 | Ga0268265_10003999 | 3300028380 | Bacteria | 10378 |
| 467 | Ga0268265_10006699 | 3300028380 | Bacteria | 7798 |
| 468 | Ga0268265_10074241 | 3300028380 | Bacteria | 2659 |
| 469 | Ga0268265_10310188 | 3300028380 | Bacteria | 1424 |
| 470 | Ga0268264_10001000 | 3300028381 | Bacteria | 28759 |
| 471 | Ga0268264_10002760 | 3300028381 | Bacteria | 15322 |
| 472 | Ga0268264_10049555 | 3300028381 | Bacteria | 3494 |
| 473 | Ga0268264_10089344 | 3300028381 | Bacteria | 2653 |
| 474 | Ga0307517_10000358 | 3300028786 | Bacteria | 78437 |
| 475 | Ga0307515_10000417 | 3300028794 | Bacteria | 102343 |
| 476 | Ga0307515_10000459 | 3300028794 | Bacteria | 97482 |
| 477 | Ga0307515_10003649 | 3300028794 | Bacteria | 32350 |
| 478 | Ga0307515_10003668 | 3300028794 | Bacteria | 32257 |
| 479 | Ga0307515_10009465 | 3300028794 | Bacteria | 18830 |
| 480 | Ga0307515_10010929 | 3300028794 | Bacteria | 17310 |
| 481 | Ga0307515_10025898 | 3300028794 | Bacteria | 10121 |
| 482 | Ga0307515_10091248 | 3300028794 | Bacteria | 3809 |
| 483 | Ga0307512_10031625 | 3300030522 | Bacteria | 4578 |
| 484 | Ga0307512_10055700 | 3300030522 | Bacteria | 3115 |
| 485 | Ga0265332_10010522 | 3300031238 | Bacteria | 4119 |
| 486 | Ga0265316_10000632 | 3300031344 | Bacteria | 39227 |
| 487 | Ga0307513_10000006 | 3300031456 | Bacteria | 470848 |
| 488 | Ga0307513_10002513 | 3300031456 | Bacteria | 25362 |
| 489 | Ga0307513_10005054 | 3300031456 | Bacteria | 17463 |
| 490 | Ga0307513_10009552 | 3300031456 | Bacteria | 12262 |
| 491 | Ga0307513_10025822 | 3300031456 | Bacteria | 6793 |
| 492 | Ga0307513_10076015 | 3300031456 | Bacteria | 3485 |
| 493 | Ga0307513_10183534 | 3300031456 | Bacteria | 1952 |
| 494 | Ga0307513_10190247 | 3300031456 | Bacteria | 1905 |
| 495 | Ga0307509_10001694 | 3300031507 | Bacteria | 36817 |
| 496 | Ga0307509_10005213 | 3300031507 | Bacteria | 18216 |
| 497 | Ga0307509_10017599 | 3300031507 | Bacteria | 8218 |
| 498 | Ga0307509_10052291 | 3300031507 | Bacteria | 4361 |
| 499 | Ga0307509_10096881 | 3300031507 | Bacteria | 3000 |
| 500 | Ga0307408_100000008 | 3300031548 | Bacteria | 456355 |
| 501 | Ga0307408_100000072 | 3300031548 | Bacteria | 115918 |
| 502 | Ga0307408_100050732 | 3300031548 | Bacteria | 2985 |
| 503 | Ga0307408_100057624 | 3300031548 | Bacteria | 2821 |
| 504 | Ga0307408_100064711 | 3300031548 | Bacteria | 2679 |
| 505 | Ga0307408_100086284 | 3300031548 | Bacteria | 2359 |
| 506 | Ga0307508_10000466 | 3300031616 | Bacteria | 48802 |
| 507 | Ga0307508_10007101 | 3300031616 | Bacteria | 10443 |
| 508 | Ga0307514_10000979 | 3300031649 | Bacteria | 42521 |
| 509 | Ga0307514_10001625 | 3300031649 | Bacteria | 26325 |
| 510 | Ga0307514_10004420 | 3300031649 | Bacteria | 12940 |
| 511 | Ga0307514_10056335 | 3300031649 | Bacteria | 3018 |
| 512 | Ga0307516_10000705 | 3300031730 | Bacteria | 45448 |
| 513 | Ga0307516_10018606 | 3300031730 | Bacteria | 7215 |
| 514 | Ga0307516_10023079 | 3300031730 | Bacteria | 6384 |
| 515 | Ga0307516_10123621 | 3300031730 | Bacteria | 2374 |
| 516 | Ga0307516_10190063 | 3300031730 | Bacteria | 1780 |
| 517 | Ga0307405_10001883 | 3300031731 | Bacteria | 9015 |
| 518 | Ga0307405_10013240 | 3300031731 | Bacteria | 4396 |
| 519 | Ga0307413_10004852 | 3300031824 | Bacteria | 5909 |
| 520 | Ga0307413_10005108 | 3300031824 | Bacteria | 5808 |
| 521 | Ga0307410_10079866 | 3300031852 | Bacteria | 2293 |
| 522 | Ga0307406_10000278 | 3300031901 | Bacteria | 30154 |
| 523 | Ga0307406_10004015 | 3300031901 | Bacteria | 8006 |
| 524 | Ga0307406_10004493 | 3300031901 | Bacteria | 7594 |
| 525 | Ga0307406_10023208 | 3300031901 | Bacteria | 3688 |
| 526 | Ga0307407_10012937 | 3300031903 | Bacteria | 4031 |
| 527 | Ga0307412_10004381 | 3300031911 | Bacteria | 7870 |
| 528 | Ga0307412_10034999 | 3300031911 | Bacteria | 3205 |
| 529 | Ga0307409_100010785 | 3300031995 | Bacteria | 5711 |
| 530 | Ga0307409_100163392 | 3300031995 | Bacteria | 1950 |
| 531 | Ga0307416_100011599 | 3300032002 | Bacteria | 5888 |
| 532 | Ga0307416_100022062 | 3300032002 | Bacteria | 4586 |
| 533 | Ga0307414_10316971 | 3300032004 | Bacteria | 1326 |
| 534 | Ga0307411_10001006 | 3300032005 | Bacteria | 10872 |
| 535 | Ga0307415_100096447 | 3300032126 | Bacteria | 2155 |
| 536 | Ga0307507_10058912 | 3300033179 | Bacteria | 3600 |
| 537 | Ga0307507_10142012 | 3300033179 | Bacteria | 1838 |
| 538 | Ga0373929_0020793 | 3300035085 | Bacteria | 1326 |
| 539 | Ga0373944_0048338 | 3300035089 | Bacteria | 1335 |
| 540 | Ga0373941_0131040 | 3300035115 | Unclassified | 903 |
| 541 | Ga0373953_0003327 | 3300035117 | Bacteria | 4988 |
| 542 | Ga0373954_0027596 | 3300035118 | Bacteria | 2607 |
| 543 | Ga0373946_0019107 | 3300035171 | Bacteria | 2638 |
| 544 | Ga0373955_0039097 | 3300035172 | Bacteria | 2530 |
| 545 | Ga0373955_0214555 | 3300035172 | Bacteria | 1148 |
| 546 | Ga0373931_0044447 | 3300035691 | Bacteria | 2343 |
| 547 | Ga0373935_0081080 | 3300035692 | Bacteria | 2109 |
| 548 | Ga0373935_0092233 | 3300035692 | Bacteria | 1984 |
| 549 | Ga0373927_0040065 | 3300035695 | Bacteria | 3040 |
| 550 | Ga0373933_0004441 | 3300035724 | Bacteria | 7697 |
| 551 | Ga0373947_0057524 | 3300035725 | Bacteria | 2353 |
| 552 | Ga0373937_0027808 | 3300036401 | Bacteria | 5116 |
| 553 | Ga0373937_0102170 | 3300036401 | Bacteria | 2661 |
| 554 | Ga0373925_0052445 | 3300037068 | Bacteria | 3047 |
| 555 | Ga0373925_0054821 | 3300037068 | Bacteria | 2982 |
| 556 | Ga0373925_0064722 | 3300037068 | Bacteria | 2753 |
| 557 | Ga0373925_0152105 | 3300037068 | Bacteria | 1818 |
| 558 | Ga0436361_1141598 | 3300039447 | Bacteria | 1600 |
| 559 | Ga0451793_0421724 | 3300041452 | Bacteria | 3400 |
| 560 | Ga0451853_3400648 | 3300041512 | Bacteria | 1889 |
| 561 | Ga0439431_0009732 | 3300041997 | Bacteria | 2174 |
| 562 | Ga0439445_0022983 | 3300042004 | Bacteria | 1576 |
| 563 | Ga0439455_0058532 | 3300042012 | Bacteria | 1018 |
| 564 | Ga0450919_002868 | 3300042121 | Bacteria | 2211 |
| 565 | Ga0450923_025616 | 3300042125 | Bacteria | 1176 |
| 566 | Ga0450891_006399 | 3300042129 | Bacteria | 1086 |
| 567 | Ga0439434_0026031 | 3300042435 | Bacteria | 1767 |
| 568 | Ga0439464_0058301 | 3300042439 | Bacteria | 1127 |
| 569 | Ga0450918_001141 | 3300042531 | Bacteria | 5446 |
| 570 | Ga0451577_0003070 | 3300042876 | Bacteria | 18890 |
| 571 | Ga0451577_0067920 | 3300042876 | Bacteria | 3180 |
| 572 | Ga0451577_0102691 | 3300042876 | Bacteria | 2555 |
| 573 | Ga0453683_0022728 | 3300044673 | Bacteria | 3998 |
| 574 | Ga0466963_0129886 | 3300044694 | Bacteria | 1740 |
| 575 | Ga0453684_0006395 | 3300044712 | Bacteria | 22435 |
| 576 | Ga0453684_0009366 | 3300044712 | Bacteria | 17157 |
| 577 | Ga0453684_0030654 | 3300044712 | Bacteria | 7589 |
| 578 | Ga0451576_0005545 | 3300045051 | Bacteria | 15763 |
| 579 | Ga0451576_0298557 | 3300045051 | Bacteria | 1684 |
| 580 | Ga0495592_0000264 | 3300046454 | Bacteria | 44823 |
| 581 | Ga0495590_0018748 | 3300046457 | Bacteria | 2475 |
| 582 | Ga0495650_0004943 | 3300046471 | Bacteria | 8892 |
| 583 | Ga0495580_0070957 | 3300046472 | Bacteria | 2433 |
| 584 | Ga0495664_0033908 | 3300046477 | Bacteria | 3001 |
| 585 | Ga0495608_0120732 | 3300046511 | Bacteria | 1681 |
| 586 | Ga0495610_0036459 | 3300046512 | Bacteria | 2513 |
| 587 | Ga0495630_0058507 | 3300046517 | Bacteria | 2890 |
| 588 | Ga0495632_0002891 | 3300046519 | Bacteria | 12629 |
| 589 | Ga0495632_0026840 | 3300046519 | Bacteria | 3024 |
| 590 | Ga0495632_0084916 | 3300046519 | Bacteria | 1506 |
| 591 | Ga0495648_0076904 | 3300046524 | Bacteria | 1915 |
| 592 | Ga0495654_0002750 | 3300046530 | Bacteria | 11091 |
| 593 | Ga0495645_0019219 | 3300046543 | Bacteria | 4919 |
| 594 | Ga0495622_0079260 | 3300046557 | Bacteria | 1512 |
| 595 | Ga0495656_0002817 | 3300046615 | Bacteria | 5815 |
| 596 | Ga0495625_0001726 | 3300046660 | Bacteria | 25344 |
| 597 | Ga0495625_0139522 | 3300046660 | Bacteria | 1636 |
| 598 | Ga0495623_0106309 | 3300046679 | Bacteria | 1705 |
| 599 | Ga0495669_0042227 | 3300046684 | Bacteria | 2027 |
| 600 | Ga0495624_0199029 | 3300046690 | Bacteria | 1217 |
| 601 | Ga0495670_0216111 | 3300046691 | Archaea | 1018 |
| 602 | Ga0495649_0015742 | 3300046694 | Bacteria | 4299 |
| 603 | Ga0495649_0025268 | 3300046694 | Bacteria | 3309 |
| 604 | Ga0495676_0289302 | 3300047321 | Bacteria | 1107 |
| 605 | Ga0495687_000212 | 3300047443 | Bacteria | 83406 |
| 606 | Ga0495687_044482 | 3300047443 | Bacteria | 1929 |
| 607 | Ga0495593_0022467 | 3300047673 | Bacteria | 3514 |
| 608 | Ga0495602_0275707 | 3300048088 | Bacteria | 1241 |
| 609 | Ga0496102_0003078 | 3300048905 | Bacteria | 14125 |
| 610 | Ga0496102_0005035 | 3300048905 | Bacteria | 11191 |
| 611 | Ga0496102_0038160 | 3300048905 | Bacteria | 4334 |
| 612 | Ga0496102_0205363 | 3300048905 | Bacteria | 1857 |
| 613 | Ga0496104_0007078 | 3300048907 | Bacteria | 9893 |
| 614 | Ga0496105_0001968 | 3300048908 | Bacteria | 14776 |
| 615 | Ga0496106_0002588 | 3300048909 | Bacteria | 13468 |
| 616 | Ga0496106_0084117 | 3300048909 | Bacteria | 2448 |
| 617 | Ga0496106_0188970 | 3300048909 | Bacteria | 1637 |
| 618 | Ga0496107_0002385 | 3300048910 | Bacteria | 12156 |
| 619 | Ga0496107_0143787 | 3300048910 | Bacteria | 1763 |
| 620 | Ga0496108_0017714 | 3300048911 | Bacteria | 5826 |
| 621 | Ga0496110_0101718 | 3300048913 | Bacteria | 2576 |
| 622 | Ga0496110_0685235 | 3300048913 | Bacteria | 926 |
| 623 | Ga0496112_0000241 | 3300048915 | Bacteria | 35206 |
| 624 | Ga0496113_0209016 | 3300048916 | Bacteria | 1553 |
| 625 | Ga0496114_0003680 | 3300048917 | Bacteria | 11790 |
| 626 | Ga0496115_0079611 | 3300048918 | Bacteria | 2667 |
| 627 | Ga0496118_0184943 | 3300048921 | Bacteria | 1254 |
| 628 | Ga0496121_0116335 | 3300048924 | Bacteria | 2028 |
| 629 | Ga0496124_0003260 | 3300048927 | Bacteria | 20044 |
| 630 | Ga0496125_0005292 | 3300048928 | Bacteria | 14432 |
| 631 | Ga0496125_0113669 | 3300048928 | Bacteria | 1953 |
| 632 | Ga0496125_0125014 | 3300048928 | Bacteria | 1825 |
| 633 | Ga0501300_017066 | 3300049523 | Bacteria | 1059 |
| 634 | Ga0501047_0172215 | 3300049581 | Bacteria | 2033 |
| 635 | Ga0501079_0509046 | 3300049741 | Bacteria | 947 |
| 636 | Ga0501080_0063841 | 3300049742 | Bacteria | 3426 |
| 637 | Ga0501083_0010480 | 3300049744 | Bacteria | 6525 |
| 638 | nmdc:mga03683_36318_c1 | 3300050489 | Bacteria | 2004 |
| 639 | nmdc:mga0k408_13359_c1 | 3300050493 | Bacteria | 4502 |
| 640 | nmdc:mga0k408_20709_c1 | 3300050493 | Bacteria | 3689 |
| 641 | nmdc:mga0k408_37110_c1 | 3300050493 | Bacteria | 2797 |
| 642 | nmdc:mga0k408_51204_c1 | 3300050493 | Bacteria | 2392 |
| 643 | nmdc:mga0k408_585_c1 | 3300050493 | Bacteria | 20193 |
| 644 | nmdc:mga0k408_81863_c1 | 3300050493 | Bacteria | 1891 |
| 645 | nmdc:mga06z11_135992_c1 | 3300050494 | Bacteria | 1385 |
| 646 | nmdc:mga06z11_14050_c1 | 3300050494 | Bacteria | 3534 |
| 647 | nmdc:mga06z11_37007_c1 | 3300050494 | Bacteria | 2414 |
| 648 | nmdc:mga06z11_5847_c1 | 3300050494 | Bacteria | 4965 |
| 649 | nmdc:mga04h51_23644_c1 | 3300050495 | Bacteria | 1873 |
| 650 | nmdc:mga07m45_247_c1 | 3300050496 | Bacteria | 21997 |
| 651 | nmdc:mga07m45_41439_c1 | 3300050496 | Bacteria | 2579 |
| 652 | nmdc:mga09592_3236_c1 | 3300050508 | Bacteria | 13180 |
| 653 | nmdc:mga0qj67_115994_c1 | 3300050509 | Bacteria | 2164 |
| 654 | nmdc:mga08y16_120385_c1 | 3300050511 | Bacteria | 2731 |
| 655 | nmdc:mga08y16_24913_c1 | 3300050511 | Bacteria | 6311 |
| 656 | nmdc:mga08y16_74087_c1 | 3300050511 | Bacteria | 3547 |
| 657 | nmdc:mga0n895_296568_c1 | 3300050512 | Bacteria | 1639 |
| 658 | nmdc:mga08x19_15991_c1 | 3300050514 | Bacteria | 4571 |
| 659 | Ga0500578_0010158 | 3300053086 | Bacteria | 6104 |
| 660 | Ga0500644_0154548 | 3300053088 | Bacteria | 922 |
| 661 | Ga0500646_0001709 | 3300053090 | Bacteria | 5790 |
| 662 | Ga0500583_0051795 | 3300053092 | Bacteria | 1909 |
| 663 | Ga0500651_0027117 | 3300053093 | Bacteria | 3601 |
| 664 | Ga0500566_0004435 | 3300053094 | Bacteria | 8380 |
| 665 | Ga0500566_0014401 | 3300053094 | Bacteria | 4650 |
| 666 | Ga0500650_0033793 | 3300053098 | Bacteria | 2334 |
| 667 | Ga0500593_000435 | 3300053117 | Bacteria | 16452 |
| 668 | Ga0500652_001537 | 3300053131 | Bacteria | 7060 |
| 669 | Ga0500658_0022941 | 3300053134 | Bacteria | 2379 |
| 670 | Ga0500559_0000092 | 3300053136 | Bacteria | 71917 |
| 671 | Ga0500559_0218527 | 3300053136 | Bacteria | 899 |
| 672 | Ga0500603_000602 | 3300053150 | Bacteria | 8950 |
| 673 | Ga0500604_0005487 | 3300053151 | Bacteria | 3348 |
| 674 | Ga0500622_0001110 | 3300053156 | Bacteria | 22450 |
| 675 | Ga0500645_000474 | 3300053730 | Bacteria | 27453 |
| 676 | Ga0500587_001176 | 3300053739 | Bacteria | 3617 |
| 677 | Ga0501082_0101187 | 3300060353 | Bacteria | 2493 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035115 | Ga0373941_0131040 | Ga0373941_0131040_125_892 | 252 |
| 2 | 3300053136 | Ga0500559_0218527 | Ga0500559_0218527_13_777 | 253 |
| 3 | 3300048913 | Ga0496110_0685235 | Ga0496110_0685235_29_856 | 275 |
| 4 | 3300048921 | Ga0496118_0184943 | Ga0496118_0184943_194_1027 | 275 |
| 5 | 3300048924 | Ga0496121_0116335 | Ga0496121_0116335_913_1746 | 275 |
| 6 | 3300048928 | Ga0496125_0125014 | Ga0496125_0125014_321_1154 | 275 |
| 7 | 3300049741 | Ga0501079_0509046 | Ga0501079_0509046_92_934 | 278 |
| 8 | iso_pu_bacteria | 2643221644 | 2644244522 | 279 |
| 9 | 3300005459 | Ga0068867_100000114 | Ga0068867_10000011450 | 280 |
| 10 | 3300009148 | Ga0105243_10014110 | Ga0105243_100141103 | 280 |
| 11 | 3300014745 | Ga0157377_10000016 | Ga0157377_10000016133 | 280 |
| 12 | 3300025935 | Ga0207709_10052527 | Ga0207709_100525272 | 280 |
| 13 | 3300026089 | Ga0207648_10000343 | Ga0207648_1000034351 | 280 |
| 14 | 3300046691 | Ga0495670_0216111 | Ga0495670_0216111_119_973 | 280 |
| 15 | 3300014326 | Ga0157380_10076760 | Ga0157380_100767603 | 282 |
| 16 | 3300003775 | Ga0055524_1000079 | Ga0055524_100007982 | 283 |
| 17 | 3300003791 | Ga0055530_10005160 | Ga0055530_100051602 | 283 |
| 18 | 3300003792 | Ga0055540_1000004 | Ga0055540_1000004156 | 283 |
| 19 | 3300003794 | Ga0055531_10014357 | Ga0055531_100143573 | 283 |
| 20 | 3300005339 | Ga0070660_100025436 | Ga0070660_1000254362 | 283 |
| 21 | 3300005344 | Ga0070661_100007008 | Ga0070661_1000070089 | 283 |
| 22 | 3300005564 | Ga0070664_100184031 | Ga0070664_1001840312 | 283 |
| 23 | 3300006946 | Ga0079104_1000352 | Ga0079104_100035214 | 283 |
| 24 | 3300025298 | Ga0209050_1000677 | Ga0209050_100067721 | 283 |
| 25 | 3300025298 | Ga0209050_1028295 | Ga0209050_10282952 | 283 |
| 26 | 3300025299 | Ga0209256_1000011 | Ga0209256_100001183 | 283 |
| 27 | 3300025303 | Ga0209051_1000016 | Ga0209051_1000016249 | 283 |
| 28 | 3300025304 | Ga0209257_1000102 | Ga0209257_100010244 | 283 |
| 29 | 3300025919 | Ga0207657_10041190 | Ga0207657_100411902 | 283 |
| 30 | 3300025920 | Ga0207649_10001247 | Ga0207649_1000124714 | 283 |
| 31 | 3300025932 | Ga0207690_10066524 | Ga0207690_100665243 | 283 |
| 32 | 3300025945 | Ga0207679_10000404 | Ga0207679_100004047 | 283 |
| 33 | 3300027111 | Ga0209281_1000454 | Ga0209281_100045443 | 283 |
| 34 | 3300033179 | Ga0307507_10142012 | Ga0307507_101420122 | 283 |
| 35 | 3300042121 | Ga0450919_002868 | Ga0450919_002868_1229_2080 | 283 |
| 36 | 3300042125 | Ga0450923_025616 | Ga0450923_025616_108_959 | 283 |
| 37 | 3300042531 | Ga0450918_001141 | Ga0450918_001141_919_1770 | 283 |
| 38 | 3300048905 | Ga0496102_0005035 | Ga0496102_0005035_6464_7384 | 283 |
| 39 | 3300048917 | Ga0496114_0003680 | Ga0496114_0003680_8020_8871 | 283 |
| 40 | 3300053117 | Ga0500593_000435 | Ga0500593_000435_1984_2904 | 283 |
| 41 | 3300003322 | rootL2_10103817 | rootL2_101038174 | 284 |
| 42 | 3300006038 | Ga0075365_10041051 | Ga0075365_100410512 | 284 |
| 43 | 3300006051 | Ga0075364_10243040 | Ga0075364_102430402 | 284 |
| 44 | 3300005718 | Ga0068866_10058754 | Ga0068866_100587542 | 286 |
| 45 | 3300026118 | Ga0207675_100080982 | Ga0207675_1000809822 | 286 |
| 46 | 3300031548 | Ga0307408_100050732 | Ga0307408_1000507321 | 286 |
| 47 | 3300031901 | Ga0307406_10023208 | Ga0307406_100232082 | 286 |
| 48 | 3300053086 | Ga0500578_0010158 | Ga0500578_0010158_329_1201 | 286 |
| 49 | 3300053094 | Ga0500566_0004435 | Ga0500566_0004435_7222_8115 | 286 |
| 50 | 3300053150 | Ga0500603_000602 | Ga0500603_000602_4346_5239 | 286 |
| 51 | 3300006914 | Ga0075436_100030838 | Ga0075436_1000308383 | 287 |
| 52 | 3300025905 | Ga0207685_10170595 | Ga0207685_101705951 | 287 |
| 53 | 3300025937 | Ga0207669_10292471 | Ga0207669_102924711 | 287 |
| 54 | 3300027614 | Ga0209970_1001012 | Ga0209970_10010121 | 287 |
| 55 | 3300035691 | Ga0373931_0044447 | Ga0373931_0044447_500_1390 | 287 |
| 56 | 3300046684 | Ga0495669_0042227 | Ga0495669_0042227_320_1195 | 287 |
| 57 | 3300050514 | nmdc:mga08x19_15991_c1 | nmdc:mga08x19_15991_c1_1856_2731 | 287 |
| 58 | 3300053730 | Ga0500645_000474 | Ga0500645_000474_11106_12053 | 287 |
| 59 | 3300031456 | Ga0307513_10190247 | Ga0307513_101902472 | 288 |
| 60 | iso_pu_bacteria | 2643221609 | 2644058240 | 288 |
| 61 | iso_pu_bacteria | 2643221611 | 2644073293 | 288 |
| 62 | iso_pu_bacteria | 2738543012 | 2739244419 | 288 |
| 63 | iso_pu_bacteria | 2816332133 | 2816469850 | 288 |
| 64 | 3300005340 | Ga0070689_100019245 | Ga0070689_1000192455 | 289 |
| 65 | 3300005438 | Ga0070701_10007050 | Ga0070701_100070503 | 289 |
| 66 | 3300005440 | Ga0070705_100114283 | Ga0070705_1001142831 | 289 |
| 67 | 3300005615 | Ga0070702_100109450 | Ga0070702_1001094502 | 289 |
| 68 | 3300005617 | Ga0068859_100430372 | Ga0068859_1004303721 | 289 |
| 69 | 3300006931 | Ga0097620_100430429 | Ga0097620_1004304291 | 289 |
| 70 | 3300014326 | Ga0157380_10000875 | Ga0157380_100008756 | 289 |
| 71 | 3300025918 | Ga0207662_10032204 | Ga0207662_100322041 | 289 |
| 72 | 3300025936 | Ga0207670_10031264 | Ga0207670_100312643 | 289 |
| 73 | 3300025942 | Ga0207689_10026863 | Ga0207689_100268634 | 289 |
| 74 | 3300031456 | Ga0307513_10000006 | Ga0307513_10000006412 | 289 |
| 75 | 3300031548 | Ga0307408_100000008 | Ga0307408_100000008271 | 289 |
| 76 | 3300031730 | Ga0307516_10018606 | Ga0307516_100186067 | 289 |
| 77 | 3300042876 | Ga0451577_0003070 | Ga0451577_0003070_2562_3473 | 289 |
| 78 | 3300042876 | Ga0451577_0067920 | Ga0451577_0067920_1611_2510 | 289 |
| 79 | 3300044673 | Ga0453683_0022728 | Ga0453683_0022728_456_1355 | 289 |
| 80 | 3300044712 | Ga0453684_0009366 | Ga0453684_0009366_3560_4471 | 289 |
| 81 | 3300044712 | Ga0453684_0030654 | Ga0453684_0030654_2244_3143 | 289 |
| 82 | 3300045051 | Ga0451576_0005545 | Ga0451576_0005545_1852_2751 | 289 |
| 83 | iso_pu_bacteria | 2547132374 | 2548500442 | 289 |
| 84 | iso_pu_bacteria | 2585428062 | 2587757047 | 289 |
| 85 | iso_pu_bacteria | 2643221570 | 2643864548 | 289 |
| 86 | iso_pu_bacteria | 2643221596 | 2643992840 | 289 |
| 87 | iso_pu_bacteria | 2643221652 | 2644291763 | 289 |
| 88 | iso_pu_bacteria | 2643221717 | 2644647011 | 289 |
| 89 | iso_pu_bacteria | 2990710928 | 2990715127 | 289 |
| 90 | 3300005539 | Ga0068853_100011875 | Ga0068853_1000118757 | 290 |
| 91 | 3300005841 | Ga0068863_100027188 | Ga0068863_1000271882 | 290 |
| 92 | 3300006844 | Ga0075428_100012423 | Ga0075428_1000124238 | 290 |
| 93 | 3300009093 | Ga0105240_10027731 | Ga0105240_100277315 | 290 |
| 94 | 3300009094 | Ga0111539_10021763 | Ga0111539_100217636 | 290 |
| 95 | 3300009545 | Ga0105237_10000076 | Ga0105237_100000769 | 290 |
| 96 | 3300009551 | Ga0105238_10007384 | Ga0105238_100073849 | 290 |
| 97 | 3300010375 | Ga0105239_10008182 | Ga0105239_100081829 | 290 |
| 98 | 3300025911 | Ga0207654_10137587 | Ga0207654_101375872 | 290 |
| 99 | 3300025913 | Ga0207695_10021153 | Ga0207695_100211534 | 290 |
| 100 | 3300025914 | Ga0207671_10005377 | Ga0207671_100053775 | 290 |
| 101 | 3300025916 | Ga0207663_10246971 | Ga0207663_102469712 | 290 |
| 102 | 3300025924 | Ga0207694_10011637 | Ga0207694_100116373 | 290 |
| 103 | 3300026088 | Ga0207641_10225869 | Ga0207641_102258692 | 290 |
| 104 | 3300028794 | Ga0307515_10025898 | Ga0307515_100258983 | 290 |
| 105 | 3300039447 | Ga0436361_1141598 | Ga0436361_1141598_640_1527 | 290 |
| 106 | 3300042439 | Ga0439464_0058301 | Ga0439464_0058301_51_926 | 290 |
| 107 | 3300046471 | Ga0495650_0004943 | Ga0495650_0004943_2908_3783 | 290 |
| 108 | 3300046615 | Ga0495656_0002817 | Ga0495656_0002817_3773_4657 | 290 |
| 109 | 3300048928 | Ga0496125_0113669 | Ga0496125_0113669_24_896 | 290 |
| 110 | 3300049581 | Ga0501047_0172215 | Ga0501047_0172215_202_1092 | 290 |
| 111 | 3300049742 | Ga0501080_0063841 | Ga0501080_0063841_487_1377 | 290 |
| 112 | 3300049744 | Ga0501083_0010480 | Ga0501083_0010480_831_1721 | 290 |
| 113 | 3300050511 | nmdc:mga08y16_24913_c1 | nmdc:mga08y16_24913_c1_942_1826 | 290 |
| 114 | 3300060353 | Ga0501082_0101187 | Ga0501082_0101187_1543_2433 | 290 |
| 115 | 3300005331 | Ga0070670_100029077 | Ga0070670_1000290773 | 291 |
| 116 | 3300005336 | Ga0070680_100332264 | Ga0070680_1003322641 | 291 |
| 117 | 3300005458 | Ga0070681_10193585 | Ga0070681_101935852 | 291 |
| 118 | 3300005563 | Ga0068855_100154798 | Ga0068855_1001547982 | 291 |
| 119 | 3300006195 | Ga0075366_10000810 | Ga0075366_100008105 | 291 |
| 120 | 3300006195 | Ga0075366_10002594 | Ga0075366_100025943 | 291 |
| 121 | 3300006846 | Ga0075430_100087012 | Ga0075430_1000870122 | 291 |
| 122 | 3300013104 | Ga0157370_10013405 | Ga0157370_100134055 | 291 |
| 123 | 3300014326 | Ga0157380_10427889 | Ga0157380_104278892 | 291 |
| 124 | 3300025292 | Ga0209676_1043215 | Ga0209676_10432152 | 291 |
| 125 | 3300025912 | Ga0207707_10069217 | Ga0207707_100692173 | 291 |
| 126 | 3300025925 | Ga0207650_10024159 | Ga0207650_100241592 | 291 |
| 127 | 3300025949 | Ga0207667_10165607 | Ga0207667_101656072 | 291 |
| 128 | 3300028794 | Ga0307515_10000459 | Ga0307515_1000045987 | 291 |
| 129 | 3300031456 | Ga0307513_10005054 | Ga0307513_100050544 | 291 |
| 130 | 3300031548 | Ga0307408_100064711 | Ga0307408_1000647113 | 291 |
| 131 | 3300031649 | Ga0307514_10001625 | Ga0307514_1000162522 | 291 |
| 132 | 3300031731 | Ga0307405_10001883 | Ga0307405_100018834 | 291 |
| 133 | 3300031824 | Ga0307413_10004852 | Ga0307413_100048526 | 291 |
| 134 | 3300031852 | Ga0307410_10079866 | Ga0307410_100798662 | 291 |
| 135 | 3300031901 | Ga0307406_10004015 | Ga0307406_100040152 | 291 |
| 136 | 3300031903 | Ga0307407_10012937 | Ga0307407_100129374 | 291 |
| 137 | 3300031911 | Ga0307412_10034999 | Ga0307412_100349993 | 291 |
| 138 | 3300031995 | Ga0307409_100163392 | Ga0307409_1001633922 | 291 |
| 139 | 3300032002 | Ga0307416_100011599 | Ga0307416_1000115993 | 291 |
| 140 | 3300032004 | Ga0307414_10316971 | Ga0307414_103169712 | 291 |
| 141 | 3300032005 | Ga0307411_10001006 | Ga0307411_1000100611 | 291 |
| 142 | 3300032126 | Ga0307415_100096447 | Ga0307415_1000964473 | 291 |
| 143 | 3300044694 | Ga0466963_0129886 | Ga0466963_0129886_692_1567 | 291 |
| 144 | 3300050493 | nmdc:mga0k408_585_c1 | nmdc:mga0k408_585_c1_9249_10124 | 291 |
| 145 | 3300050508 | nmdc:mga09592_3236_c1 | nmdc:mga09592_3236_c1_9140_10021 | 291 |
| 146 | 3300050509 | nmdc:mga0qj67_115994_c1 | nmdc:mga0qj67_115994_c1_1154_2035 | 291 |
| 147 | iso_pu_bacteria | 2585428058 | 2587736261 | 291 |
| 148 | 3300005331 | Ga0070670_100080848 | Ga0070670_1000808481 | 292 |
| 149 | 3300005338 | Ga0068868_100200106 | Ga0068868_1002001062 | 292 |
| 150 | 3300005338 | Ga0068868_100318724 | Ga0068868_1003187241 | 292 |
| 151 | 3300005338 | Ga0068868_100411250 | Ga0068868_1004112501 | 292 |
| 152 | 3300005339 | Ga0070660_100455486 | Ga0070660_1004554861 | 292 |
| 153 | 3300005340 | Ga0070689_100228338 | Ga0070689_1002283382 | 292 |
| 154 | 3300005347 | Ga0070668_100049482 | Ga0070668_1000494822 | 292 |
| 155 | 3300005347 | Ga0070668_100417237 | Ga0070668_1004172372 | 292 |
| 156 | 3300005353 | Ga0070669_100063154 | Ga0070669_1000631542 | 292 |
| 157 | 3300005353 | Ga0070669_100122721 | Ga0070669_1001227212 | 292 |
| 158 | 3300005354 | Ga0070675_100030891 | Ga0070675_1000308915 | 292 |
| 159 | 3300005355 | Ga0070671_100002310 | Ga0070671_10000231010 | 292 |
| 160 | 3300005355 | Ga0070671_100007296 | Ga0070671_1000072968 | 292 |
| 161 | 3300005355 | Ga0070671_100541423 | Ga0070671_1005414231 | 292 |
| 162 | 3300005364 | Ga0070673_100026546 | Ga0070673_1000265465 | 292 |
| 163 | 3300005364 | Ga0070673_100073518 | Ga0070673_1000735182 | 292 |
| 164 | 3300005365 | Ga0070688_100267709 | Ga0070688_1002677092 | 292 |
| 165 | 3300005366 | Ga0070659_100003296 | Ga0070659_1000032969 | 292 |
| 166 | 3300005366 | Ga0070659_100090741 | Ga0070659_1000907412 | 292 |
| 167 | 3300005367 | Ga0070667_100282042 | Ga0070667_1002820422 | 292 |
| 168 | 3300005445 | Ga0070708_100000792 | Ga0070708_10000079211 | 292 |
| 169 | 3300005445 | Ga0070708_100309855 | Ga0070708_1003098552 | 292 |
| 170 | 3300005455 | Ga0070663_100021054 | Ga0070663_1000210543 | 292 |
| 171 | 3300005457 | Ga0070662_100001177 | Ga0070662_1000011775 | 292 |
| 172 | 3300005459 | Ga0068867_100121786 | Ga0068867_1001217862 | 292 |
| 173 | 3300005530 | Ga0070679_100037311 | Ga0070679_1000373112 | 292 |
| 174 | 3300005539 | Ga0068853_100002005 | Ga0068853_10000200517 | 292 |
| 175 | 3300005543 | Ga0070672_100199499 | Ga0070672_1001994992 | 292 |
| 176 | 3300005547 | Ga0070693_100208420 | Ga0070693_1002084202 | 292 |
| 177 | 3300005548 | Ga0070665_100007136 | Ga0070665_1000071366 | 292 |
| 178 | 3300005563 | Ga0068855_100003898 | Ga0068855_1000038984 | 292 |
| 179 | 3300005563 | Ga0068855_100118801 | Ga0068855_1001188013 | 292 |
| 180 | 3300005564 | Ga0070664_100023803 | Ga0070664_1000238037 | 292 |
| 181 | 3300005577 | Ga0068857_100451502 | Ga0068857_1004515022 | 292 |
| 182 | 3300005578 | Ga0068854_100161072 | Ga0068854_1001610722 | 292 |
| 183 | 3300005614 | Ga0068856_100001796 | Ga0068856_10000179612 | 292 |
| 184 | 3300005617 | Ga0068859_100340151 | Ga0068859_1003401511 | 292 |
| 185 | 3300005618 | Ga0068864_100001446 | Ga0068864_10000144629 | 292 |
| 186 | 3300005718 | Ga0068866_10170551 | Ga0068866_101705512 | 292 |
| 187 | 3300005719 | Ga0068861_100133512 | Ga0068861_1001335122 | 292 |
| 188 | 3300005719 | Ga0068861_100272877 | Ga0068861_1002728772 | 292 |
| 189 | 3300005841 | Ga0068863_100158509 | Ga0068863_1001585093 | 292 |
| 190 | 3300005842 | Ga0068858_100275380 | Ga0068858_1002753802 | 292 |
| 191 | 3300005843 | Ga0068860_100198079 | Ga0068860_1001980793 | 292 |
| 192 | 3300005843 | Ga0068860_100281001 | Ga0068860_1002810012 | 292 |
| 193 | 3300005844 | Ga0068862_100025057 | Ga0068862_1000250574 | 292 |
| 194 | 3300006195 | Ga0075366_10037164 | Ga0075366_100371644 | 292 |
| 195 | 3300006353 | Ga0075370_10147441 | Ga0075370_101474412 | 292 |
| 196 | 3300006844 | Ga0075428_100548448 | Ga0075428_1005484482 | 292 |
| 197 | 3300006871 | Ga0075434_100757284 | Ga0075434_1007572841 | 292 |
| 198 | 3300006931 | Ga0097620_100340139 | Ga0097620_1003401391 | 292 |
| 199 | 3300009094 | Ga0111539_10154655 | Ga0111539_101546552 | 292 |
| 200 | 3300009098 | Ga0105245_10057243 | Ga0105245_100572431 | 292 |
| 201 | 3300009147 | Ga0114129_10697670 | Ga0114129_106976702 | 292 |
| 202 | 3300009174 | Ga0105241_10154351 | Ga0105241_101543512 | 292 |
| 203 | 3300009177 | Ga0105248_10013123 | Ga0105248_100131236 | 292 |
| 204 | 3300013100 | Ga0157373_10006303 | Ga0157373_100063038 | 292 |
| 205 | 3300013102 | Ga0157371_10000194 | Ga0157371_1000019414 | 292 |
| 206 | 3300013297 | Ga0157378_10094210 | Ga0157378_100942103 | 292 |
| 207 | 3300013306 | Ga0163162_10118849 | Ga0163162_101188493 | 292 |
| 208 | 3300013307 | Ga0157372_10005627 | Ga0157372_1000562713 | 292 |
| 209 | 3300013308 | Ga0157375_10019566 | Ga0157375_100195668 | 292 |
| 210 | 3300013308 | Ga0157375_10298682 | Ga0157375_102986822 | 292 |
| 211 | 3300013308 | Ga0157375_10400246 | Ga0157375_104002461 | 292 |
| 212 | 3300014968 | Ga0157379_10025337 | Ga0157379_100253373 | 292 |
| 213 | 3300014968 | Ga0157379_10102095 | Ga0157379_101020952 | 292 |
| 214 | 3300014969 | Ga0157376_10033776 | Ga0157376_100337762 | 292 |
| 215 | 3300014969 | Ga0157376_10707566 | Ga0157376_107075662 | 292 |
| 216 | 3300025901 | Ga0207688_10261430 | Ga0207688_102614301 | 292 |
| 217 | 3300025903 | Ga0207680_10039758 | Ga0207680_100397581 | 292 |
| 218 | 3300025903 | Ga0207680_10301950 | Ga0207680_103019501 | 292 |
| 219 | 3300025906 | Ga0207699_10361416 | Ga0207699_103614161 | 292 |
| 220 | 3300025919 | Ga0207657_10003940 | Ga0207657_1000394021 | 292 |
| 221 | 3300025919 | Ga0207657_10022507 | Ga0207657_100225071 | 292 |
| 222 | 3300025920 | Ga0207649_10057355 | Ga0207649_100573552 | 292 |
| 223 | 3300025921 | Ga0207652_10145470 | Ga0207652_101454702 | 292 |
| 224 | 3300025925 | Ga0207650_10043358 | Ga0207650_100433581 | 292 |
| 225 | 3300025927 | Ga0207687_10042968 | Ga0207687_100429681 | 292 |
| 226 | 3300025931 | Ga0207644_10001985 | Ga0207644_100019858 | 292 |
| 227 | 3300025931 | Ga0207644_10044136 | Ga0207644_100441363 | 292 |
| 228 | 3300025931 | Ga0207644_10058835 | Ga0207644_100588352 | 292 |
| 229 | 3300025932 | Ga0207690_10006609 | Ga0207690_100066096 | 292 |
| 230 | 3300025933 | Ga0207706_10000002 | Ga0207706_10000002287 | 292 |
| 231 | 3300025933 | Ga0207706_10093004 | Ga0207706_100930043 | 292 |
| 232 | 3300025940 | Ga0207691_10075440 | Ga0207691_100754402 | 292 |
| 233 | 3300025941 | Ga0207711_10019605 | Ga0207711_100196053 | 292 |
| 234 | 3300025942 | Ga0207689_10037463 | Ga0207689_100374634 | 292 |
| 235 | 3300025945 | Ga0207679_10005738 | Ga0207679_1000573811 | 292 |
| 236 | 3300025945 | Ga0207679_10121147 | Ga0207679_101211472 | 292 |
| 237 | 3300025949 | Ga0207667_10002797 | Ga0207667_1000279716 | 292 |
| 238 | 3300025960 | Ga0207651_10007695 | Ga0207651_100076953 | 292 |
| 239 | 3300025960 | Ga0207651_10035662 | Ga0207651_100356623 | 292 |
| 240 | 3300025972 | Ga0207668_10034452 | Ga0207668_100344522 | 292 |
| 241 | 3300025986 | Ga0207658_10058879 | Ga0207658_100588793 | 292 |
| 242 | 3300026023 | Ga0207677_10120407 | Ga0207677_101204072 | 292 |
| 243 | 3300026023 | Ga0207677_10560265 | Ga0207677_105602651 | 292 |
| 244 | 3300026035 | Ga0207703_10262531 | Ga0207703_102625312 | 292 |
| 245 | 3300026067 | Ga0207678_10032495 | Ga0207678_100324954 | 292 |
| 246 | 3300026078 | Ga0207702_10006364 | Ga0207702_100063645 | 292 |
| 247 | 3300026078 | Ga0207702_10270514 | Ga0207702_102705142 | 292 |
| 248 | 3300026089 | Ga0207648_10220136 | Ga0207648_102201362 | 292 |
| 249 | 3300026095 | Ga0207676_10182574 | Ga0207676_101825741 | 292 |
| 250 | 3300026095 | Ga0207676_10391478 | Ga0207676_103914782 | 292 |
| 251 | 3300026095 | Ga0207676_10647995 | Ga0207676_106479951 | 292 |
| 252 | 3300026116 | Ga0207674_10131513 | Ga0207674_101315133 | 292 |
| 253 | 3300026116 | Ga0207674_10154073 | Ga0207674_101540732 | 292 |
| 254 | 3300026118 | Ga0207675_100207949 | Ga0207675_1002079492 | 292 |
| 255 | 3300027552 | Ga0209982_1019615 | Ga0209982_10196152 | 292 |
| 256 | 3300027617 | Ga0210002_1011274 | Ga0210002_10112741 | 292 |
| 257 | 3300027665 | Ga0209983_1002922 | Ga0209983_10029222 | 292 |
| 258 | 3300027682 | Ga0209971_1028964 | Ga0209971_10289642 | 292 |
| 259 | 3300027695 | Ga0209966_1004389 | Ga0209966_10043892 | 292 |
| 260 | 3300027876 | Ga0209974_10007375 | Ga0209974_100073752 | 292 |
| 261 | 3300028379 | Ga0268266_10210787 | Ga0268266_102107872 | 292 |
| 262 | 3300028380 | Ga0268265_10074241 | Ga0268265_100742413 | 292 |
| 263 | 3300028381 | Ga0268264_10089344 | Ga0268264_100893443 | 292 |
| 264 | 3300028794 | Ga0307515_10000417 | Ga0307515_100004172 | 292 |
| 265 | 3300028794 | Ga0307515_10091248 | Ga0307515_100912482 | 292 |
| 266 | 3300030522 | Ga0307512_10031625 | Ga0307512_100316253 | 292 |
| 267 | 3300031456 | Ga0307513_10002513 | Ga0307513_1000251315 | 292 |
| 268 | 3300031507 | Ga0307509_10001694 | Ga0307509_1000169410 | 292 |
| 269 | 3300031507 | Ga0307509_10096881 | Ga0307509_100968812 | 292 |
| 270 | 3300031548 | Ga0307408_100000072 | Ga0307408_10000007226 | 292 |
| 271 | 3300031548 | Ga0307408_100057624 | Ga0307408_1000576242 | 292 |
| 272 | 3300031548 | Ga0307408_100086284 | Ga0307408_1000862842 | 292 |
| 273 | 3300031649 | Ga0307514_10056335 | Ga0307514_100563352 | 292 |
| 274 | 3300031730 | Ga0307516_10000705 | Ga0307516_1000070520 | 292 |
| 275 | 3300031731 | Ga0307405_10013240 | Ga0307405_100132404 | 292 |
| 276 | 3300031824 | Ga0307413_10005108 | Ga0307413_100051086 | 292 |
| 277 | 3300031901 | Ga0307406_10000278 | Ga0307406_1000027826 | 292 |
| 278 | 3300031901 | Ga0307406_10004493 | Ga0307406_100044932 | 292 |
| 279 | 3300031911 | Ga0307412_10004381 | Ga0307412_100043818 | 292 |
| 280 | 3300031995 | Ga0307409_100010785 | Ga0307409_1000107856 | 292 |
| 281 | 3300032002 | Ga0307416_100022062 | Ga0307416_1000220622 | 292 |
| 282 | 3300035085 | Ga0373929_0020793 | Ga0373929_0020793_397_1281 | 292 |
| 283 | 3300037068 | Ga0373925_0152105 | Ga0373925_0152105_515_1393 | 292 |
| 284 | 3300041997 | Ga0439431_0009732 | Ga0439431_0009732_360_1301 | 292 |
| 285 | 3300042004 | Ga0439445_0022983 | Ga0439445_0022983_303_1244 | 292 |
| 286 | 3300042012 | Ga0439455_0058532 | Ga0439455_0058532_26_910 | 292 |
| 287 | 3300042129 | Ga0450891_006399 | Ga0450891_006399_11_952 | 292 |
| 288 | 3300042435 | Ga0439434_0026031 | Ga0439434_0026031_784_1725 | 292 |
| 289 | 3300046454 | Ga0495592_0000264 | Ga0495592_0000264_9111_9989 | 292 |
| 290 | 3300046457 | Ga0495590_0018748 | Ga0495590_0018748_1130_2017 | 292 |
| 291 | 3300046512 | Ga0495610_0036459 | Ga0495610_0036459_226_1104 | 292 |
| 292 | 3300046690 | Ga0495624_0199029 | Ga0495624_0199029_313_1191 | 292 |
| 293 | 3300046694 | Ga0495649_0025268 | Ga0495649_0025268_1539_2432 | 292 |
| 294 | 3300047321 | Ga0495676_0289302 | Ga0495676_0289302_143_1021 | 292 |
| 295 | 3300047673 | Ga0495593_0022467 | Ga0495593_0022467_1939_2817 | 292 |
| 296 | 3300048088 | Ga0495602_0275707 | Ga0495602_0275707_239_1117 | 292 |
| 297 | 3300048905 | Ga0496102_0003078 | Ga0496102_0003078_4662_5546 | 292 |
| 298 | 3300048905 | Ga0496102_0205363 | Ga0496102_0205363_550_1431 | 292 |
| 299 | 3300048909 | Ga0496106_0002588 | Ga0496106_0002588_8990_9874 | 292 |
| 300 | 3300048909 | Ga0496106_0084117 | Ga0496106_0084117_1276_2157 | 292 |
| 301 | 3300048910 | Ga0496107_0002385 | Ga0496107_0002385_347_1231 | 292 |
| 302 | 3300048927 | Ga0496124_0003260 | Ga0496124_0003260_3085_3966 | 292 |
| 303 | 3300048928 | Ga0496125_0005292 | Ga0496125_0005292_11105_11986 | 292 |
| 304 | 3300049523 | Ga0501300_017066 | Ga0501300_017066_32_1003 | 292 |
| 305 | 3300050493 | nmdc:mga0k408_81863_c1 | nmdc:mga0k408_81863_c1_436_1314 | 292 |
| 306 | 3300050511 | nmdc:mga08y16_120385_c1 | nmdc:mga08y16_120385_c1_592_1470 | 292 |
| 307 | 3300050512 | nmdc:mga0n895_296568_c1 | nmdc:mga0n895_296568_c1_75_956 | 292 |
| 308 | 3300053093 | Ga0500651_0027117 | Ga0500651_0027117_2067_2945 | 292 |
| 309 | 3300053136 | Ga0500559_0000092 | Ga0500559_0000092_40132_41010 | 292 |
| 310 | 3300005328 | Ga0070676_10012793 | Ga0070676_100127933 | 293 |
| 311 | 3300005329 | Ga0070683_100239441 | Ga0070683_1002394412 | 293 |
| 312 | 3300005330 | Ga0070690_100000663 | Ga0070690_1000006636 | 293 |
| 313 | 3300005331 | Ga0070670_100008053 | Ga0070670_1000080535 | 293 |
| 314 | 3300005331 | Ga0070670_100017699 | Ga0070670_1000176991 | 293 |
| 315 | 3300005334 | Ga0068869_100000481 | Ga0068869_10000048111 | 293 |
| 316 | 3300005334 | Ga0068869_100075037 | Ga0068869_1000750373 | 293 |
| 317 | 3300005334 | Ga0068869_100125862 | Ga0068869_1001258622 | 293 |
| 318 | 3300005335 | Ga0070666_10000745 | Ga0070666_100007455 | 293 |
| 319 | 3300005336 | Ga0070680_100049561 | Ga0070680_1000495613 | 293 |
| 320 | 3300005338 | Ga0068868_100000971 | Ga0068868_10000097112 | 293 |
| 321 | 3300005338 | Ga0068868_100065210 | Ga0068868_1000652103 | 293 |
| 322 | 3300005339 | Ga0070660_100083033 | Ga0070660_1000830332 | 293 |
| 323 | 3300005340 | Ga0070689_100002088 | Ga0070689_1000020885 | 293 |
| 324 | 3300005344 | Ga0070661_100057524 | Ga0070661_1000575243 | 293 |
| 325 | 3300005345 | Ga0070692_10019480 | Ga0070692_100194804 | 293 |
| 326 | 3300005347 | Ga0070668_100033478 | Ga0070668_1000334783 | 293 |
| 327 | 3300005347 | Ga0070668_100062380 | Ga0070668_1000623802 | 293 |
| 328 | 3300005353 | Ga0070669_100004947 | Ga0070669_1000049472 | 293 |
| 329 | 3300005353 | Ga0070669_100053187 | Ga0070669_1000531872 | 293 |
| 330 | 3300005353 | Ga0070669_100417334 | Ga0070669_1004173342 | 293 |
| 331 | 3300005355 | Ga0070671_100001053 | Ga0070671_10000105320 | 293 |
| 332 | 3300005355 | Ga0070671_100196745 | Ga0070671_1001967451 | 293 |
| 333 | 3300005356 | Ga0070674_100057087 | Ga0070674_1000570872 | 293 |
| 334 | 3300005364 | Ga0070673_100007976 | Ga0070673_1000079764 | 293 |
| 335 | 3300005364 | Ga0070673_100211783 | Ga0070673_1002117831 | 293 |
| 336 | 3300005365 | Ga0070688_100002954 | Ga0070688_10000295410 | 293 |
| 337 | 3300005366 | Ga0070659_100086147 | Ga0070659_1000861472 | 293 |
| 338 | 3300005367 | Ga0070667_100001469 | Ga0070667_10000146911 | 293 |
| 339 | 3300005367 | Ga0070667_100004231 | Ga0070667_10000423112 | 293 |
| 340 | 3300005367 | Ga0070667_100020817 | Ga0070667_1000208175 | 293 |
| 341 | 3300005434 | Ga0070709_10077929 | Ga0070709_100779292 | 293 |
| 342 | 3300005435 | Ga0070714_100052026 | Ga0070714_1000520265 | 293 |
| 343 | 3300005436 | Ga0070713_100003384 | Ga0070713_1000033841 | 293 |
| 344 | 3300005436 | Ga0070713_100216577 | Ga0070713_1002165772 | 293 |
| 345 | 3300005439 | Ga0070711_100004626 | Ga0070711_1000046266 | 293 |
| 346 | 3300005440 | Ga0070705_100004377 | Ga0070705_1000043775 | 293 |
| 347 | 3300005441 | Ga0070700_100060479 | Ga0070700_1000604792 | 293 |
| 348 | 3300005444 | Ga0070694_100025464 | Ga0070694_1000254645 | 293 |
| 349 | 3300005445 | Ga0070708_100031577 | Ga0070708_1000315776 | 293 |
| 350 | 3300005458 | Ga0070681_10076070 | Ga0070681_100760703 | 293 |
| 351 | 3300005459 | Ga0068867_100003168 | Ga0068867_1000031686 | 293 |
| 352 | 3300005459 | Ga0068867_100007271 | Ga0068867_1000072713 | 293 |
| 353 | 3300005466 | Ga0070685_10011495 | Ga0070685_100114955 | 293 |
| 354 | 3300005468 | Ga0070707_100184969 | Ga0070707_1001849692 | 293 |
| 355 | 3300005471 | Ga0070698_100448861 | Ga0070698_1004488612 | 293 |
| 356 | 3300005518 | Ga0070699_100258697 | Ga0070699_1002586972 | 293 |
| 357 | 3300005535 | Ga0070684_100169006 | Ga0070684_1001690062 | 293 |
| 358 | 3300005536 | Ga0070697_100149793 | Ga0070697_1001497932 | 293 |
| 359 | 3300005539 | Ga0068853_100286500 | Ga0068853_1002865001 | 293 |
| 360 | 3300005543 | Ga0070672_100083034 | Ga0070672_1000830342 | 293 |
| 361 | 3300005543 | Ga0070672_100094808 | Ga0070672_1000948082 | 293 |
| 362 | 3300005543 | Ga0070672_100121904 | Ga0070672_1001219042 | 293 |
| 363 | 3300005544 | Ga0070686_100087863 | Ga0070686_1000878632 | 293 |
| 364 | 3300005546 | Ga0070696_100069276 | Ga0070696_1000692763 | 293 |
| 365 | 3300005547 | Ga0070693_100016671 | Ga0070693_1000166711 | 293 |
| 366 | 3300005547 | Ga0070693_100098940 | Ga0070693_1000989401 | 293 |
| 367 | 3300005548 | Ga0070665_100001402 | Ga0070665_10000140219 | 293 |
| 368 | 3300005548 | Ga0070665_100158672 | Ga0070665_1001586722 | 293 |
| 369 | 3300005548 | Ga0070665_100499930 | Ga0070665_1004999302 | 293 |
| 370 | 3300005549 | Ga0070704_100278957 | Ga0070704_1002789572 | 293 |
| 371 | 3300005563 | Ga0068855_100129567 | Ga0068855_1001295673 | 293 |
| 372 | 3300005577 | Ga0068857_100007102 | Ga0068857_1000071029 | 293 |
| 373 | 3300005578 | Ga0068854_100047229 | Ga0068854_1000472292 | 293 |
| 374 | 3300005614 | Ga0068856_100171183 | Ga0068856_1001711831 | 293 |
| 375 | 3300005615 | Ga0070702_100010808 | Ga0070702_1000108085 | 293 |
| 376 | 3300005615 | Ga0070702_100262853 | Ga0070702_1002628532 | 293 |
| 377 | 3300005616 | Ga0068852_100110416 | Ga0068852_1001104161 | 293 |
| 378 | 3300005616 | Ga0068852_100212494 | Ga0068852_1002124942 | 293 |
| 379 | 3300005617 | Ga0068859_100000893 | Ga0068859_10000089325 | 293 |
| 380 | 3300005617 | Ga0068859_100001169 | Ga0068859_10000116911 | 293 |
| 381 | 3300005618 | Ga0068864_100002752 | Ga0068864_10000275210 | 293 |
| 382 | 3300005618 | Ga0068864_100009929 | Ga0068864_1000099299 | 293 |
| 383 | 3300005718 | Ga0068866_10022409 | Ga0068866_100224094 | 293 |
| 384 | 3300005719 | Ga0068861_100001611 | Ga0068861_10000161110 | 293 |
| 385 | 3300005719 | Ga0068861_100002388 | Ga0068861_10000238810 | 293 |
| 386 | 3300005719 | Ga0068861_100225580 | Ga0068861_1002255802 | 293 |
| 387 | 3300005840 | Ga0068870_10022611 | Ga0068870_100226112 | 293 |
| 388 | 3300005840 | Ga0068870_10071014 | Ga0068870_100710142 | 293 |
| 389 | 3300005841 | Ga0068863_100000521 | Ga0068863_10000052126 | 293 |
| 390 | 3300005841 | Ga0068863_100003595 | Ga0068863_10000359510 | 293 |
| 391 | 3300005842 | Ga0068858_100003010 | Ga0068858_10000301014 | 293 |
| 392 | 3300005842 | Ga0068858_100012873 | Ga0068858_1000128737 | 293 |
| 393 | 3300005843 | Ga0068860_100001084 | Ga0068860_10000108417 | 293 |
| 394 | 3300005843 | Ga0068860_100003063 | Ga0068860_10000306312 | 293 |
| 395 | 3300005843 | Ga0068860_100005415 | Ga0068860_1000054159 | 293 |
| 396 | 3300005844 | Ga0068862_100013035 | Ga0068862_1000130356 | 293 |
| 397 | 3300006042 | Ga0075368_10112944 | Ga0075368_101129442 | 293 |
| 398 | 3300006173 | Ga0070716_100005733 | Ga0070716_1000057337 | 293 |
| 399 | 3300006175 | Ga0070712_100014560 | Ga0070712_1000145602 | 293 |
| 400 | 3300006178 | Ga0075367_10033023 | Ga0075367_100330233 | 293 |
| 401 | 3300006178 | Ga0075367_10044392 | Ga0075367_100443924 | 293 |
| 402 | 3300006195 | Ga0075366_10011317 | Ga0075366_100113176 | 293 |
| 403 | 3300006195 | Ga0075366_10016722 | Ga0075366_100167225 | 293 |
| 404 | 3300006195 | Ga0075366_10041574 | Ga0075366_100415743 | 293 |
| 405 | 3300006237 | Ga0097621_100014273 | Ga0097621_1000142736 | 293 |
| 406 | 3300006353 | Ga0075370_10002345 | Ga0075370_1000234510 | 293 |
| 407 | 3300006353 | Ga0075370_10207202 | Ga0075370_102072022 | 293 |
| 408 | 3300006358 | Ga0068871_100017564 | Ga0068871_1000175642 | 293 |
| 409 | 3300006881 | Ga0068865_100003419 | Ga0068865_1000034198 | 293 |
| 410 | 3300006931 | Ga0097620_100000893 | Ga0097620_10000089325 | 293 |
| 411 | 3300006931 | Ga0097620_100001169 | Ga0097620_10000116917 | 293 |
| 412 | 3300009093 | Ga0105240_10038834 | Ga0105240_100388343 | 293 |
| 413 | 3300009094 | Ga0111539_10092046 | Ga0111539_100920462 | 293 |
| 414 | 3300009098 | Ga0105245_10001644 | Ga0105245_100016442 | 293 |
| 415 | 3300009098 | Ga0105245_10007857 | Ga0105245_100078573 | 293 |
| 416 | 3300009101 | Ga0105247_10064396 | Ga0105247_100643962 | 293 |
| 417 | 3300009101 | Ga0105247_10200821 | Ga0105247_102008212 | 293 |
| 418 | 3300009147 | Ga0114129_10321911 | Ga0114129_103219112 | 293 |
| 419 | 3300009174 | Ga0105241_10067553 | Ga0105241_100675532 | 293 |
| 420 | 3300009177 | Ga0105248_10008045 | Ga0105248_1000804510 | 293 |
| 421 | 3300009177 | Ga0105248_10035492 | Ga0105248_100354926 | 293 |
| 422 | 3300009545 | Ga0105237_10016342 | Ga0105237_100163426 | 293 |
| 423 | 3300009553 | Ga0105249_10109533 | Ga0105249_101095333 | 293 |
| 424 | 3300010375 | Ga0105239_10817732 | Ga0105239_108177322 | 293 |
| 425 | 3300013105 | Ga0157369_10303625 | Ga0157369_103036252 | 293 |
| 426 | 3300013296 | Ga0157374_10002838 | Ga0157374_100028384 | 293 |
| 427 | 3300013297 | Ga0157378_10001679 | Ga0157378_1000167910 | 293 |
| 428 | 3300013297 | Ga0157378_10005473 | Ga0157378_100054736 | 293 |
| 429 | 3300013297 | Ga0157378_10505201 | Ga0157378_105052011 | 293 |
| 430 | 3300013306 | Ga0163162_10001712 | Ga0163162_100017127 | 293 |
| 431 | 3300013306 | Ga0163162_10001908 | Ga0163162_1000190815 | 293 |
| 432 | 3300013308 | Ga0157375_10025955 | Ga0157375_100259556 | 293 |
| 433 | 3300013308 | Ga0157375_10161320 | Ga0157375_101613202 | 293 |
| 434 | 3300013308 | Ga0157375_10228948 | Ga0157375_102289481 | 293 |
| 435 | 3300014325 | Ga0163163_10009939 | Ga0163163_100099396 | 293 |
| 436 | 3300014325 | Ga0163163_10311104 | Ga0163163_103111041 | 293 |
| 437 | 3300014326 | Ga0157380_10071614 | Ga0157380_100716142 | 293 |
| 438 | 3300014745 | Ga0157377_10104944 | Ga0157377_101049442 | 293 |
| 439 | 3300014968 | Ga0157379_10001362 | Ga0157379_1000136217 | 293 |
| 440 | 3300014968 | Ga0157379_10002571 | Ga0157379_1000257110 | 293 |
| 441 | 3300014968 | Ga0157379_10066080 | Ga0157379_100660802 | 293 |
| 442 | 3300014969 | Ga0157376_10001750 | Ga0157376_1000175012 | 293 |
| 443 | 3300017792 | Ga0163161_10020125 | Ga0163161_100201252 | 293 |
| 444 | 3300025321 | Ga0207656_10133863 | Ga0207656_101338631 | 293 |
| 445 | 3300025899 | Ga0207642_10089583 | Ga0207642_100895832 | 293 |
| 446 | 3300025900 | Ga0207710_10043600 | Ga0207710_100436001 | 293 |
| 447 | 3300025900 | Ga0207710_10074938 | Ga0207710_100749382 | 293 |
| 448 | 3300025903 | Ga0207680_10000783 | Ga0207680_100007836 | 293 |
| 449 | 3300025906 | Ga0207699_10078508 | Ga0207699_100785082 | 293 |
| 450 | 3300025907 | Ga0207645_10045451 | Ga0207645_100454512 | 293 |
| 451 | 3300025907 | Ga0207645_10046267 | Ga0207645_100462673 | 293 |
| 452 | 3300025908 | Ga0207643_10032638 | Ga0207643_100326382 | 293 |
| 453 | 3300025908 | Ga0207643_10079987 | Ga0207643_100799872 | 293 |
| 454 | 3300025912 | Ga0207707_10427262 | Ga0207707_104272621 | 293 |
| 455 | 3300025913 | Ga0207695_10029322 | Ga0207695_100293222 | 293 |
| 456 | 3300025915 | Ga0207693_10001071 | Ga0207693_100010719 | 293 |
| 457 | 3300025916 | Ga0207663_10280088 | Ga0207663_102800881 | 293 |
| 458 | 3300025917 | Ga0207660_10060768 | Ga0207660_100607684 | 293 |
| 459 | 3300025918 | Ga0207662_10051405 | Ga0207662_100514051 | 293 |
| 460 | 3300025923 | Ga0207681_10008779 | Ga0207681_100087792 | 293 |
| 461 | 3300025925 | Ga0207650_10008631 | Ga0207650_100086314 | 293 |
| 462 | 3300025925 | Ga0207650_10011427 | Ga0207650_100114279 | 293 |
| 463 | 3300025926 | Ga0207659_10008305 | Ga0207659_100083053 | 293 |
| 464 | 3300025927 | Ga0207687_10000226 | Ga0207687_1000022612 | 293 |
| 465 | 3300025927 | Ga0207687_10003096 | Ga0207687_1000309610 | 293 |
| 466 | 3300025927 | Ga0207687_10443291 | Ga0207687_104432911 | 293 |
| 467 | 3300025928 | Ga0207700_10029862 | Ga0207700_100298624 | 293 |
| 468 | 3300025928 | Ga0207700_10044625 | Ga0207700_100446253 | 293 |
| 469 | 3300025929 | Ga0207664_10009233 | Ga0207664_100092337 | 293 |
| 470 | 3300025931 | Ga0207644_10007852 | Ga0207644_100078527 | 293 |
| 471 | 3300025933 | Ga0207706_10001944 | Ga0207706_1000194413 | 293 |
| 472 | 3300025934 | Ga0207686_10003018 | Ga0207686_100030183 | 293 |
| 473 | 3300025935 | Ga0207709_10114981 | Ga0207709_101149812 | 293 |
| 474 | 3300025936 | Ga0207670_10035858 | Ga0207670_100358582 | 293 |
| 475 | 3300025936 | Ga0207670_10250291 | Ga0207670_102502912 | 293 |
| 476 | 3300025937 | Ga0207669_10121511 | Ga0207669_101215112 | 293 |
| 477 | 3300025937 | Ga0207669_10279444 | Ga0207669_102794442 | 293 |
| 478 | 3300025938 | Ga0207704_10002798 | Ga0207704_100027986 | 293 |
| 479 | 3300025939 | Ga0207665_10060503 | Ga0207665_100605032 | 293 |
| 480 | 3300025940 | Ga0207691_10062634 | Ga0207691_100626342 | 293 |
| 481 | 3300025940 | Ga0207691_10074024 | Ga0207691_100740243 | 293 |
| 482 | 3300025940 | Ga0207691_10124161 | Ga0207691_101241612 | 293 |
| 483 | 3300025941 | Ga0207711_10000654 | Ga0207711_1000065415 | 293 |
| 484 | 3300025941 | Ga0207711_10008005 | Ga0207711_100080058 | 293 |
| 485 | 3300025942 | Ga0207689_10001081 | Ga0207689_1000108112 | 293 |
| 486 | 3300025944 | Ga0207661_10072017 | Ga0207661_100720172 | 293 |
| 487 | 3300025960 | Ga0207651_10052487 | Ga0207651_100524872 | 293 |
| 488 | 3300025960 | Ga0207651_10117798 | Ga0207651_101177982 | 293 |
| 489 | 3300025961 | Ga0207712_10018508 | Ga0207712_100185082 | 293 |
| 490 | 3300025972 | Ga0207668_10002950 | Ga0207668_100029506 | 293 |
| 491 | 3300025981 | Ga0207640_10044617 | Ga0207640_100446173 | 293 |
| 492 | 3300025981 | Ga0207640_10478336 | Ga0207640_104783362 | 293 |
| 493 | 3300025986 | Ga0207658_10006949 | Ga0207658_1000694912 | 293 |
| 494 | 3300025986 | Ga0207658_10022771 | Ga0207658_100227712 | 293 |
| 495 | 3300026023 | Ga0207677_10000162 | Ga0207677_1000016234 | 293 |
| 496 | 3300026023 | Ga0207677_10197178 | Ga0207677_101971782 | 293 |
| 497 | 3300026035 | Ga0207703_10001919 | Ga0207703_100019192 | 293 |
| 498 | 3300026035 | Ga0207703_10006661 | Ga0207703_100066619 | 293 |
| 499 | 3300026067 | Ga0207678_10167518 | Ga0207678_101675182 | 293 |
| 500 | 3300026075 | Ga0207708_10036611 | Ga0207708_100366112 | 293 |
| 501 | 3300026088 | Ga0207641_10001702 | Ga0207641_1000170217 | 293 |
| 502 | 3300026088 | Ga0207641_10014054 | Ga0207641_100140542 | 293 |
| 503 | 3300026089 | Ga0207648_10002633 | Ga0207648_1000263310 | 293 |
| 504 | 3300026089 | Ga0207648_10008152 | Ga0207648_100081524 | 293 |
| 505 | 3300026089 | Ga0207648_10050801 | Ga0207648_100508014 | 293 |
| 506 | 3300026095 | Ga0207676_10000451 | Ga0207676_1000045124 | 293 |
| 507 | 3300026095 | Ga0207676_10003663 | Ga0207676_100036633 | 293 |
| 508 | 3300026116 | Ga0207674_10018325 | Ga0207674_100183259 | 293 |
| 509 | 3300026116 | Ga0207674_10026307 | Ga0207674_100263072 | 293 |
| 510 | 3300026118 | Ga0207675_100003236 | Ga0207675_10000323610 | 293 |
| 511 | 3300026118 | Ga0207675_100013521 | Ga0207675_1000135215 | 293 |
| 512 | 3300027866 | Ga0209813_10005461 | Ga0209813_100054612 | 293 |
| 513 | 3300027876 | Ga0209974_10006322 | Ga0209974_100063223 | 293 |
| 514 | 3300027907 | Ga0207428_10251550 | Ga0207428_102515502 | 293 |
| 515 | 3300028379 | Ga0268266_10147323 | Ga0268266_101473231 | 293 |
| 516 | 3300028380 | Ga0268265_10003999 | Ga0268265_100039999 | 293 |
| 517 | 3300028380 | Ga0268265_10006699 | Ga0268265_100066999 | 293 |
| 518 | 3300028380 | Ga0268265_10310188 | Ga0268265_103101882 | 293 |
| 519 | 3300028381 | Ga0268264_10001000 | Ga0268264_1000100014 | 293 |
| 520 | 3300028381 | Ga0268264_10002760 | Ga0268264_100027606 | 293 |
| 521 | 3300028381 | Ga0268264_10049555 | Ga0268264_100495552 | 293 |
| 522 | 3300028786 | Ga0307517_10000358 | Ga0307517_100003588 | 293 |
| 523 | 3300028794 | Ga0307515_10003649 | Ga0307515_1000364931 | 293 |
| 524 | 3300028794 | Ga0307515_10003668 | Ga0307515_1000366819 | 293 |
| 525 | 3300028794 | Ga0307515_10009465 | Ga0307515_100094659 | 293 |
| 526 | 3300028794 | Ga0307515_10010929 | Ga0307515_1001092911 | 293 |
| 527 | 3300030522 | Ga0307512_10055700 | Ga0307512_100557002 | 293 |
| 528 | 3300031238 | Ga0265332_10010522 | Ga0265332_100105223 | 293 |
| 529 | 3300031344 | Ga0265316_10000632 | Ga0265316_1000063220 | 293 |
| 530 | 3300031456 | Ga0307513_10009552 | Ga0307513_100095522 | 293 |
| 531 | 3300031456 | Ga0307513_10025822 | Ga0307513_100258223 | 293 |
| 532 | 3300031456 | Ga0307513_10076015 | Ga0307513_100760154 | 293 |
| 533 | 3300031456 | Ga0307513_10183534 | Ga0307513_101835342 | 293 |
| 534 | 3300031507 | Ga0307509_10005213 | Ga0307509_1000521310 | 293 |
| 535 | 3300031507 | Ga0307509_10017599 | Ga0307509_100175992 | 293 |
| 536 | 3300031507 | Ga0307509_10052291 | Ga0307509_100522913 | 293 |
| 537 | 3300031616 | Ga0307508_10000466 | Ga0307508_1000046633 | 293 |
| 538 | 3300031616 | Ga0307508_10007101 | Ga0307508_100071016 | 293 |
| 539 | 3300031649 | Ga0307514_10000979 | Ga0307514_1000097939 | 293 |
| 540 | 3300031649 | Ga0307514_10004420 | Ga0307514_100044209 | 293 |
| 541 | 3300031730 | Ga0307516_10023079 | Ga0307516_100230797 | 293 |
| 542 | 3300033179 | Ga0307507_10058912 | Ga0307507_100589122 | 293 |
| 543 | 3300035089 | Ga0373944_0048338 | Ga0373944_0048338_204_1163 | 293 |
| 544 | 3300035117 | Ga0373953_0003327 | Ga0373953_0003327_1324_2310 | 293 |
| 545 | 3300035118 | Ga0373954_0027596 | Ga0373954_0027596_194_1180 | 293 |
| 546 | 3300035171 | Ga0373946_0019107 | Ga0373946_0019107_1244_2203 | 293 |
| 547 | 3300035172 | Ga0373955_0039097 | Ga0373955_0039097_260_1246 | 293 |
| 548 | 3300035172 | Ga0373955_0214555 | Ga0373955_0214555_222_1103 | 293 |
| 549 | 3300035692 | Ga0373935_0081080 | Ga0373935_0081080_193_1074 | 293 |
| 550 | 3300035692 | Ga0373935_0092233 | Ga0373935_0092233_98_1084 | 293 |
| 551 | 3300035695 | Ga0373927_0040065 | Ga0373927_0040065_448_1407 | 293 |
| 552 | 3300035724 | Ga0373933_0004441 | Ga0373933_0004441_5284_6270 | 293 |
| 553 | 3300035725 | Ga0373947_0057524 | Ga0373947_0057524_923_1804 | 293 |
| 554 | 3300036401 | Ga0373937_0027808 | Ga0373937_0027808_3410_4291 | 293 |
| 555 | 3300036401 | Ga0373937_0102170 | Ga0373937_0102170_247_1233 | 293 |
| 556 | 3300037068 | Ga0373925_0052445 | Ga0373925_0052445_810_1751 | 293 |
| 557 | 3300037068 | Ga0373925_0054821 | Ga0373925_0054821_1321_2280 | 293 |
| 558 | 3300037068 | Ga0373925_0064722 | Ga0373925_0064722_998_1879 | 293 |
| 559 | 3300041512 | Ga0451853_3400648 | Ga0451853_3400648_23_904 | 293 |
| 560 | 3300042876 | Ga0451577_0102691 | Ga0451577_0102691_761_1702 | 293 |
| 561 | 3300044712 | Ga0453684_0006395 | Ga0453684_0006395_17404_18285 | 293 |
| 562 | 3300045051 | Ga0451576_0298557 | Ga0451576_0298557_563_1504 | 293 |
| 563 | 3300046472 | Ga0495580_0070957 | Ga0495580_0070957_1044_2003 | 293 |
| 564 | 3300046477 | Ga0495664_0033908 | Ga0495664_0033908_40_1026 | 293 |
| 565 | 3300046511 | Ga0495608_0120732 | Ga0495608_0120732_231_1217 | 293 |
| 566 | 3300046519 | Ga0495632_0026840 | Ga0495632_0026840_67_948 | 293 |
| 567 | 3300046519 | Ga0495632_0084916 | Ga0495632_0084916_480_1361 | 293 |
| 568 | 3300046524 | Ga0495648_0076904 | Ga0495648_0076904_195_1076 | 293 |
| 569 | 3300046543 | Ga0495645_0019219 | Ga0495645_0019219_895_1821 | 293 |
| 570 | 3300046660 | Ga0495625_0001726 | Ga0495625_0001726_19961_20842 | 293 |
| 571 | 3300046660 | Ga0495625_0139522 | Ga0495625_0139522_145_1026 | 293 |
| 572 | 3300046679 | Ga0495623_0106309 | Ga0495623_0106309_665_1651 | 293 |
| 573 | 3300047443 | Ga0495687_044482 | Ga0495687_044482_642_1523 | 293 |
| 574 | 3300048905 | Ga0496102_0038160 | Ga0496102_0038160_2507_3388 | 293 |
| 575 | 3300048907 | Ga0496104_0007078 | Ga0496104_0007078_5420_6406 | 293 |
| 576 | 3300048908 | Ga0496105_0001968 | Ga0496105_0001968_13190_14176 | 293 |
| 577 | 3300048909 | Ga0496106_0188970 | Ga0496106_0188970_713_1594 | 293 |
| 578 | 3300048910 | Ga0496107_0143787 | Ga0496107_0143787_514_1500 | 293 |
| 579 | 3300048911 | Ga0496108_0017714 | Ga0496108_0017714_3470_4351 | 293 |
| 580 | 3300048913 | Ga0496110_0101718 | Ga0496110_0101718_311_1192 | 293 |
| 581 | 3300048915 | Ga0496112_0000241 | Ga0496112_0000241_13160_14146 | 293 |
| 582 | 3300048918 | Ga0496115_0079611 | Ga0496115_0079611_723_1709 | 293 |
| 583 | 3300050493 | nmdc:mga0k408_13359_c1 | nmdc:mga0k408_13359_c1_1909_2790 | 293 |
| 584 | 3300050493 | nmdc:mga0k408_51204_c1 | nmdc:mga0k408_51204_c1_1332_2213 | 293 |
| 585 | 3300050494 | nmdc:mga06z11_135992_c1 | nmdc:mga06z11_135992_c1_440_1321 | 293 |
| 586 | 3300050494 | nmdc:mga06z11_5847_c1 | nmdc:mga06z11_5847_c1_2412_3293 | 293 |
| 587 | 3300050495 | nmdc:mga04h51_23644_c1 | nmdc:mga04h51_23644_c1_977_1858 | 293 |
| 588 | 3300050496 | nmdc:mga07m45_247_c1 | nmdc:mga07m45_247_c1_17775_18656 | 293 |
| 589 | 3300050496 | nmdc:mga07m45_41439_c1 | nmdc:mga07m45_41439_c1_548_1429 | 293 |
| 590 | 3300050511 | nmdc:mga08y16_74087_c1 | nmdc:mga08y16_74087_c1_2425_3306 | 293 |
| 591 | 3300053094 | Ga0500566_0014401 | Ga0500566_0014401_1456_2352 | 293 |
| 592 | 3300053134 | Ga0500658_0022941 | Ga0500658_0022941_630_1511 | 293 |
| 593 | 3300053739 | Ga0500587_001176 | Ga0500587_001176_818_1699 | 293 |
| 594 | 3300003316 | rootH1_10007111 | rootH1_100071117 | 294 |
| 595 | 3300003322 | rootL2_10005678 | rootL2_100056787 | 294 |
| 596 | 3300005328 | Ga0070676_10002095 | Ga0070676_100020959 | 294 |
| 597 | 3300005333 | Ga0070677_10013640 | Ga0070677_100136403 | 294 |
| 598 | 3300005334 | Ga0068869_100230042 | Ga0068869_1002300422 | 294 |
| 599 | 3300005334 | Ga0068869_100316416 | Ga0068869_1003164162 | 294 |
| 600 | 3300005338 | Ga0068868_100179767 | Ga0068868_1001797672 | 294 |
| 601 | 3300005353 | Ga0070669_100345896 | Ga0070669_1003458961 | 294 |
| 602 | 3300005354 | Ga0070675_100033406 | Ga0070675_1000334064 | 294 |
| 603 | 3300005456 | Ga0070678_100249031 | Ga0070678_1002490312 | 294 |
| 604 | 3300005457 | Ga0070662_100060606 | Ga0070662_1000606062 | 294 |
| 605 | 3300005459 | Ga0068867_100213831 | Ga0068867_1002138312 | 294 |
| 606 | 3300005467 | Ga0070706_100003222 | Ga0070706_10000322213 | 294 |
| 607 | 3300005543 | Ga0070672_100190163 | Ga0070672_1001901632 | 294 |
| 608 | 3300005577 | Ga0068857_100026898 | Ga0068857_1000268986 | 294 |
| 609 | 3300005577 | Ga0068857_100283073 | Ga0068857_1002830732 | 294 |
| 610 | 3300005578 | Ga0068854_100095261 | Ga0068854_1000952612 | 294 |
| 611 | 3300005617 | Ga0068859_100115911 | Ga0068859_1001159112 | 294 |
| 612 | 3300005841 | Ga0068863_100110964 | Ga0068863_1001109642 | 294 |
| 613 | 3300006042 | Ga0075368_10018558 | Ga0075368_100185582 | 294 |
| 614 | 3300006178 | Ga0075367_10025491 | Ga0075367_100254912 | 294 |
| 615 | 3300006195 | Ga0075366_10029487 | Ga0075366_100294872 | 294 |
| 616 | 3300006237 | Ga0097621_100345009 | Ga0097621_1003450091 | 294 |
| 617 | 3300006353 | Ga0075370_10001742 | Ga0075370_100017425 | 294 |
| 618 | 3300006353 | Ga0075370_10079598 | Ga0075370_100795982 | 294 |
| 619 | 3300006931 | Ga0097620_100115908 | Ga0097620_1001159083 | 294 |
| 620 | 3300009093 | Ga0105240_10030931 | Ga0105240_100309318 | 294 |
| 621 | 3300009098 | Ga0105245_10073690 | Ga0105245_100736903 | 294 |
| 622 | 3300009148 | Ga0105243_10347556 | Ga0105243_103475561 | 294 |
| 623 | 3300009545 | Ga0105237_10044581 | Ga0105237_100445815 | 294 |
| 624 | 3300010375 | Ga0105239_10126723 | Ga0105239_101267232 | 294 |
| 625 | 3300011119 | Ga0105246_10029964 | Ga0105246_100299644 | 294 |
| 626 | 3300013308 | Ga0157375_10031086 | Ga0157375_100310867 | 294 |
| 627 | 3300014745 | Ga0157377_10311090 | Ga0157377_103110901 | 294 |
| 628 | 3300025893 | Ga0207682_10016029 | Ga0207682_100160293 | 294 |
| 629 | 3300025907 | Ga0207645_10001729 | Ga0207645_100017295 | 294 |
| 630 | 3300025908 | Ga0207643_10018090 | Ga0207643_100180904 | 294 |
| 631 | 3300025910 | Ga0207684_10002424 | Ga0207684_100024243 | 294 |
| 632 | 3300025913 | Ga0207695_10107478 | Ga0207695_101074783 | 294 |
| 633 | 3300025914 | Ga0207671_10014637 | Ga0207671_100146374 | 294 |
| 634 | 3300025922 | Ga0207646_10047710 | Ga0207646_100477104 | 294 |
| 635 | 3300025925 | Ga0207650_10038924 | Ga0207650_100389242 | 294 |
| 636 | 3300025927 | Ga0207687_10020926 | Ga0207687_100209263 | 294 |
| 637 | 3300025933 | Ga0207706_10046447 | Ga0207706_100464472 | 294 |
| 638 | 3300025933 | Ga0207706_10109511 | Ga0207706_101095112 | 294 |
| 639 | 3300025940 | Ga0207691_10029845 | Ga0207691_100298456 | 294 |
| 640 | 3300025940 | Ga0207691_10310597 | Ga0207691_103105971 | 294 |
| 641 | 3300025960 | Ga0207651_10001587 | Ga0207651_1000158711 | 294 |
| 642 | 3300025981 | Ga0207640_10103978 | Ga0207640_101039782 | 294 |
| 643 | 3300026023 | Ga0207677_10020074 | Ga0207677_100200745 | 294 |
| 644 | 3300026088 | Ga0207641_10045270 | Ga0207641_100452703 | 294 |
| 645 | 3300026089 | Ga0207648_10003584 | Ga0207648_1000358411 | 294 |
| 646 | 3300026116 | Ga0207674_10003102 | Ga0207674_1000310211 | 294 |
| 647 | 3300026116 | Ga0207674_10019808 | Ga0207674_100198087 | 294 |
| 648 | 3300026121 | Ga0207683_10085353 | Ga0207683_100853533 | 294 |
| 649 | 3300031730 | Ga0307516_10190063 | Ga0307516_101900632 | 294 |
| 650 | 3300046517 | Ga0495630_0058507 | Ga0495630_0058507_1949_2833 | 294 |
| 651 | 3300046530 | Ga0495654_0002750 | Ga0495654_0002750_5023_5976 | 294 |
| 652 | 3300046557 | Ga0495622_0079260 | Ga0495622_0079260_612_1496 | 294 |
| 653 | 3300046694 | Ga0495649_0015742 | Ga0495649_0015742_1426_2310 | 294 |
| 654 | 3300047443 | Ga0495687_000212 | Ga0495687_000212_35883_36779 | 294 |
| 655 | 3300050489 | nmdc:mga03683_36318_c1 | nmdc:mga03683_36318_c1_678_1562 | 294 |
| 656 | 3300050493 | nmdc:mga0k408_20709_c1 | nmdc:mga0k408_20709_c1_508_1392 | 294 |
| 657 | 3300050493 | nmdc:mga0k408_37110_c1 | nmdc:mga0k408_37110_c1_301_1185 | 294 |
| 658 | 3300050494 | nmdc:mga06z11_14050_c1 | nmdc:mga06z11_14050_c1_1369_2253 | 294 |
| 659 | 3300050494 | nmdc:mga06z11_37007_c1 | nmdc:mga06z11_37007_c1_393_1277 | 294 |
| 660 | 3300003215 | JGI25153J46596_10004275 | JGI25153J46596_100042751 | 295 |
| 661 | 3300005295 | Ga0065707_10087932 | Ga0065707_100879322 | 295 |
| 662 | 3300005354 | Ga0070675_100092616 | Ga0070675_1000926161 | 295 |
| 663 | 3300005356 | Ga0070674_100099699 | Ga0070674_1000996993 | 295 |
| 664 | 3300005367 | Ga0070667_100074494 | Ga0070667_1000744943 | 295 |
| 665 | 3300005539 | Ga0068853_100251738 | Ga0068853_1002517382 | 295 |
| 666 | 3300005543 | Ga0070672_100091803 | Ga0070672_1000918032 | 295 |
| 667 | 3300005578 | Ga0068854_100163922 | Ga0068854_1001639222 | 295 |
| 668 | 3300005843 | Ga0068860_100443456 | Ga0068860_1004434562 | 295 |
| 669 | 3300025297 | Ga0209758_1000122 | Ga0209758_100012260 | 295 |
| 670 | 3300025901 | Ga0207688_10138650 | Ga0207688_101386501 | 295 |
| 671 | 3300025931 | Ga0207644_10063586 | Ga0207644_100635863 | 295 |
| 672 | 3300025940 | Ga0207691_10003696 | Ga0207691_1000369618 | 295 |
| 673 | 3300025981 | Ga0207640_10056692 | Ga0207640_100566922 | 295 |
| 674 | 3300025986 | Ga0207658_10079113 | Ga0207658_100791133 | 295 |
| 675 | 3300026035 | Ga0207703_10217221 | Ga0207703_102172212 | 295 |
| 676 | 3300026041 | Ga0207639_10181280 | Ga0207639_101812802 | 295 |
| 677 | 3300026089 | Ga0207648_10035446 | Ga0207648_100354464 | 295 |
| 678 | 3300026118 | Ga0207675_100024008 | Ga0207675_1000240082 | 295 |
| 679 | 3300026121 | Ga0207683_10172285 | Ga0207683_101722853 | 295 |
| 680 | 3300031730 | Ga0307516_10123621 | Ga0307516_101236212 | 295 |
| 681 | 3300041452 | Ga0451793_0421724 | Ga0451793_0421724_857_1747 | 295 |
| 682 | 3300046519 | Ga0495632_0002891 | Ga0495632_0002891_850_1740 | 295 |
| 683 | 3300048916 | Ga0496113_0209016 | Ga0496113_0209016_570_1460 | 295 |
| 684 | 3300053088 | Ga0500644_0154548 | Ga0500644_0154548_18_908 | 295 |
| 685 | 3300053090 | Ga0500646_0001709 | Ga0500646_0001709_4537_5427 | 295 |
| 686 | 3300053092 | Ga0500583_0051795 | Ga0500583_0051795_796_1686 | 295 |
| 687 | 3300053098 | Ga0500650_0033793 | Ga0500650_0033793_843_1733 | 295 |
| 688 | 3300053131 | Ga0500652_001537 | Ga0500652_001537_5162_6052 | 295 |
| 689 | 3300053151 | Ga0500604_0005487 | Ga0500604_0005487_250_1140 | 295 |
| 690 | 3300053156 | Ga0500622_0001110 | Ga0500622_0001110_5636_6526 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7x8e-assembly1.cif.gz_A | crystal structure of pfhppd-y13287 complex | 0.8384 | 15 | 295 |
| 7x8e-assembly3.cif.gz_D-3 | crystal structure of pfhppd-y13287 complex | 0.8358 | 15 | 295 |
| 7xnt-assembly1.cif.gz_B | crystal structure of pfhppd-y13161 complex | 0.8345 | 15 | 295 |
| 7x8e-assembly2.cif.gz_B | crystal structure of pfhppd-y13287 complex | 0.8337 | 15 | 295 |
| 7xnt-assembly1.cif.gz_C | crystal structure of pfhppd-y13161 complex | 0.8315 | 15 | 295 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1cjxD01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9038 | 15 | 159 | 3.10.180.10 |
| 1cjxD01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8697 | 15 | 159 | 3.10.180.10 |
| 2r5vB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7714 | 19 | 151 | 3.10.180.10 |
| 3zgjA02 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7535 | 165 | 289 | 3.10.180.10 |
| 2r5vB01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7458 | 19 | 151 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-N6Z3L8-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 0.9704 | 20 | 290 |
GO:0046872
GO:0051213 |
| AF-K2ELF4-F1-model_v4 | VOC domain-containing protein | 0.9554 | 118 | 290 |
|
| AF-A0A1F4B8T9-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase | 0.9498 | 4 | 290 |
GO:0051213
|
| AF-A0A4Q5X6D5-F1-model_v4 | deleted | 0.9486 | 101 | 294 |
|
| AF-W8X881-F1-model_v4 | 4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27) | 0.9474 | 17 | 295 |
GO:0003868
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar