F475430
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 690 | 342 | 685 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300005458|Ga0070681_10030862|Ga0070681_100308625 |
| Length | 328 |
| Sequence | MPGRDARTVRPGSKALSDYFTISSIKVCYPDAMSGQEIDAIRALLTSKPRPVSWNERRERIDEIGATWPVAADVRLEEVDVDGVPGEWSIVPGSDAARVLMFFHGGGYCSGSIVSHRRMVTEAGRAARMRTLAVRYRLAPEHPYPAAHEDAMTAWRFLRGQGIAARDIAVGGDSAGGNLTITLINRLRAAGEEQPACAWLASPWTDLTMSGASLETKASVDPLIHKAYLEELADCYAPAPIDRKDPLISPLFADLTGFPPVLIQVGSAETLLDDSVRFARAAGLADVNVTLQVWPHMIHAWPMWNAKLAEGRQALAHAGAFMRQWVRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 3 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 4 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 203 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 205 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 207 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 208 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 210 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 216 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 217 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 234 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 237 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 238 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 239 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 242 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 306 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 307 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 308 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 335 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 338 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 339 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 341 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 342 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.42 |
| Metatranscriptomes | 0 |
| Isolates | 0.58 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.01 |
| Nodule | 0.58 |
| Rhizoplane | 10.72 |
| Rhizosphere | 87.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214842432 | 2209111006 | Bacteria | 1703 |
| 2 | ARcpr5oldR_c000052 | 3300000041 | Bacteria | 21384 |
| 3 | ARcpr5yngRDRAFT_c000046 | 3300000043 | Bacteria | 19355 |
| 4 | JGI24746J21847_1000437 | 3300001977 | Bacteria | 6225 |
| 5 | JGI24739J22299_10002728 | 3300001989 | Bacteria | 6797 |
| 6 | JGI24745J21846_1000373 | 3300002073 | Bacteria | 3912 |
| 7 | JGI24748J21848_1000523 | 3300002074 | Bacteria | 4195 |
| 8 | JGI24738J21930_10000045 | 3300002075 | Bacteria | 24599 |
| 9 | JGI24749J21850_1003211 | 3300002076 | Bacteria | 2280 |
| 10 | JGI24033J26618_1001318 | 3300002155 | Bacteria | 2449 |
| 11 | JGI25406J46586_10002241 | 3300003203 | Bacteria | 9125 |
| 12 | JGI25153J46596_10004363 | 3300003215 | Bacteria | 7635 |
| 13 | JGI25404J52841_10003802 | 3300003659 | Bacteria | 3015 |
| 14 | Ga0065712_10026686 | 3300005290 | Bacteria | 2172 |
| 15 | Ga0065712_10087675 | 3300005290 | Bacteria | 2562 |
| 16 | Ga0070676_10000220 | 3300005328 | Bacteria | 24496 |
| 17 | Ga0070676_10098314 | 3300005328 | Bacteria | 1804 |
| 18 | Ga0070683_100000775 | 3300005329 | Bacteria | 23502 |
| 19 | Ga0070690_100009429 | 3300005330 | Bacteria | 5654 |
| 20 | Ga0070670_100005399 | 3300005331 | Bacteria | 10787 |
| 21 | Ga0070677_10000315 | 3300005333 | Bacteria | 16873 |
| 22 | Ga0068869_100000165 | 3300005334 | Bacteria | 33038 |
| 23 | Ga0070680_100020169 | 3300005336 | Bacteria | 5289 |
| 24 | Ga0070682_100000355 | 3300005337 | Bacteria | 31144 |
| 25 | Ga0068868_100112535 | 3300005338 | Bacteria | 2213 |
| 26 | Ga0070660_100001171 | 3300005339 | Bacteria | 17747 |
| 27 | Ga0070660_100045769 | 3300005339 | Bacteria | 3351 |
| 28 | Ga0070689_100000964 | 3300005340 | Bacteria | 17950 |
| 29 | Ga0070689_100198206 | 3300005340 | Bacteria | 1638 |
| 30 | Ga0070691_10000690 | 3300005341 | Bacteria | 13173 |
| 31 | Ga0070687_100000108 | 3300005343 | Bacteria | 28016 |
| 32 | Ga0070661_100001187 | 3300005344 | Bacteria | 18373 |
| 33 | Ga0070661_100028102 | 3300005344 | Bacteria | 4055 |
| 34 | Ga0070661_100184835 | 3300005344 | Bacteria | 1587 |
| 35 | Ga0070661_100205584 | 3300005344 | Bacteria | 1506 |
| 36 | Ga0070692_10013294 | 3300005345 | Bacteria | 3833 |
| 37 | Ga0070668_100001227 | 3300005347 | Bacteria | 18235 |
| 38 | Ga0070668_100012163 | 3300005347 | Bacteria | 6408 |
| 39 | Ga0070668_100019674 | 3300005347 | Bacteria | 5083 |
| 40 | Ga0070668_100085324 | 3300005347 | Bacteria | 2481 |
| 41 | Ga0070669_100000173 | 3300005353 | Bacteria | 56673 |
| 42 | Ga0070669_100059086 | 3300005353 | Bacteria | 2815 |
| 43 | Ga0070675_100008683 | 3300005354 | Bacteria | 7891 |
| 44 | Ga0070675_100009012 | 3300005354 | Bacteria | 7750 |
| 45 | Ga0070675_100187765 | 3300005354 | Bacteria | 1790 |
| 46 | Ga0070671_100001858 | 3300005355 | Bacteria | 16112 |
| 47 | Ga0070671_100059075 | 3300005355 | Bacteria | 3191 |
| 48 | Ga0070674_100000387 | 3300005356 | Bacteria | 22089 |
| 49 | Ga0070674_100006516 | 3300005356 | Bacteria | 6818 |
| 50 | Ga0070673_100003686 | 3300005364 | Bacteria | 9598 |
| 51 | Ga0070688_100000812 | 3300005365 | Bacteria | 15421 |
| 52 | Ga0070688_100126332 | 3300005365 | Bacteria | 1719 |
| 53 | Ga0070659_100001449 | 3300005366 | Bacteria | 17099 |
| 54 | Ga0070659_100008809 | 3300005366 | Bacteria | 7390 |
| 55 | Ga0070659_100082407 | 3300005366 | Bacteria | 2570 |
| 56 | Ga0070659_100264718 | 3300005366 | Bacteria | 1427 |
| 57 | Ga0070667_100002184 | 3300005367 | Bacteria | 17225 |
| 58 | Ga0070703_10005861 | 3300005406 | Bacteria | 3441 |
| 59 | Ga0070714_100034470 | 3300005435 | Bacteria | 4239 |
| 60 | Ga0070713_100001366 | 3300005436 | Bacteria | 15607 |
| 61 | Ga0070713_100003440 | 3300005436 | Bacteria | 10447 |
| 62 | Ga0070713_100128116 | 3300005436 | Bacteria | 2235 |
| 63 | Ga0070713_100385472 | 3300005436 | Bacteria | 1306 |
| 64 | Ga0070710_10004961 | 3300005437 | Bacteria | 6296 |
| 65 | Ga0070701_10000182 | 3300005438 | Bacteria | 19472 |
| 66 | Ga0070711_100003929 | 3300005439 | Bacteria | 8736 |
| 67 | Ga0070711_100087391 | 3300005439 | Bacteria | 2238 |
| 68 | Ga0070711_100104879 | 3300005439 | Bacteria | 2063 |
| 69 | Ga0070711_100129377 | 3300005439 | Bacteria | 1878 |
| 70 | Ga0070705_100001581 | 3300005440 | Bacteria | 11931 |
| 71 | Ga0070700_100000294 | 3300005441 | Bacteria | 26210 |
| 72 | Ga0070700_100015521 | 3300005441 | Bacteria | 4321 |
| 73 | Ga0070700_100103785 | 3300005441 | Bacteria | 1878 |
| 74 | Ga0070694_100017889 | 3300005444 | Bacteria | 4486 |
| 75 | Ga0070694_100025365 | 3300005444 | Bacteria | 3835 |
| 76 | Ga0070694_100062418 | 3300005444 | Bacteria | 2546 |
| 77 | Ga0070708_100063290 | 3300005445 | Bacteria | 3311 |
| 78 | Ga0070663_100000881 | 3300005455 | Bacteria | 16323 |
| 79 | Ga0070663_100054901 | 3300005455 | Bacteria | 2849 |
| 80 | Ga0070678_100000097 | 3300005456 | Bacteria | 33580 |
| 81 | Ga0070678_100064311 | 3300005456 | Bacteria | 2718 |
| 82 | Ga0070678_100073740 | 3300005456 | Bacteria | 2562 |
| 83 | Ga0070678_100187322 | 3300005456 | Bacteria | 1699 |
| 84 | Ga0070662_100018404 | 3300005457 | Bacteria | 4725 |
| 85 | Ga0070662_100149193 | 3300005457 | Bacteria | 1818 |
| 86 | Ga0070681_10000308 | 3300005458 | Bacteria | 39593 |
| 87 | Ga0070681_10030862 | 3300005458 | Bacteria | 5379 |
| 88 | Ga0070681_10574541 | 3300005458 | Bacteria | 1041 |
| 89 | Ga0068867_100001290 | 3300005459 | Bacteria | 17283 |
| 90 | Ga0068867_100083809 | 3300005459 | Bacteria | 2407 |
| 91 | Ga0068867_100089759 | 3300005459 | Bacteria | 2331 |
| 92 | Ga0070685_10003447 | 3300005466 | Bacteria | 8043 |
| 93 | Ga0070698_100085336 | 3300005471 | Bacteria | 3145 |
| 94 | Ga0070698_100363938 | 3300005471 | Bacteria | 1378 |
| 95 | Ga0070679_100001806 | 3300005530 | Bacteria | 19298 |
| 96 | Ga0070679_100142270 | 3300005530 | Bacteria | 2377 |
| 97 | Ga0070679_100147472 | 3300005530 | Bacteria | 2330 |
| 98 | Ga0070679_100443372 | 3300005530 | Bacteria | 1243 |
| 99 | Ga0070684_100000325 | 3300005535 | Bacteria | 32964 |
| 100 | Ga0070684_100106825 | 3300005535 | Bacteria | 2507 |
| 101 | Ga0070684_100388777 | 3300005535 | Bacteria | 1285 |
| 102 | Ga0070697_100123854 | 3300005536 | Bacteria | 2164 |
| 103 | Ga0068853_100009974 | 3300005539 | Bacteria | 7670 |
| 104 | Ga0070672_100034369 | 3300005543 | Bacteria | 3847 |
| 105 | Ga0070686_100001115 | 3300005544 | Bacteria | 15442 |
| 106 | Ga0070686_100246540 | 3300005544 | Bacteria | 1303 |
| 107 | Ga0070695_100001755 | 3300005545 | Bacteria | 12193 |
| 108 | Ga0070695_100004973 | 3300005545 | Bacteria | 7836 |
| 109 | Ga0070696_100000763 | 3300005546 | Bacteria | 20623 |
| 110 | Ga0070693_100000808 | 3300005547 | Bacteria | 13860 |
| 111 | Ga0070693_100041057 | 3300005547 | Bacteria | 2601 |
| 112 | Ga0070665_100188867 | 3300005548 | Bacteria | 2061 |
| 113 | Ga0070665_100207905 | 3300005548 | Bacteria | 1958 |
| 114 | Ga0070665_100406883 | 3300005548 | Bacteria | 1369 |
| 115 | Ga0070704_100000560 | 3300005549 | Bacteria | 17882 |
| 116 | Ga0068855_100035619 | 3300005563 | Bacteria | 5928 |
| 117 | Ga0068855_100273817 | 3300005563 | Bacteria | 1876 |
| 118 | Ga0070664_100000089 | 3300005564 | Bacteria | 58202 |
| 119 | Ga0070664_100142422 | 3300005564 | Bacteria | 2112 |
| 120 | Ga0068857_100000571 | 3300005577 | Bacteria | 26945 |
| 121 | Ga0068857_100451133 | 3300005577 | Bacteria | 1202 |
| 122 | Ga0068854_100001540 | 3300005578 | Bacteria | 13990 |
| 123 | Ga0068856_100001158 | 3300005614 | Bacteria | 27731 |
| 124 | Ga0070702_100000572 | 3300005615 | Bacteria | 13439 |
| 125 | Ga0070702_100254638 | 3300005615 | Bacteria | 1192 |
| 126 | Ga0068852_100001589 | 3300005616 | Bacteria | 15453 |
| 127 | Ga0068852_100058414 | 3300005616 | Bacteria | 3341 |
| 128 | Ga0068852_100278401 | 3300005616 | Bacteria | 1612 |
| 129 | Ga0068852_100473179 | 3300005616 | Bacteria | 1244 |
| 130 | Ga0068859_100071698 | 3300005617 | Bacteria | 3500 |
| 131 | Ga0068859_100100536 | 3300005617 | Bacteria | 2947 |
| 132 | Ga0068864_100006971 | 3300005618 | Bacteria | 9268 |
| 133 | Ga0068864_100221665 | 3300005618 | Bacteria | 1745 |
| 134 | Ga0068864_100373515 | 3300005618 | Bacteria | 1350 |
| 135 | Ga0068866_10001222 | 3300005718 | Bacteria | 11158 |
| 136 | Ga0068861_100001053 | 3300005719 | Bacteria | 16973 |
| 137 | Ga0068861_100010884 | 3300005719 | Bacteria | 6320 |
| 138 | Ga0068861_100050314 | 3300005719 | Bacteria | 3159 |
| 139 | Ga0068861_100129059 | 3300005719 | Bacteria | 2050 |
| 140 | Ga0068870_10000130 | 3300005840 | Bacteria | 25869 |
| 141 | Ga0068863_100008367 | 3300005841 | Bacteria | 10102 |
| 142 | Ga0068863_100011693 | 3300005841 | Bacteria | 8488 |
| 143 | Ga0068863_100328547 | 3300005841 | Bacteria | 1486 |
| 144 | Ga0068858_100009338 | 3300005842 | Bacteria | 9365 |
| 145 | Ga0068858_100112671 | 3300005842 | Bacteria | 2541 |
| 146 | Ga0068858_100162109 | 3300005842 | Bacteria | 2105 |
| 147 | Ga0068860_100005077 | 3300005843 | Bacteria | 13388 |
| 148 | Ga0068860_100013046 | 3300005843 | Bacteria | 8156 |
| 149 | Ga0068860_100090323 | 3300005843 | Bacteria | 2917 |
| 150 | Ga0068860_100334662 | 3300005843 | Bacteria | 1487 |
| 151 | Ga0068862_100005805 | 3300005844 | Bacteria | 10291 |
| 152 | Ga0068862_100047873 | 3300005844 | Bacteria | 3649 |
| 153 | Ga0081455_10000036 | 3300005937 | Bacteria | 136303 |
| 154 | Ga0081455_10007008 | 3300005937 | Bacteria | 11977 |
| 155 | Ga0081455_10011515 | 3300005937 | Bacteria | 8882 |
| 156 | Ga0081455_10021233 | 3300005937 | Bacteria | 6095 |
| 157 | Ga0081455_10027689 | 3300005937 | Bacteria | 5190 |
| 158 | Ga0081540_1000007 | 3300005983 | Bacteria | 205328 |
| 159 | Ga0081540_1003801 | 3300005983 | Bacteria | 11817 |
| 160 | Ga0081540_1004135 | 3300005983 | Bacteria | 11193 |
| 161 | Ga0081540_1005703 | 3300005983 | Bacteria | 9239 |
| 162 | Ga0081540_1020947 | 3300005983 | Bacteria | 3913 |
| 163 | Ga0081540_1023682 | 3300005983 | Bacteria | 3584 |
| 164 | Ga0081539_10000203 | 3300005985 | Bacteria | 138096 |
| 165 | Ga0070717_10000296 | 3300006028 | Bacteria | 33438 |
| 166 | Ga0070717_10004085 | 3300006028 | Bacteria | 10526 |
| 167 | Ga0075432_10011220 | 3300006058 | Bacteria | 3046 |
| 168 | Ga0075432_10026605 | 3300006058 | Bacteria | 1988 |
| 169 | Ga0070715_10142118 | 3300006163 | Bacteria | 1167 |
| 170 | Ga0070716_100005900 | 3300006173 | Bacteria | 5959 |
| 171 | Ga0070716_100005969 | 3300006173 | Bacteria | 5928 |
| 172 | Ga0070716_100029304 | 3300006173 | Bacteria | 2974 |
| 173 | Ga0070716_100140997 | 3300006173 | Bacteria | 1537 |
| 174 | Ga0075427_10001068 | 3300006194 | Bacteria | 3434 |
| 175 | Ga0097621_100000638 | 3300006237 | Bacteria | 24786 |
| 176 | Ga0097621_100261382 | 3300006237 | Bacteria | 1519 |
| 177 | Ga0068871_100006181 | 3300006358 | Bacteria | 8441 |
| 178 | Ga0068871_100186159 | 3300006358 | Bacteria | 1787 |
| 179 | Ga0075428_100021920 | 3300006844 | Bacteria | 7074 |
| 180 | Ga0075428_100148690 | 3300006844 | Bacteria | 2545 |
| 181 | Ga0075430_100001846 | 3300006846 | Bacteria | 17326 |
| 182 | Ga0075430_100018430 | 3300006846 | Bacteria | 5939 |
| 183 | Ga0075430_100027698 | 3300006846 | Bacteria | 4813 |
| 184 | Ga0075430_100027985 | 3300006846 | Bacteria | 4788 |
| 185 | Ga0075431_100020464 | 3300006847 | Bacteria | 6760 |
| 186 | Ga0075431_100033755 | 3300006847 | Bacteria | 5273 |
| 187 | Ga0075431_100036798 | 3300006847 | Bacteria | 5042 |
| 188 | Ga0075431_100039816 | 3300006847 | Bacteria | 4842 |
| 189 | Ga0075431_100095199 | 3300006847 | Bacteria | 3074 |
| 190 | Ga0075433_10001346 | 3300006852 | Bacteria | 18007 |
| 191 | Ga0075433_10038027 | 3300006852 | Bacteria | 4154 |
| 192 | Ga0075433_10094526 | 3300006852 | Bacteria | 2646 |
| 193 | Ga0075434_100000387 | 3300006871 | Bacteria | 32179 |
| 194 | Ga0075434_100009027 | 3300006871 | Bacteria | 9288 |
| 195 | Ga0075434_100032269 | 3300006871 | Bacteria | 5164 |
| 196 | Ga0075434_100045288 | 3300006871 | Bacteria | 4365 |
| 197 | Ga0075434_100077160 | 3300006871 | Bacteria | 3327 |
| 198 | Ga0075434_100295223 | 3300006871 | Bacteria | 1640 |
| 199 | Ga0075429_100009528 | 3300006880 | Bacteria | 8425 |
| 200 | Ga0068865_100003088 | 3300006881 | Bacteria | 9962 |
| 201 | Ga0068865_100158601 | 3300006881 | Bacteria | 1724 |
| 202 | Ga0075436_100095669 | 3300006914 | Bacteria | 2066 |
| 203 | Ga0097620_100071691 | 3300006931 | Bacteria | 3500 |
| 204 | Ga0097620_100100535 | 3300006931 | Bacteria | 2947 |
| 205 | Ga0075435_100006725 | 3300007076 | Bacteria | 8156 |
| 206 | Ga0075435_100017000 | 3300007076 | Bacteria | 5494 |
| 207 | Ga0075435_100032050 | 3300007076 | Bacteria | 4148 |
| 208 | Ga0075435_100318113 | 3300007076 | Bacteria | 1332 |
| 209 | Ga0105240_10098502 | 3300009093 | Bacteria | 3560 |
| 210 | Ga0111539_10000082 | 3300009094 | Bacteria | 96811 |
| 211 | Ga0111539_10005016 | 3300009094 | Bacteria | 17214 |
| 212 | Ga0111539_10009477 | 3300009094 | Bacteria | 12287 |
| 213 | Ga0111539_10568800 | 3300009094 | Bacteria | 1320 |
| 214 | Ga0105245_10006051 | 3300009098 | Bacteria | 10634 |
| 215 | Ga0105245_10084308 | 3300009098 | Bacteria | 2911 |
| 216 | Ga0105245_10239174 | 3300009098 | Bacteria | 1759 |
| 217 | Ga0105245_10609961 | 3300009098 | Bacteria | 1119 |
| 218 | Ga0105247_10055878 | 3300009101 | Bacteria | 2437 |
| 219 | Ga0114129_10007088 | 3300009147 | Bacteria | 15950 |
| 220 | Ga0114129_10027390 | 3300009147 | Bacteria | 8068 |
| 221 | Ga0105243_10001273 | 3300009148 | Bacteria | 22624 |
| 222 | Ga0105243_10121133 | 3300009148 | Bacteria | 2206 |
| 223 | Ga0105241_10000977 | 3300009174 | Bacteria | 21655 |
| 224 | Ga0105241_10043783 | 3300009174 | Bacteria | 3391 |
| 225 | Ga0105242_10000666 | 3300009176 | Bacteria | 26877 |
| 226 | Ga0105242_10038732 | 3300009176 | Bacteria | 3835 |
| 227 | Ga0105242_10063784 | 3300009176 | Bacteria | 3035 |
| 228 | Ga0105242_10119509 | 3300009176 | Bacteria | 2259 |
| 229 | Ga0105248_10083056 | 3300009177 | Bacteria | 3604 |
| 230 | Ga0105248_10230243 | 3300009177 | Bacteria | 2086 |
| 231 | Ga0105237_10073862 | 3300009545 | Bacteria | 3402 |
| 232 | Ga0105237_10095997 | 3300009545 | Bacteria | 2955 |
| 233 | Ga0105237_10167630 | 3300009545 | Bacteria | 2196 |
| 234 | Ga0105249_10138101 | 3300009553 | Bacteria | 2335 |
| 235 | Ga0105249_10152859 | 3300009553 | Bacteria | 2223 |
| 236 | Ga0105249_10303030 | 3300009553 | Bacteria | 1603 |
| 237 | Ga0099796_10017743 | 3300010159 | Bacteria | 2125 |
| 238 | Ga0105239_10006896 | 3300010375 | Bacteria | 13103 |
| 239 | Ga0105246_10075082 | 3300011119 | Bacteria | 2392 |
| 240 | Ga0105246_10261653 | 3300011119 | Bacteria | 1379 |
| 241 | Ga0157373_10026797 | 3300013100 | Bacteria | 4160 |
| 242 | Ga0157370_10025892 | 3300013104 | Bacteria | 5800 |
| 243 | Ga0157370_10271334 | 3300013104 | Bacteria | 1567 |
| 244 | Ga0157369_10433977 | 3300013105 | Bacteria | 1361 |
| 245 | Ga0157374_10001732 | 3300013296 | Bacteria | 18295 |
| 246 | Ga0157378_10007752 | 3300013297 | Bacteria | 9369 |
| 247 | Ga0157378_10114410 | 3300013297 | Bacteria | 2478 |
| 248 | Ga0157378_10260925 | 3300013297 | Bacteria | 1662 |
| 249 | Ga0157378_10411044 | 3300013297 | Bacteria | 1335 |
| 250 | Ga0163162_10001862 | 3300013306 | Bacteria | 19850 |
| 251 | Ga0163162_10019795 | 3300013306 | Bacteria | 6608 |
| 252 | Ga0163162_10220503 | 3300013306 | Bacteria | 2026 |
| 253 | Ga0163162_10558081 | 3300013306 | Bacteria | 1273 |
| 254 | Ga0157372_10088738 | 3300013307 | Bacteria | 3511 |
| 255 | Ga0157372_10703965 | 3300013307 | Bacteria | 1175 |
| 256 | Ga0157375_10000177 | 3300013308 | Bacteria | 59436 |
| 257 | Ga0157375_10055336 | 3300013308 | Bacteria | 3912 |
| 258 | Ga0157375_10080011 | 3300013308 | Bacteria | 3305 |
| 259 | Ga0163163_10068172 | 3300014325 | Bacteria | 3539 |
| 260 | Ga0163163_10443005 | 3300014325 | Bacteria | 1359 |
| 261 | Ga0163163_10699535 | 3300014325 | Bacteria | 1077 |
| 262 | Ga0157380_10000783 | 3300014326 | Bacteria | 19941 |
| 263 | Ga0157380_10011614 | 3300014326 | Bacteria | 6365 |
| 264 | Ga0157380_10231718 | 3300014326 | Bacteria | 1659 |
| 265 | Ga0182008_10094265 | 3300014497 | Bacteria | 1477 |
| 266 | Ga0157377_10009711 | 3300014745 | Bacteria | 4734 |
| 267 | Ga0157377_10017731 | 3300014745 | Bacteria | 3688 |
| 268 | Ga0157379_10017426 | 3300014968 | Bacteria | 6325 |
| 269 | Ga0157379_10017484 | 3300014968 | Bacteria | 6313 |
| 270 | Ga0157379_10039762 | 3300014968 | Bacteria | 4196 |
| 271 | Ga0163161_10002993 | 3300017792 | Bacteria | 11947 |
| 272 | Ga0163161_10113795 | 3300017792 | Bacteria | 2026 |
| 273 | Ga0207666_1000012 | 3300025271 | Bacteria | 43336 |
| 274 | Ga0207673_1000076 | 3300025290 | Bacteria | 8624 |
| 275 | Ga0209758_1000188 | 3300025297 | Bacteria | 138749 |
| 276 | Ga0207697_10000032 | 3300025315 | Bacteria | 50984 |
| 277 | Ga0207682_10002281 | 3300025893 | Bacteria | 8649 |
| 278 | Ga0207642_10000392 | 3300025899 | Bacteria | 13105 |
| 279 | Ga0207642_10065010 | 3300025899 | Bacteria | 1712 |
| 280 | Ga0207642_10189126 | 3300025899 | Bacteria | 1128 |
| 281 | Ga0207710_10043888 | 3300025900 | Bacteria | 1990 |
| 282 | Ga0207688_10002931 | 3300025901 | Bacteria | 9277 |
| 283 | Ga0207647_10005102 | 3300025904 | Bacteria | 9674 |
| 284 | Ga0207647_10014575 | 3300025904 | Bacteria | 5417 |
| 285 | Ga0207699_10031728 | 3300025906 | Bacteria | 2969 |
| 286 | Ga0207699_10152330 | 3300025906 | Bacteria | 1531 |
| 287 | Ga0207645_10000074 | 3300025907 | Bacteria | 71544 |
| 288 | Ga0207643_10006362 | 3300025908 | Bacteria | 6325 |
| 289 | Ga0207654_10002888 | 3300025911 | Bacteria | 8717 |
| 290 | Ga0207707_10001963 | 3300025912 | Bacteria | 18692 |
| 291 | Ga0207707_10209989 | 3300025912 | Bacteria | 1696 |
| 292 | Ga0207695_10320910 | 3300025913 | Bacteria | 1438 |
| 293 | Ga0207695_10349549 | 3300025913 | Bacteria | 1366 |
| 294 | Ga0207671_10236714 | 3300025914 | Bacteria | 1433 |
| 295 | Ga0207671_10472257 | 3300025914 | Bacteria | 999 |
| 296 | Ga0207693_10019018 | 3300025915 | Bacteria | 5467 |
| 297 | Ga0207693_10047508 | 3300025915 | Bacteria | 3372 |
| 298 | Ga0207663_10017896 | 3300025916 | Bacteria | 3958 |
| 299 | Ga0207663_10106671 | 3300025916 | Bacteria | 1894 |
| 300 | Ga0207660_10000243 | 3300025917 | Bacteria | 35432 |
| 301 | Ga0207660_10235785 | 3300025917 | Bacteria | 1440 |
| 302 | Ga0207662_10000753 | 3300025918 | Bacteria | 14841 |
| 303 | Ga0207662_10034315 | 3300025918 | Bacteria | 2961 |
| 304 | Ga0207657_10002717 | 3300025919 | Bacteria | 19047 |
| 305 | Ga0207657_10021647 | 3300025919 | Bacteria | 6043 |
| 306 | Ga0207649_10000201 | 3300025920 | Bacteria | 49824 |
| 307 | Ga0207649_10067758 | 3300025920 | Bacteria | 2267 |
| 308 | Ga0207652_10059276 | 3300025921 | Bacteria | 3299 |
| 309 | Ga0207652_10388815 | 3300025921 | Bacteria | 1259 |
| 310 | Ga0207681_10000375 | 3300025923 | Bacteria | 31652 |
| 311 | Ga0207681_10095323 | 3300025923 | Bacteria | 2134 |
| 312 | Ga0207694_10042227 | 3300025924 | Bacteria | 3517 |
| 313 | Ga0207650_10026632 | 3300025925 | Bacteria | 4127 |
| 314 | Ga0207650_10113387 | 3300025925 | Bacteria | 2102 |
| 315 | Ga0207659_10000039 | 3300025926 | Bacteria | 91685 |
| 316 | Ga0207659_10038137 | 3300025926 | Bacteria | 3340 |
| 317 | Ga0207687_10000347 | 3300025927 | Bacteria | 30794 |
| 318 | Ga0207700_10001101 | 3300025928 | Bacteria | 15581 |
| 319 | Ga0207700_10001324 | 3300025928 | Bacteria | 14056 |
| 320 | Ga0207700_10209165 | 3300025928 | Bacteria | 1648 |
| 321 | Ga0207664_10081969 | 3300025929 | Bacteria | 2627 |
| 322 | Ga0207644_10001356 | 3300025931 | Bacteria | 15748 |
| 323 | Ga0207644_10012872 | 3300025931 | Bacteria | 5563 |
| 324 | Ga0207644_10102751 | 3300025931 | Bacteria | 2150 |
| 325 | Ga0207690_10000271 | 3300025932 | Bacteria | 36932 |
| 326 | Ga0207690_10143017 | 3300025932 | Bacteria | 1765 |
| 327 | Ga0207706_10008840 | 3300025933 | Bacteria | 9271 |
| 328 | Ga0207706_10013956 | 3300025933 | Bacteria | 7285 |
| 329 | Ga0207706_10071135 | 3300025933 | Bacteria | 3059 |
| 330 | Ga0207706_10127011 | 3300025933 | Bacteria | 2242 |
| 331 | Ga0207706_10197750 | 3300025933 | Bacteria | 1763 |
| 332 | Ga0207686_10000698 | 3300025934 | Bacteria | 20815 |
| 333 | Ga0207686_10077443 | 3300025934 | Bacteria | 2159 |
| 334 | Ga0207686_10292788 | 3300025934 | Bacteria | 1206 |
| 335 | Ga0207709_10003374 | 3300025935 | Bacteria | 9539 |
| 336 | Ga0207709_10152052 | 3300025935 | Bacteria | 1604 |
| 337 | Ga0207670_10000432 | 3300025936 | Bacteria | 23547 |
| 338 | Ga0207670_10016639 | 3300025936 | Bacteria | 4425 |
| 339 | Ga0207669_10000043 | 3300025937 | Bacteria | 65025 |
| 340 | Ga0207669_10003759 | 3300025937 | Bacteria | 6591 |
| 341 | Ga0207704_10000285 | 3300025938 | Bacteria | 24138 |
| 342 | Ga0207704_10014215 | 3300025938 | Bacteria | 4013 |
| 343 | Ga0207665_10003696 | 3300025939 | Bacteria | 10222 |
| 344 | Ga0207665_10257569 | 3300025939 | Bacteria | 1291 |
| 345 | Ga0207691_10000169 | 3300025940 | Bacteria | 60909 |
| 346 | Ga0207711_10114424 | 3300025941 | Bacteria | 2402 |
| 347 | Ga0207711_10183741 | 3300025941 | Bacteria | 1902 |
| 348 | Ga0207711_10432970 | 3300025941 | Bacteria | 1224 |
| 349 | Ga0207689_10007874 | 3300025942 | Bacteria | 9309 |
| 350 | Ga0207689_10020170 | 3300025942 | Bacteria | 5615 |
| 351 | Ga0207661_10000764 | 3300025944 | Bacteria | 20904 |
| 352 | Ga0207661_10072062 | 3300025944 | Bacteria | 2826 |
| 353 | Ga0207679_10000030 | 3300025945 | Bacteria | 169351 |
| 354 | Ga0207679_10049665 | 3300025945 | Bacteria | 3062 |
| 355 | Ga0207667_10048477 | 3300025949 | Bacteria | 4492 |
| 356 | Ga0207667_10069014 | 3300025949 | Bacteria | 3679 |
| 357 | Ga0207667_10174904 | 3300025949 | Bacteria | 2206 |
| 358 | Ga0207651_10001313 | 3300025960 | Bacteria | 11218 |
| 359 | Ga0207712_10000396 | 3300025961 | Bacteria | 37902 |
| 360 | Ga0207712_10017027 | 3300025961 | Bacteria | 4715 |
| 361 | Ga0207712_10031769 | 3300025961 | Bacteria | 3559 |
| 362 | Ga0207712_10174217 | 3300025961 | Bacteria | 1684 |
| 363 | Ga0207668_10000312 | 3300025972 | Bacteria | 31799 |
| 364 | Ga0207668_10010748 | 3300025972 | Bacteria | 5542 |
| 365 | Ga0207668_10085572 | 3300025972 | Bacteria | 2301 |
| 366 | Ga0207668_10135942 | 3300025972 | Bacteria | 1883 |
| 367 | Ga0207640_10011962 | 3300025981 | Bacteria | 4929 |
| 368 | Ga0207658_10004659 | 3300025986 | Bacteria | 9505 |
| 369 | Ga0207677_10001531 | 3300026023 | Bacteria | 12231 |
| 370 | Ga0207703_10001648 | 3300026035 | Bacteria | 20092 |
| 371 | Ga0207703_10059578 | 3300026035 | Bacteria | 3118 |
| 372 | Ga0207703_10086555 | 3300026035 | Bacteria | 2625 |
| 373 | Ga0207703_10182261 | 3300026035 | Bacteria | 1854 |
| 374 | Ga0207639_10007077 | 3300026041 | Bacteria | 7653 |
| 375 | Ga0207639_10063579 | 3300026041 | Bacteria | 2858 |
| 376 | Ga0207639_10243645 | 3300026041 | Bacteria | 1564 |
| 377 | Ga0207678_10000266 | 3300026067 | Bacteria | 47353 |
| 378 | Ga0207678_10048367 | 3300026067 | Bacteria | 3676 |
| 379 | Ga0207678_10057003 | 3300026067 | Bacteria | 3362 |
| 380 | Ga0207708_10000383 | 3300026075 | Bacteria | 34626 |
| 381 | Ga0207708_10011040 | 3300026075 | Bacteria | 6716 |
| 382 | Ga0207708_10106365 | 3300026075 | Bacteria | 2175 |
| 383 | Ga0207702_10009618 | 3300026078 | Bacteria | 8114 |
| 384 | Ga0207641_10001892 | 3300026088 | Bacteria | 20096 |
| 385 | Ga0207641_10004239 | 3300026088 | Bacteria | 12498 |
| 386 | Ga0207641_10075261 | 3300026088 | Bacteria | 2915 |
| 387 | Ga0207641_10411654 | 3300026088 | Bacteria | 1300 |
| 388 | Ga0207648_10000272 | 3300026089 | Bacteria | 56105 |
| 389 | Ga0207648_10113238 | 3300026089 | Bacteria | 2382 |
| 390 | Ga0207676_10000074 | 3300026095 | Bacteria | 101208 |
| 391 | Ga0207676_10024313 | 3300026095 | Bacteria | 4481 |
| 392 | Ga0207674_10000135 | 3300026116 | Bacteria | 85071 |
| 393 | Ga0207674_10081560 | 3300026116 | Bacteria | 3236 |
| 394 | Ga0207675_100003473 | 3300026118 | Bacteria | 15393 |
| 395 | Ga0207675_100006357 | 3300026118 | Bacteria | 11200 |
| 396 | Ga0207675_100034543 | 3300026118 | Bacteria | 4715 |
| 397 | Ga0207675_100116316 | 3300026118 | Bacteria | 2527 |
| 398 | Ga0207675_100194154 | 3300026118 | Bacteria | 1948 |
| 399 | Ga0207675_100486978 | 3300026118 | Bacteria | 1226 |
| 400 | Ga0207683_10000136 | 3300026121 | Bacteria | 60910 |
| 401 | Ga0207683_10001596 | 3300026121 | Bacteria | 20375 |
| 402 | Ga0207683_10039380 | 3300026121 | Bacteria | 4123 |
| 403 | Ga0207683_10046302 | 3300026121 | Bacteria | 3806 |
| 404 | Ga0207683_10494004 | 3300026121 | Bacteria | 1130 |
| 405 | Ga0209966_1004920 | 3300027695 | Bacteria | 2280 |
| 406 | Ga0209998_10005189 | 3300027717 | Bacteria | 2735 |
| 407 | Ga0209998_10005230 | 3300027717 | Bacteria | 2720 |
| 408 | Ga0209998_10017982 | 3300027717 | Bacteria | 1498 |
| 409 | Ga0209974_10001126 | 3300027876 | Bacteria | 9476 |
| 410 | Ga0207428_10000702 | 3300027907 | Bacteria | 38855 |
| 411 | Ga0207428_10001429 | 3300027907 | Bacteria | 25093 |
| 412 | Ga0207428_10002527 | 3300027907 | Bacteria | 18248 |
| 413 | Ga0268266_10013326 | 3300028379 | Bacteria | 7084 |
| 414 | Ga0268265_10002284 | 3300028380 | Bacteria | 14599 |
| 415 | Ga0268265_10036443 | 3300028380 | Bacteria | 3603 |
| 416 | Ga0268265_10046762 | 3300028380 | Bacteria | 3237 |
| 417 | Ga0268264_10001372 | 3300028381 | Bacteria | 22784 |
| 418 | Ga0268264_10047489 | 3300028381 | Bacteria | 3569 |
| 419 | Ga0268264_10101539 | 3300028381 | Bacteria | 2501 |
| 420 | Ga0268264_10223266 | 3300028381 | Bacteria | 1735 |
| 421 | Ga0307516_10168450 | 3300031730 | Bacteria | 1933 |
| 422 | Ga0373930_0009964 | 3300034816 | Bacteria | 1688 |
| 423 | Ga0373948_0000977 | 3300034817 | Bacteria | 3831 |
| 424 | Ga0373950_0000281 | 3300034818 | Bacteria | 6403 |
| 425 | Ga0373950_0006978 | 3300034818 | Bacteria | 1740 |
| 426 | Ga0373950_0017175 | 3300034818 | Bacteria | 1244 |
| 427 | Ga0373958_0000312 | 3300034819 | Bacteria | 5850 |
| 428 | Ga0373938_0001612 | 3300034957 | Bacteria | 3624 |
| 429 | Ga0373928_0001756 | 3300035084 | Bacteria | 4222 |
| 430 | Ga0373928_0002833 | 3300035084 | Bacteria | 3342 |
| 431 | Ga0373929_0001398 | 3300035085 | Bacteria | 4626 |
| 432 | Ga0373934_0090531 | 3300035086 | Bacteria | 1233 |
| 433 | Ga0373940_0001217 | 3300035088 | Bacteria | 4543 |
| 434 | Ga0373944_0004186 | 3300035089 | Bacteria | 3749 |
| 435 | Ga0373944_0010557 | 3300035089 | Plasmid | 2519 |
| 436 | Ga0373949_0000926 | 3300035090 | Bacteria | 9141 |
| 437 | Ga0373949_0001424 | 3300035090 | Bacteria | 6844 |
| 438 | Ga0373951_0010729 | 3300035091 | Bacteria | 2058 |
| 439 | Ga0373952_0000246 | 3300035092 | Bacteria | 8799 |
| 440 | Ga0373952_0001063 | 3300035092 | Bacteria | 5020 |
| 441 | Ga0373923_0064231 | 3300035111 | Bacteria | 1565 |
| 442 | Ga0373932_0000229 | 3300035112 | Bacteria | 16826 |
| 443 | Ga0373932_0001553 | 3300035112 | Bacteria | 6346 |
| 444 | Ga0373936_0016212 | 3300035113 | Bacteria | 2865 |
| 445 | Ga0373939_0002684 | 3300035114 | Bacteria | 4170 |
| 446 | Ga0373941_0000372 | 3300035115 | Bacteria | 8943 |
| 447 | Ga0373941_0002874 | 3300035115 | Bacteria | 3841 |
| 448 | Ga0373945_0023132 | 3300035116 | Bacteria | 2145 |
| 449 | Ga0373945_0023332 | 3300035116 | Bacteria | 2136 |
| 450 | Ga0373945_0051728 | 3300035116 | Bacteria | 1512 |
| 451 | Ga0373945_0105131 | 3300035116 | Unclassified | 1109 |
| 452 | Ga0373953_0101809 | 3300035117 | Bacteria | 1209 |
| 453 | Ga0373954_0101194 | 3300035118 | Bacteria | 1390 |
| 454 | Ga0373956_0063353 | 3300035119 | Bacteria | 1677 |
| 455 | Ga0373960_0002263 | 3300035121 | Bacteria | 4330 |
| 456 | Ga0373960_0010800 | 3300035121 | Bacteria | 2237 |
| 457 | Ga0373960_0013322 | 3300035121 | Bacteria | 2061 |
| 458 | Ga0373943_0023255 | 3300035170 | Bacteria | 2880 |
| 459 | Ga0373943_0044158 | 3300035170 | Unclassified | 2168 |
| 460 | Ga0373946_0023079 | 3300035171 | Bacteria | 2428 |
| 461 | Ga0373942_0000944 | 3300035207 | Bacteria | 7948 |
| 462 | Ga0373942_0002333 | 3300035207 | Bacteria | 4626 |
| 463 | Ga0373961_0001011 | 3300035241 | Bacteria | 9193 |
| 464 | Ga0373961_0003246 | 3300035241 | Bacteria | 4054 |
| 465 | Ga0373962_0000208 | 3300035242 | Bacteria | 12431 |
| 466 | Ga0373962_0000514 | 3300035242 | Bacteria | 8629 |
| 467 | Ga0373962_0003428 | 3300035242 | Bacteria | 3808 |
| 468 | Ga0373931_0000249 | 3300035691 | Bacteria | 22911 |
| 469 | Ga0373931_0009175 | 3300035691 | Bacteria | 4723 |
| 470 | Ga0373931_0232637 | 3300035691 | Bacteria | 1114 |
| 471 | Ga0373935_0160429 | 3300035692 | Unclassified | 1532 |
| 472 | Ga0373933_0109440 | 3300035724 | Bacteria | 1722 |
| 473 | Ga0373947_0001407 | 3300035725 | Bacteria | 14812 |
| 474 | Ga0373947_0050559 | 3300035725 | Bacteria | 2499 |
| 475 | Ga0373925_0023819 | 3300037068 | Bacteria | 4466 |
| 476 | Ga0395899_0074613 | 3300037312 | Bacteria | 2477 |
| 477 | Ga0395899_0195447 | 3300037312 | Bacteria | 1414 |
| 478 | Ga0395900_0011525 | 3300037418 | Bacteria | 9048 |
| 479 | Ga0395900_0016463 | 3300037418 | Bacteria | 7539 |
| 480 | Ga0395900_0207412 | 3300037418 | Bacteria | 1980 |
| 481 | Ga0395898_0002494 | 3300037466 | Bacteria | 21650 |
| 482 | Ga0395898_0003815 | 3300037466 | Bacteria | 16691 |
| 483 | Ga0395898_0022725 | 3300037466 | Bacteria | 6348 |
| 484 | Ga0395905_0043920 | 3300037471 | Bacteria | 4194 |
| 485 | Ga0395905_0424060 | 3300037471 | Bacteria | 1227 |
| 486 | Ga0395901_0024020 | 3300038443 | Bacteria | 6253 |
| 487 | Ga0395901_0036020 | 3300038443 | Bacteria | 5113 |
| 488 | Ga0439453_0003702 | 3300041408 | Bacteria | 2220 |
| 489 | Ga0453684_0316376 | 3300044712 | Bacteria | 1769 |
| 490 | Ga0495603_0002528 | 3300046455 | Bacteria | 10769 |
| 491 | Ga0495603_0040714 | 3300046455 | Bacteria | 2780 |
| 492 | Ga0495629_0000473 | 3300046459 | Bacteria | 33677 |
| 493 | Ga0495629_0024003 | 3300046459 | Bacteria | 4343 |
| 494 | Ga0495629_0053264 | 3300046459 | Bacteria | 2831 |
| 495 | Ga0495638_0044451 | 3300046460 | Bacteria | 2798 |
| 496 | Ga0495641_0021264 | 3300046461 | Bacteria | 3266 |
| 497 | Ga0495641_0083376 | 3300046461 | Bacteria | 1432 |
| 498 | Ga0495651_0003643 | 3300046462 | Bacteria | 11794 |
| 499 | Ga0495653_0079832 | 3300046463 | Bacteria | 2422 |
| 500 | Ga0495653_0144751 | 3300046463 | Bacteria | 1667 |
| 501 | Ga0495580_0007386 | 3300046472 | Bacteria | 8838 |
| 502 | Ga0495582_0010936 | 3300046473 | Bacteria | 4994 |
| 503 | Ga0495639_0067122 | 3300046475 | Bacteria | 1652 |
| 504 | Ga0495639_0110988 | 3300046475 | Bacteria | 1301 |
| 505 | Ga0495662_0007357 | 3300046476 | Bacteria | 5443 |
| 506 | Ga0495662_0062011 | 3300046476 | Bacteria | 1807 |
| 507 | Ga0495664_0014986 | 3300046477 | Bacteria | 4402 |
| 508 | Ga0495664_0161455 | 3300046477 | Bacteria | 1359 |
| 509 | Ga0495585_0004147 | 3300046492 | Bacteria | 9483 |
| 510 | Ga0495594_0006922 | 3300046499 | Bacteria | 5834 |
| 511 | Ga0495594_0048372 | 3300046499 | Bacteria | 2336 |
| 512 | Ga0495607_0108473 | 3300046501 | Bacteria | 1475 |
| 513 | Ga0495608_0092920 | 3300046511 | Bacteria | 1949 |
| 514 | Ga0495610_0053036 | 3300046512 | Bacteria | 1966 |
| 515 | Ga0495618_0189049 | 3300046514 | Bacteria | 1306 |
| 516 | Ga0495620_0043818 | 3300046515 | Bacteria | 1948 |
| 517 | Ga0495630_0068633 | 3300046517 | Bacteria | 2666 |
| 518 | Ga0495637_0021172 | 3300046520 | Bacteria | 2983 |
| 519 | Ga0495644_0002015 | 3300046523 | Bacteria | 8171 |
| 520 | Ga0495644_0033032 | 3300046523 | Bacteria | 1955 |
| 521 | Ga0495666_0097570 | 3300046526 | Bacteria | 1385 |
| 522 | Ga0495652_0060197 | 3300046529 | Bacteria | 3210 |
| 523 | Ga0495665_0045563 | 3300046531 | Bacteria | 2329 |
| 524 | Ga0495640_0028912 | 3300046533 | Bacteria | 3985 |
| 525 | Ga0495640_0067441 | 3300046533 | Bacteria | 2409 |
| 526 | Ga0495586_0104711 | 3300046535 | Bacteria | 1572 |
| 527 | Ga0495587_0057431 | 3300046536 | Bacteria | 2288 |
| 528 | Ga0495622_0024704 | 3300046557 | Bacteria | 2806 |
| 529 | Ga0495633_0009234 | 3300046558 | Bacteria | 5465 |
| 530 | Ga0495656_0000562 | 3300046615 | Bacteria | 12127 |
| 531 | Ga0495634_0058118 | 3300046642 | Bacteria | 2579 |
| 532 | Ga0495635_0216215 | 3300046663 | Bacteria | 1297 |
| 533 | Ga0495599_0113535 | 3300046678 | Bacteria | 1686 |
| 534 | Ga0495646_0261458 | 3300046680 | Bacteria | 924 |
| 535 | Ga0495647_0011512 | 3300046681 | Bacteria | 3032 |
| 536 | Ga0495647_0024570 | 3300046681 | Bacteria | 2194 |
| 537 | Ga0495658_0000557 | 3300046683 | Bacteria | 20322 |
| 538 | Ga0495613_0031441 | 3300046689 | Bacteria | 3943 |
| 539 | Ga0495670_0007228 | 3300046691 | Bacteria | 5462 |
| 540 | Ga0495670_0070725 | 3300046691 | Bacteria | 1766 |
| 541 | Ga0495671_0084933 | 3300046692 | Bacteria | 1551 |
| 542 | Ga0495600_0026167 | 3300046809 | Bacteria | 3763 |
| 543 | Ga0495581_0023207 | 3300047315 | Bacteria | 3595 |
| 544 | Ga0495604_0041603 | 3300047317 | Bacteria | 3604 |
| 545 | Ga0495674_0055413 | 3300047319 | Bacteria | 3477 |
| 546 | Ga0495676_0063324 | 3300047321 | Bacteria | 2883 |
| 547 | Ga0495680_0008202 | 3300047322 | Bacteria | 9521 |
| 548 | Ga0495680_0059042 | 3300047322 | Bacteria | 2962 |
| 549 | Ga0495680_0094045 | 3300047322 | Bacteria | 2243 |
| 550 | Ga0495679_022908 | 3300047446 | Bacteria | 2129 |
| 551 | Ga0495684_0021314 | 3300047471 | Bacteria | 4990 |
| 552 | Ga0495684_0155879 | 3300047471 | Bacteria | 1706 |
| 553 | Ga0495684_0183102 | 3300047471 | Unclassified | 1552 |
| 554 | Ga0495593_0024102 | 3300047673 | Bacteria | 3376 |
| 555 | Ga0495593_0033599 | 3300047673 | Bacteria | 2793 |
| 556 | Ga0495602_0055382 | 3300048088 | Bacteria | 3493 |
| 557 | Ga0495614_0082010 | 3300048089 | Unclassified | 1398 |
| 558 | Ga0496100_0000363 | 3300048903 | Bacteria | 22088 |
| 559 | Ga0496100_0176123 | 3300048903 | Bacteria | 1544 |
| 560 | Ga0496100_0237753 | 3300048903 | Bacteria | 1343 |
| 561 | Ga0496101_0000136 | 3300048904 | Bacteria | 65392 |
| 562 | Ga0496101_0022404 | 3300048904 | Bacteria | 4348 |
| 563 | Ga0496101_0058283 | 3300048904 | Bacteria | 2796 |
| 564 | Ga0496101_0065648 | 3300048904 | Bacteria | 2646 |
| 565 | Ga0496101_0097743 | 3300048904 | Bacteria | 2193 |
| 566 | Ga0496101_0099112 | 3300048904 | Bacteria | 2178 |
| 567 | Ga0496101_0137944 | 3300048904 | Bacteria | 1857 |
| 568 | Ga0496102_0017179 | 3300048905 | Bacteria | 6335 |
| 569 | Ga0496102_0076950 | 3300048905 | Bacteria | 3070 |
| 570 | Ga0496102_0091063 | 3300048905 | Bacteria | 2822 |
| 571 | Ga0496102_0098641 | 3300048905 | Bacteria | 2711 |
| 572 | Ga0496102_0110321 | 3300048905 | Bacteria | 2564 |
| 573 | Ga0496102_0205591 | 3300048905 | Bacteria | 1856 |
| 574 | Ga0496102_0251867 | 3300048905 | Bacteria | 1665 |
| 575 | Ga0496102_0364373 | 3300048905 | Bacteria | 1361 |
| 576 | Ga0496103_0001236 | 3300048906 | Bacteria | 17450 |
| 577 | Ga0496103_0093342 | 3300048906 | Unclassified | 1900 |
| 578 | Ga0496104_0024694 | 3300048907 | Bacteria | 5532 |
| 579 | Ga0496104_0025731 | 3300048907 | Bacteria | 5426 |
| 580 | Ga0496104_0080152 | 3300048907 | Bacteria | 3112 |
| 581 | Ga0496104_0180269 | 3300048907 | Bacteria | 2023 |
| 582 | Ga0496104_0231882 | 3300048907 | Bacteria | 1758 |
| 583 | Ga0496105_0012384 | 3300048908 | Bacteria | 6752 |
| 584 | Ga0496105_0018275 | 3300048908 | Bacteria | 5630 |
| 585 | Ga0496105_0029885 | 3300048908 | Bacteria | 4461 |
| 586 | Ga0496105_0165831 | 3300048908 | Unclassified | 1812 |
| 587 | Ga0496105_0303807 | 3300048908 | Bacteria | 1282 |
| 588 | Ga0496106_0010263 | 3300048909 | Bacteria | 6925 |
| 589 | Ga0496106_0051771 | 3300048909 | Bacteria | 3096 |
| 590 | Ga0496106_0093956 | 3300048909 | Bacteria | 2318 |
| 591 | Ga0496106_0095734 | 3300048909 | Bacteria | 2297 |
| 592 | Ga0496106_0119247 | 3300048909 | Bacteria | 2061 |
| 593 | Ga0496106_0260047 | 3300048909 | Bacteria | 1389 |
| 594 | Ga0496106_0260587 | 3300048909 | Bacteria | 1387 |
| 595 | Ga0496107_0029806 | 3300048910 | Bacteria | 3885 |
| 596 | Ga0496107_0042674 | 3300048910 | Bacteria | 3258 |
| 597 | Ga0496107_0042757 | 3300048910 | Bacteria | 3254 |
| 598 | Ga0496107_0044636 | 3300048910 | Bacteria | 3186 |
| 599 | Ga0496107_0081365 | 3300048910 | Bacteria | 2362 |
| 600 | Ga0496108_0018445 | 3300048911 | Bacteria | 5712 |
| 601 | Ga0496108_0024030 | 3300048911 | Bacteria | 5017 |
| 602 | Ga0496108_0032576 | 3300048911 | Bacteria | 4329 |
| 603 | Ga0496108_0118472 | 3300048911 | Bacteria | 2269 |
| 604 | Ga0496108_0169844 | 3300048911 | Bacteria | 1887 |
| 605 | Ga0496109_0000771 | 3300048912 | Bacteria | 26630 |
| 606 | Ga0496109_0025662 | 3300048912 | Bacteria | 5252 |
| 607 | Ga0496109_0047955 | 3300048912 | Bacteria | 3885 |
| 608 | Ga0496109_0105391 | 3300048912 | Bacteria | 2618 |
| 609 | Ga0496109_0211151 | 3300048912 | Bacteria | 1825 |
| 610 | Ga0496110_0013968 | 3300048913 | Bacteria | 6653 |
| 611 | Ga0496110_0076727 | 3300048913 | Bacteria | 2971 |
| 612 | Ga0496110_0175257 | 3300048913 | Bacteria | 1946 |
| 613 | Ga0496111_0013864 | 3300048914 | Bacteria | 5497 |
| 614 | Ga0496111_0037705 | 3300048914 | Bacteria | 3460 |
| 615 | Ga0496111_0068548 | 3300048914 | Bacteria | 2578 |
| 616 | Ga0496112_0008432 | 3300048915 | Bacteria | 9230 |
| 617 | Ga0496112_0019971 | 3300048915 | Bacteria | 6340 |
| 618 | Ga0496112_0028147 | 3300048915 | Bacteria | 5422 |
| 619 | Ga0496112_0106001 | 3300048915 | Bacteria | 2780 |
| 620 | Ga0496112_0154826 | 3300048915 | Bacteria | 2259 |
| 621 | Ga0496113_0002900 | 3300048916 | Bacteria | 10103 |
| 622 | Ga0496113_0010822 | 3300048916 | Bacteria | 6052 |
| 623 | Ga0496113_0026128 | 3300048916 | Bacteria | 4171 |
| 624 | Ga0496113_0092102 | 3300048916 | Bacteria | 2337 |
| 625 | Ga0496113_0132826 | 3300048916 | Bacteria | 1954 |
| 626 | Ga0496114_0063152 | 3300048917 | Bacteria | 3100 |
| 627 | Ga0496115_0001192 | 3300048918 | Bacteria | 18634 |
| 628 | Ga0496115_0031621 | 3300048918 | Bacteria | 4170 |
| 629 | Ga0496115_0063850 | 3300048918 | Bacteria | 2971 |
| 630 | Ga0496115_0124321 | 3300048918 | Bacteria | 2124 |
| 631 | Ga0496115_0327671 | 3300048918 | Bacteria | 1252 |
| 632 | Ga0496121_0079685 | 3300048924 | Bacteria | 2599 |
| 633 | Ga0496126_0082048 | 3300048929 | Bacteria | 2850 |
| 634 | Ga0501034_0621695 | 3300049571 | Bacteria | 984 |
| 635 | Ga0501036_0234145 | 3300049572 | Bacteria | 1541 |
| 636 | Ga0501037_0228930 | 3300049573 | Bacteria | 1305 |
| 637 | Ga0501047_0106974 | 3300049581 | Bacteria | 2678 |
| 638 | Ga0501067_0056607 | 3300049583 | Bacteria | 2172 |
| 639 | Ga0501069_0188958 | 3300049585 | Bacteria | 1192 |
| 640 | Ga0501079_0361855 | 3300049741 | Bacteria | 1137 |
| 641 | Ga0501080_0426369 | 3300049742 | Bacteria | 1191 |
| 642 | Ga0501083_0069615 | 3300049744 | Bacteria | 2341 |
| 643 | Ga0501035_0303902 | 3300049822 | Bacteria | 1344 |
| 644 | Ga0501035_0449839 | 3300049822 | Bacteria | 1066 |
| 645 | nmdc:mga05p37_11799_c1 | 3300050507 | Bacteria | 10415 |
| 646 | nmdc:mga05p37_332165_c1 | 3300050507 | Bacteria | 1795 |
| 647 | nmdc:mga05p37_3938_c1 | 3300050507 | Bacteria | 14912 |
| 648 | nmdc:mga09592_3119_c1 | 3300050508 | Bacteria | 13453 |
| 649 | nmdc:mga0qj67_10737_c1 | 3300050509 | Bacteria | 6847 |
| 650 | nmdc:mga0qj67_17100_c1 | 3300050509 | Bacteria | 5512 |
| 651 | nmdc:mga0qj67_409837_c1 | 3300050509 | Bacteria | 1093 |
| 652 | nmdc:mga0qj67_5979_c1 | 3300050509 | Bacteria | 8917 |
| 653 | nmdc:mga06r32_18804_c1 | 3300050510 | Bacteria | 6331 |
| 654 | nmdc:mga06r32_3736_c1 | 3300050510 | Bacteria | 13616 |
| 655 | nmdc:mga06r32_4793_c1 | 3300050510 | Bacteria | 12169 |
| 656 | nmdc:mga06r32_630_c1 | 3300050510 | Bacteria | 30687 |
| 657 | nmdc:mga08y16_3226_c2 | 3300050511 | Bacteria | 14776 |
| 658 | nmdc:mga08y16_4462_c1 | 3300050511 | Bacteria | 14634 |
| 659 | nmdc:mga0n895_1795_c1 | 3300050512 | Bacteria | 16306 |
| 660 | nmdc:mga0n895_1804_c1 | 3300050512 | Bacteria | 16279 |
| 661 | nmdc:mga0n895_253865_c1 | 3300050512 | Bacteria | 1784 |
| 662 | nmdc:mga0n895_42739_c1 | 3300050512 | Bacteria | 4411 |
| 663 | nmdc:mga0n895_44001_c1 | 3300050512 | Bacteria | 4354 |
| 664 | nmdc:mga0n895_76827_c1 | 3300050512 | Bacteria | 3321 |
| 665 | nmdc:mga0rr50_1015_c1 | 3300050513 | Bacteria | 15232 |
| 666 | nmdc:mga0rr50_294391_c1 | 3300050513 | Bacteria | 1357 |
| 667 | nmdc:mga08x19_212839_c1 | 3300050514 | Bacteria | 1327 |
| 668 | nmdc:mga0a205_1082_c1 | 3300050515 | Bacteria | 22615 |
| 669 | nmdc:mga0a205_17882_c1 | 3300050515 | Bacteria | 6653 |
| 670 | nmdc:mga0a205_301084_c1 | 3300050515 | Bacteria | 1476 |
| 671 | nmdc:mga0a205_4499_c1 | 3300050515 | Bacteria | 12507 |
| 672 | Ga0495601_0000963 | 3300053077 | Bacteria | 15732 |
| 673 | Ga0495612_0002575 | 3300053078 | Bacteria | 7481 |
| 674 | Ga0495612_0008798 | 3300053078 | Bacteria | 4093 |
| 675 | Ga0495595_0010716 | 3300053084 | Bacteria | 3818 |
| 676 | Ga0495619_0001993 | 3300053085 | Bacteria | 13592 |
| 677 | Ga0495619_0009900 | 3300053085 | Bacteria | 6007 |
| 678 | Ga0495619_0018762 | 3300053085 | Bacteria | 4391 |
| 679 | Ga0500566_0008491 | 3300053094 | Bacteria | 6073 |
| 680 | Ga0500595_047456 | 3300053119 | Bacteria | 1346 |
| 681 | Ga0500559_0005828 | 3300053136 | Bacteria | 5621 |
| 682 | Ga0500590_062355 | 3300053148 | Bacteria | 1871 |
| 683 | Ga0500636_0005706 | 3300053177 | Bacteria | 7117 |
| 684 | Ga0501082_0231590 | 3300060353 | Bacteria | 1608 |
| 685 | Ga0530510_0108897 | 3300061734 | Bacteria | 2028 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025899 | Ga0207642_10189126 | Ga0207642_101891262 | 255 |
| 2 | 3300034819 | Ga0373958_0000312 | Ga0373958_0000312_4896_5693 | 255 |
| 3 | 3300006846 | Ga0075430_100027985 | Ga0075430_1000279853 | 269 |
| 4 | 3300006847 | Ga0075431_100033755 | Ga0075431_1000337553 | 269 |
| 5 | 3300050510 | nmdc:mga06r32_4793_c1 | nmdc:mga06r32_4793_c1_1012_1827 | 269 |
| 6 | 3300048918 | Ga0496115_0124321 | Ga0496115_0124321_1280_2113 | 277 |
| 7 | 3300005983 | Ga0081540_1003801 | Ga0081540_10038012 | 278 |
| 8 | 3300046520 | Ga0495637_0021172 | Ga0495637_0021172_19_855 | 278 |
| 9 | 3300046680 | Ga0495646_0261458 | Ga0495646_0261458_52_888 | 278 |
| 10 | 3300037471 | Ga0395905_0424060 | Ga0395905_0424060_354_1208 | 284 |
| 11 | 3300006846 | Ga0075430_100018430 | Ga0075430_1000184304 | 290 |
| 12 | 3300006847 | Ga0075431_100036798 | Ga0075431_1000367987 | 290 |
| 13 | 3300009147 | Ga0114129_10007088 | Ga0114129_100070885 | 290 |
| 14 | 3300050507 | nmdc:mga05p37_11799_c1 | nmdc:mga05p37_11799_c1_4523_5401 | 290 |
| 15 | 3300050509 | nmdc:mga0qj67_17100_c1 | nmdc:mga0qj67_17100_c1_731_1609 | 290 |
| 16 | 3300050510 | nmdc:mga06r32_630_c1 | nmdc:mga06r32_630_c1_19949_20827 | 290 |
| 17 | 3300048909 | Ga0496106_0260587 | Ga0496106_0260587_128_1102 | 291 |
| 18 | iso_pu_bacteria | 2791355199 | 2793082717 | 291 |
| 19 | iso_pu_bacteria | 2909042592 | 2909045636 | 291 |
| 20 | iso_pu_bacteria | 2922386360 | 2922388139 | 291 |
| 21 | iso_pu_bacteria | 8006964411 | 8006964675 | 291 |
| 22 | iso_pu_bacteria | 8056673599 | 8056680321 | 291 |
| 23 | 3300003215 | JGI25153J46596_10004363 | JGI25153J46596_100043639 | 292 |
| 24 | 3300005290 | Ga0065712_10026686 | Ga0065712_100266861 | 292 |
| 25 | 3300005328 | Ga0070676_10098314 | Ga0070676_100983141 | 292 |
| 26 | 3300005347 | Ga0070668_100085324 | Ga0070668_1000853243 | 292 |
| 27 | 3300005436 | Ga0070713_100001366 | Ga0070713_1000013666 | 292 |
| 28 | 3300005436 | Ga0070713_100128116 | Ga0070713_1001281163 | 292 |
| 29 | 3300005436 | Ga0070713_100385472 | Ga0070713_1003854722 | 292 |
| 30 | 3300005439 | Ga0070711_100129377 | Ga0070711_1001293772 | 292 |
| 31 | 3300005471 | Ga0070698_100363938 | Ga0070698_1003639381 | 292 |
| 32 | 3300005937 | Ga0081455_10007008 | Ga0081455_1000700810 | 292 |
| 33 | 3300005937 | Ga0081455_10021233 | Ga0081455_100212336 | 292 |
| 34 | 3300006028 | Ga0070717_10000296 | Ga0070717_1000029637 | 292 |
| 35 | 3300006173 | Ga0070716_100029304 | Ga0070716_1000293042 | 292 |
| 36 | 3300009176 | Ga0105242_10119509 | Ga0105242_101195092 | 292 |
| 37 | 3300009545 | Ga0105237_10167630 | Ga0105237_101676302 | 292 |
| 38 | 3300010159 | Ga0099796_10017743 | Ga0099796_100177432 | 292 |
| 39 | 3300013297 | Ga0157378_10260925 | Ga0157378_102609251 | 292 |
| 40 | 3300014325 | Ga0163163_10443005 | Ga0163163_104430052 | 292 |
| 41 | 3300025297 | Ga0209758_1000188 | Ga0209758_1000188122 | 292 |
| 42 | 3300025906 | Ga0207699_10152330 | Ga0207699_101523302 | 292 |
| 43 | 3300025914 | Ga0207671_10236714 | Ga0207671_102367142 | 292 |
| 44 | 3300025915 | Ga0207693_10047508 | Ga0207693_100475083 | 292 |
| 45 | 3300025928 | Ga0207700_10001101 | Ga0207700_1000110115 | 292 |
| 46 | 3300025928 | Ga0207700_10209165 | Ga0207700_102091652 | 292 |
| 47 | 3300025939 | Ga0207665_10257569 | Ga0207665_102575692 | 292 |
| 48 | 3300025972 | Ga0207668_10085572 | Ga0207668_100855723 | 292 |
| 49 | 3300037312 | Ga0395899_0074613 | Ga0395899_0074613_249_1133 | 292 |
| 50 | 3300037418 | Ga0395900_0011525 | Ga0395900_0011525_6901_7785 | 292 |
| 51 | 3300037466 | Ga0395898_0002494 | Ga0395898_0002494_3601_4485 | 292 |
| 52 | 3300038443 | Ga0395901_0036020 | Ga0395901_0036020_1115_1999 | 292 |
| 53 | 3300048929 | Ga0496126_0082048 | Ga0496126_0082048_930_1823 | 292 |
| 54 | 3300049573 | Ga0501037_0228930 | Ga0501037_0228930_16_900 | 292 |
| 55 | 3300049581 | Ga0501047_0106974 | Ga0501047_0106974_991_1875 | 292 |
| 56 | 3300049744 | Ga0501083_0069615 | Ga0501083_0069615_1173_2057 | 292 |
| 57 | 3300053119 | Ga0500595_047456 | Ga0500595_047456_436_1320 | 292 |
| 58 | 3300003203 | JGI25406J46586_10002241 | JGI25406J46586_100022417 | 293 |
| 59 | 3300003659 | JGI25404J52841_10003802 | JGI25404J52841_100038022 | 293 |
| 60 | 3300005339 | Ga0070660_100045769 | Ga0070660_1000457694 | 293 |
| 61 | 3300005347 | Ga0070668_100012163 | Ga0070668_10001216311 | 293 |
| 62 | 3300005347 | Ga0070668_100019674 | Ga0070668_1000196741 | 293 |
| 63 | 3300005354 | Ga0070675_100009012 | Ga0070675_1000090129 | 293 |
| 64 | 3300005356 | Ga0070674_100006516 | Ga0070674_1000065161 | 293 |
| 65 | 3300005365 | Ga0070688_100126332 | Ga0070688_1001263322 | 293 |
| 66 | 3300005366 | Ga0070659_100008809 | Ga0070659_1000088095 | 293 |
| 67 | 3300005441 | Ga0070700_100015521 | Ga0070700_1000155212 | 293 |
| 68 | 3300005441 | Ga0070700_100103785 | Ga0070700_1001037852 | 293 |
| 69 | 3300005444 | Ga0070694_100025365 | Ga0070694_1000253652 | 293 |
| 70 | 3300005455 | Ga0070663_100054901 | Ga0070663_1000549012 | 293 |
| 71 | 3300005456 | Ga0070678_100073740 | Ga0070678_1000737402 | 293 |
| 72 | 3300005456 | Ga0070678_100187322 | Ga0070678_1001873222 | 293 |
| 73 | 3300005457 | Ga0070662_100149193 | Ga0070662_1001491932 | 293 |
| 74 | 3300005458 | Ga0070681_10574541 | Ga0070681_105745411 | 293 |
| 75 | 3300005459 | Ga0068867_100089759 | Ga0068867_1000897592 | 293 |
| 76 | 3300005530 | Ga0070679_100147472 | Ga0070679_1001474723 | 293 |
| 77 | 3300005530 | Ga0070679_100443372 | Ga0070679_1004433722 | 293 |
| 78 | 3300005547 | Ga0070693_100041057 | Ga0070693_1000410573 | 293 |
| 79 | 3300005548 | Ga0070665_100188867 | Ga0070665_1001888672 | 293 |
| 80 | 3300005548 | Ga0070665_100406883 | Ga0070665_1004068832 | 293 |
| 81 | 3300005563 | Ga0068855_100035619 | Ga0068855_1000356195 | 293 |
| 82 | 3300005563 | Ga0068855_100273817 | Ga0068855_1002738171 | 293 |
| 83 | 3300005564 | Ga0070664_100142422 | Ga0070664_1001424222 | 293 |
| 84 | 3300005577 | Ga0068857_100451133 | Ga0068857_1004511331 | 293 |
| 85 | 3300005615 | Ga0070702_100254638 | Ga0070702_1002546381 | 293 |
| 86 | 3300005616 | Ga0068852_100058414 | Ga0068852_1000584143 | 293 |
| 87 | 3300005617 | Ga0068859_100071698 | Ga0068859_1000716982 | 293 |
| 88 | 3300005617 | Ga0068859_100100536 | Ga0068859_1001005362 | 293 |
| 89 | 3300005618 | Ga0068864_100221665 | Ga0068864_1002216653 | 293 |
| 90 | 3300005618 | Ga0068864_100373515 | Ga0068864_1003735152 | 293 |
| 91 | 3300005719 | Ga0068861_100010884 | Ga0068861_1000108843 | 293 |
| 92 | 3300005719 | Ga0068861_100050314 | Ga0068861_1000503143 | 293 |
| 93 | 3300005841 | Ga0068863_100011693 | Ga0068863_1000116935 | 293 |
| 94 | 3300005842 | Ga0068858_100162109 | Ga0068858_1001621092 | 293 |
| 95 | 3300005843 | Ga0068860_100013046 | Ga0068860_1000130466 | 293 |
| 96 | 3300005937 | Ga0081455_10027689 | Ga0081455_100276892 | 293 |
| 97 | 3300005983 | Ga0081540_1004135 | Ga0081540_10041352 | 293 |
| 98 | 3300005983 | Ga0081540_1005703 | Ga0081540_10057032 | 293 |
| 99 | 3300005983 | Ga0081540_1020947 | Ga0081540_10209474 | 293 |
| 100 | 3300005983 | Ga0081540_1023682 | Ga0081540_10236823 | 293 |
| 101 | 3300005985 | Ga0081539_10000203 | Ga0081539_10000203147 | 293 |
| 102 | 3300006881 | Ga0068865_100158601 | Ga0068865_1001586012 | 293 |
| 103 | 3300006931 | Ga0097620_100071691 | Ga0097620_1000716912 | 293 |
| 104 | 3300006931 | Ga0097620_100100535 | Ga0097620_1001005352 | 293 |
| 105 | 3300009093 | Ga0105240_10098502 | Ga0105240_100985024 | 293 |
| 106 | 3300009098 | Ga0105245_10084308 | Ga0105245_100843082 | 293 |
| 107 | 3300009098 | Ga0105245_10609961 | Ga0105245_106099611 | 293 |
| 108 | 3300009101 | Ga0105247_10055878 | Ga0105247_100558782 | 293 |
| 109 | 3300009174 | Ga0105241_10043783 | Ga0105241_100437832 | 293 |
| 110 | 3300009176 | Ga0105242_10038732 | Ga0105242_100387322 | 293 |
| 111 | 3300009177 | Ga0105248_10083056 | Ga0105248_100830564 | 293 |
| 112 | 3300009545 | Ga0105237_10073862 | Ga0105237_100738622 | 293 |
| 113 | 3300009553 | Ga0105249_10152859 | Ga0105249_101528591 | 293 |
| 114 | 3300009553 | Ga0105249_10303030 | Ga0105249_103030302 | 293 |
| 115 | 3300013104 | Ga0157370_10271334 | Ga0157370_102713342 | 293 |
| 116 | 3300013306 | Ga0163162_10019795 | Ga0163162_100197954 | 293 |
| 117 | 3300013306 | Ga0163162_10220503 | Ga0163162_102205032 | 293 |
| 118 | 3300013308 | Ga0157375_10055336 | Ga0157375_100553362 | 293 |
| 119 | 3300013308 | Ga0157375_10080011 | Ga0157375_100800112 | 293 |
| 120 | 3300014326 | Ga0157380_10011614 | Ga0157380_100116142 | 293 |
| 121 | 3300014326 | Ga0157380_10231718 | Ga0157380_102317182 | 293 |
| 122 | 3300014745 | Ga0157377_10009711 | Ga0157377_100097113 | 293 |
| 123 | 3300014968 | Ga0157379_10017426 | Ga0157379_100174262 | 293 |
| 124 | 3300017792 | Ga0163161_10113795 | Ga0163161_101137952 | 293 |
| 125 | 3300025900 | Ga0207710_10043888 | Ga0207710_100438882 | 293 |
| 126 | 3300025904 | Ga0207647_10014575 | Ga0207647_100145753 | 293 |
| 127 | 3300025913 | Ga0207695_10349549 | Ga0207695_103495491 | 293 |
| 128 | 3300025917 | Ga0207660_10235785 | Ga0207660_102357852 | 293 |
| 129 | 3300025919 | Ga0207657_10021647 | Ga0207657_100216472 | 293 |
| 130 | 3300025921 | Ga0207652_10059276 | Ga0207652_100592763 | 293 |
| 131 | 3300025921 | Ga0207652_10388815 | Ga0207652_103888152 | 293 |
| 132 | 3300025924 | Ga0207694_10042227 | Ga0207694_100422273 | 293 |
| 133 | 3300025926 | Ga0207659_10038137 | Ga0207659_100381372 | 293 |
| 134 | 3300025931 | Ga0207644_10102751 | Ga0207644_101027512 | 293 |
| 135 | 3300025933 | Ga0207706_10071135 | Ga0207706_100711352 | 293 |
| 136 | 3300025933 | Ga0207706_10127011 | Ga0207706_101270112 | 293 |
| 137 | 3300025933 | Ga0207706_10197750 | Ga0207706_101977502 | 293 |
| 138 | 3300025936 | Ga0207670_10016639 | Ga0207670_100166394 | 293 |
| 139 | 3300025937 | Ga0207669_10003759 | Ga0207669_100037593 | 293 |
| 140 | 3300025938 | Ga0207704_10014215 | Ga0207704_100142152 | 293 |
| 141 | 3300025941 | Ga0207711_10114424 | Ga0207711_101144243 | 293 |
| 142 | 3300025941 | Ga0207711_10432970 | Ga0207711_104329702 | 293 |
| 143 | 3300025942 | Ga0207689_10020170 | Ga0207689_100201704 | 293 |
| 144 | 3300025949 | Ga0207667_10048477 | Ga0207667_100484773 | 293 |
| 145 | 3300025961 | Ga0207712_10017027 | Ga0207712_100170274 | 293 |
| 146 | 3300025961 | Ga0207712_10031769 | Ga0207712_100317694 | 293 |
| 147 | 3300025961 | Ga0207712_10174217 | Ga0207712_101742172 | 293 |
| 148 | 3300025972 | Ga0207668_10010748 | Ga0207668_100107484 | 293 |
| 149 | 3300025972 | Ga0207668_10135942 | Ga0207668_101359422 | 293 |
| 150 | 3300026035 | Ga0207703_10059578 | Ga0207703_100595782 | 293 |
| 151 | 3300026041 | Ga0207639_10063579 | Ga0207639_100635791 | 293 |
| 152 | 3300026067 | Ga0207678_10048367 | Ga0207678_100483673 | 293 |
| 153 | 3300026075 | Ga0207708_10011040 | Ga0207708_100110402 | 293 |
| 154 | 3300026075 | Ga0207708_10106365 | Ga0207708_101063652 | 293 |
| 155 | 3300026088 | Ga0207641_10004239 | Ga0207641_1000423911 | 293 |
| 156 | 3300026088 | Ga0207641_10411654 | Ga0207641_104116542 | 293 |
| 157 | 3300026095 | Ga0207676_10024313 | Ga0207676_100243135 | 293 |
| 158 | 3300026116 | Ga0207674_10081560 | Ga0207674_100815604 | 293 |
| 159 | 3300026118 | Ga0207675_100006357 | Ga0207675_1000063578 | 293 |
| 160 | 3300026118 | Ga0207675_100116316 | Ga0207675_1001163162 | 293 |
| 161 | 3300026118 | Ga0207675_100194154 | Ga0207675_1001941542 | 293 |
| 162 | 3300026121 | Ga0207683_10039380 | Ga0207683_100393805 | 293 |
| 163 | 3300026121 | Ga0207683_10046302 | Ga0207683_100463022 | 293 |
| 164 | 3300028380 | Ga0268265_10036443 | Ga0268265_100364432 | 293 |
| 165 | 3300028381 | Ga0268264_10047489 | Ga0268264_100474892 | 293 |
| 166 | 3300028381 | Ga0268264_10101539 | Ga0268264_101015392 | 293 |
| 167 | 3300028381 | Ga0268264_10223266 | Ga0268264_102232661 | 293 |
| 168 | 3300031730 | Ga0307516_10168450 | Ga0307516_101684502 | 293 |
| 169 | 3300037471 | Ga0395905_0043920 | Ga0395905_0043920_1560_2447 | 293 |
| 170 | 3300046512 | Ga0495610_0053036 | Ga0495610_0053036_52_939 | 293 |
| 171 | 3300046515 | Ga0495620_0043818 | Ga0495620_0043818_27_914 | 293 |
| 172 | 3300046523 | Ga0495644_0033032 | Ga0495644_0033032_206_1093 | 293 |
| 173 | 3300046691 | Ga0495670_0070725 | Ga0495670_0070725_623_1510 | 293 |
| 174 | 3300048904 | Ga0496101_0065648 | Ga0496101_0065648_854_1741 | 293 |
| 175 | 3300048904 | Ga0496101_0137944 | Ga0496101_0137944_793_1680 | 293 |
| 176 | 3300048905 | Ga0496102_0205591 | Ga0496102_0205591_328_1215 | 293 |
| 177 | 3300048909 | Ga0496106_0093956 | Ga0496106_0093956_165_1052 | 293 |
| 178 | 3300048909 | Ga0496106_0095734 | Ga0496106_0095734_422_1309 | 293 |
| 179 | 3300048909 | Ga0496106_0119247 | Ga0496106_0119247_748_1635 | 293 |
| 180 | 3300048911 | Ga0496108_0169844 | Ga0496108_0169844_901_1800 | 293 |
| 181 | 3300048915 | Ga0496112_0008432 | Ga0496112_0008432_6261_7148 | 293 |
| 182 | 3300048924 | Ga0496121_0079685 | Ga0496121_0079685_609_1496 | 293 |
| 183 | 3300049572 | Ga0501036_0234145 | Ga0501036_0234145_116_1018 | 293 |
| 184 | 3300049585 | Ga0501069_0188958 | Ga0501069_0188958_32_919 | 293 |
| 185 | 3300049741 | Ga0501079_0361855 | Ga0501079_0361855_132_1019 | 293 |
| 186 | 3300049742 | Ga0501080_0426369 | Ga0501080_0426369_95_982 | 293 |
| 187 | 3300049822 | Ga0501035_0449839 | Ga0501035_0449839_109_996 | 293 |
| 188 | 3300050512 | nmdc:mga0n895_253865_c1 | nmdc:mga0n895_253865_c1_205_1125 | 293 |
| 189 | 3300053136 | Ga0500559_0005828 | Ga0500559_0005828_3749_4636 | 293 |
| 190 | 3300060353 | Ga0501082_0231590 | Ga0501082_0231590_409_1296 | 293 |
| 191 | 3300061734 | Ga0530510_0108897 | Ga0530510_0108897_242_1129 | 293 |
| 192 | 3300001977 | JGI24746J21847_1000437 | JGI24746J21847_10004376 | 294 |
| 193 | 3300001989 | JGI24739J22299_10002728 | JGI24739J22299_100027284 | 294 |
| 194 | 3300002073 | JGI24745J21846_1000373 | JGI24745J21846_10003733 | 294 |
| 195 | 3300002074 | JGI24748J21848_1000523 | JGI24748J21848_10005234 | 294 |
| 196 | 3300002075 | JGI24738J21930_10000045 | JGI24738J21930_1000004513 | 294 |
| 197 | 3300002076 | JGI24749J21850_1003211 | JGI24749J21850_10032112 | 294 |
| 198 | 3300002155 | JGI24033J26618_1001318 | JGI24033J26618_10013182 | 294 |
| 199 | 3300005290 | Ga0065712_10087675 | Ga0065712_100876753 | 294 |
| 200 | 3300005328 | Ga0070676_10000220 | Ga0070676_1000022026 | 294 |
| 201 | 3300005329 | Ga0070683_100000775 | Ga0070683_1000007755 | 294 |
| 202 | 3300005330 | Ga0070690_100009429 | Ga0070690_1000094295 | 294 |
| 203 | 3300005331 | Ga0070670_100005399 | Ga0070670_1000053999 | 294 |
| 204 | 3300005333 | Ga0070677_10000315 | Ga0070677_1000031514 | 294 |
| 205 | 3300005334 | Ga0068869_100000165 | Ga0068869_10000016530 | 294 |
| 206 | 3300005336 | Ga0070680_100020169 | Ga0070680_1000201693 | 294 |
| 207 | 3300005337 | Ga0070682_100000355 | Ga0070682_1000003557 | 294 |
| 208 | 3300005338 | Ga0068868_100112535 | Ga0068868_1001125353 | 294 |
| 209 | 3300005339 | Ga0070660_100001171 | Ga0070660_1000011719 | 294 |
| 210 | 3300005340 | Ga0070689_100000964 | Ga0070689_1000009647 | 294 |
| 211 | 3300005340 | Ga0070689_100198206 | Ga0070689_1001982062 | 294 |
| 212 | 3300005341 | Ga0070691_10000690 | Ga0070691_100006904 | 294 |
| 213 | 3300005343 | Ga0070687_100000108 | Ga0070687_10000010815 | 294 |
| 214 | 3300005344 | Ga0070661_100001187 | Ga0070661_1000011876 | 294 |
| 215 | 3300005344 | Ga0070661_100028102 | Ga0070661_1000281026 | 294 |
| 216 | 3300005345 | Ga0070692_10013294 | Ga0070692_100132943 | 294 |
| 217 | 3300005347 | Ga0070668_100001227 | Ga0070668_1000012275 | 294 |
| 218 | 3300005353 | Ga0070669_100000173 | Ga0070669_10000017327 | 294 |
| 219 | 3300005354 | Ga0070675_100008683 | Ga0070675_1000086832 | 294 |
| 220 | 3300005354 | Ga0070675_100187765 | Ga0070675_1001877651 | 294 |
| 221 | 3300005355 | Ga0070671_100001858 | Ga0070671_1000018587 | 294 |
| 222 | 3300005355 | Ga0070671_100059075 | Ga0070671_1000590754 | 294 |
| 223 | 3300005356 | Ga0070674_100000387 | Ga0070674_10000038721 | 294 |
| 224 | 3300005364 | Ga0070673_100003686 | Ga0070673_1000036864 | 294 |
| 225 | 3300005365 | Ga0070688_100000812 | Ga0070688_1000008127 | 294 |
| 226 | 3300005366 | Ga0070659_100001449 | Ga0070659_1000014497 | 294 |
| 227 | 3300005367 | Ga0070667_100002184 | Ga0070667_10000218415 | 294 |
| 228 | 3300005406 | Ga0070703_10005861 | Ga0070703_100058614 | 294 |
| 229 | 3300005435 | Ga0070714_100034470 | Ga0070714_1000344706 | 294 |
| 230 | 3300005436 | Ga0070713_100003440 | Ga0070713_1000034404 | 294 |
| 231 | 3300005437 | Ga0070710_10004961 | Ga0070710_100049614 | 294 |
| 232 | 3300005438 | Ga0070701_10000182 | Ga0070701_1000018214 | 294 |
| 233 | 3300005439 | Ga0070711_100087391 | Ga0070711_1000873911 | 294 |
| 234 | 3300005439 | Ga0070711_100104879 | Ga0070711_1001048794 | 294 |
| 235 | 3300005440 | Ga0070705_100001581 | Ga0070705_10000158110 | 294 |
| 236 | 3300005441 | Ga0070700_100000294 | Ga0070700_10000029415 | 294 |
| 237 | 3300005444 | Ga0070694_100017889 | Ga0070694_1000178892 | 294 |
| 238 | 3300005445 | Ga0070708_100063290 | Ga0070708_1000632904 | 294 |
| 239 | 3300005455 | Ga0070663_100000881 | Ga0070663_10000088113 | 294 |
| 240 | 3300005456 | Ga0070678_100000097 | Ga0070678_10000009716 | 294 |
| 241 | 3300005456 | Ga0070678_100064311 | Ga0070678_1000643112 | 294 |
| 242 | 3300005457 | Ga0070662_100018404 | Ga0070662_1000184044 | 294 |
| 243 | 3300005458 | Ga0070681_10000308 | Ga0070681_1000030822 | 294 |
| 244 | 3300005458 | Ga0070681_10030862 | Ga0070681_100308625 | 294 |
| 245 | 3300005459 | Ga0068867_100001290 | Ga0068867_1000012907 | 294 |
| 246 | 3300005466 | Ga0070685_10003447 | Ga0070685_100034474 | 294 |
| 247 | 3300005530 | Ga0070679_100001806 | Ga0070679_1000018064 | 294 |
| 248 | 3300005530 | Ga0070679_100142270 | Ga0070679_1001422702 | 294 |
| 249 | 3300005535 | Ga0070684_100000325 | Ga0070684_1000003257 | 294 |
| 250 | 3300005535 | Ga0070684_100106825 | Ga0070684_1001068252 | 294 |
| 251 | 3300005535 | Ga0070684_100388777 | Ga0070684_1003887771 | 294 |
| 252 | 3300005536 | Ga0070697_100123854 | Ga0070697_1001238542 | 294 |
| 253 | 3300005539 | Ga0068853_100009974 | Ga0068853_1000099747 | 294 |
| 254 | 3300005543 | Ga0070672_100034369 | Ga0070672_1000343692 | 294 |
| 255 | 3300005544 | Ga0070686_100001115 | Ga0070686_1000011157 | 294 |
| 256 | 3300005544 | Ga0070686_100246540 | Ga0070686_1002465402 | 294 |
| 257 | 3300005545 | Ga0070695_100001755 | Ga0070695_1000017555 | 294 |
| 258 | 3300005546 | Ga0070696_100000763 | Ga0070696_10000076320 | 294 |
| 259 | 3300005547 | Ga0070693_100000808 | Ga0070693_1000008087 | 294 |
| 260 | 3300005548 | Ga0070665_100207905 | Ga0070665_1002079052 | 294 |
| 261 | 3300005549 | Ga0070704_100000560 | Ga0070704_1000005605 | 294 |
| 262 | 3300005564 | Ga0070664_100000089 | Ga0070664_10000008945 | 294 |
| 263 | 3300005577 | Ga0068857_100000571 | Ga0068857_10000057121 | 294 |
| 264 | 3300005578 | Ga0068854_100001540 | Ga0068854_10000154013 | 294 |
| 265 | 3300005614 | Ga0068856_100001158 | Ga0068856_1000011587 | 294 |
| 266 | 3300005615 | Ga0070702_100000572 | Ga0070702_1000005728 | 294 |
| 267 | 3300005616 | Ga0068852_100001589 | Ga0068852_1000015891 | 294 |
| 268 | 3300005618 | Ga0068864_100006971 | Ga0068864_1000069714 | 294 |
| 269 | 3300005718 | Ga0068866_10001222 | Ga0068866_100012226 | 294 |
| 270 | 3300005719 | Ga0068861_100001053 | Ga0068861_10000105317 | 294 |
| 271 | 3300005840 | Ga0068870_10000130 | Ga0068870_100001304 | 294 |
| 272 | 3300005841 | Ga0068863_100008367 | Ga0068863_1000083678 | 294 |
| 273 | 3300005841 | Ga0068863_100328547 | Ga0068863_1003285472 | 294 |
| 274 | 3300005842 | Ga0068858_100009338 | Ga0068858_1000093384 | 294 |
| 275 | 3300005842 | Ga0068858_100112671 | Ga0068858_1001126713 | 294 |
| 276 | 3300005843 | Ga0068860_100005077 | Ga0068860_1000050777 | 294 |
| 277 | 3300005843 | Ga0068860_100090323 | Ga0068860_1000903232 | 294 |
| 278 | 3300005844 | Ga0068862_100005805 | Ga0068862_1000058058 | 294 |
| 279 | 3300005937 | Ga0081455_10000036 | Ga0081455_1000003665 | 294 |
| 280 | 3300005937 | Ga0081455_10011515 | Ga0081455_100115153 | 294 |
| 281 | 3300006028 | Ga0070717_10004085 | Ga0070717_1000408511 | 294 |
| 282 | 3300006058 | Ga0075432_10026605 | Ga0075432_100266053 | 294 |
| 283 | 3300006173 | Ga0070716_100005969 | Ga0070716_1000059699 | 294 |
| 284 | 3300006194 | Ga0075427_10001068 | Ga0075427_100010683 | 294 |
| 285 | 3300006237 | Ga0097621_100000638 | Ga0097621_10000063827 | 294 |
| 286 | 3300006237 | Ga0097621_100261382 | Ga0097621_1002613822 | 294 |
| 287 | 3300006358 | Ga0068871_100006181 | Ga0068871_1000061814 | 294 |
| 288 | 3300006358 | Ga0068871_100186159 | Ga0068871_1001861593 | 294 |
| 289 | 3300006844 | Ga0075428_100021920 | Ga0075428_1000219202 | 294 |
| 290 | 3300006846 | Ga0075430_100001846 | Ga0075430_10000184611 | 294 |
| 291 | 3300006847 | Ga0075431_100020464 | Ga0075431_1000204645 | 294 |
| 292 | 3300006847 | Ga0075431_100039816 | Ga0075431_1000398166 | 294 |
| 293 | 3300006852 | Ga0075433_10001346 | Ga0075433_1000134615 | 294 |
| 294 | 3300006852 | Ga0075433_10038027 | Ga0075433_100380274 | 294 |
| 295 | 3300006852 | Ga0075433_10094526 | Ga0075433_100945262 | 294 |
| 296 | 3300006871 | Ga0075434_100000387 | Ga0075434_10000038723 | 294 |
| 297 | 3300006871 | Ga0075434_100009027 | Ga0075434_1000090272 | 294 |
| 298 | 3300006871 | Ga0075434_100032269 | Ga0075434_1000322693 | 294 |
| 299 | 3300006871 | Ga0075434_100045288 | Ga0075434_1000452881 | 294 |
| 300 | 3300006871 | Ga0075434_100077160 | Ga0075434_1000771602 | 294 |
| 301 | 3300006871 | Ga0075434_100295223 | Ga0075434_1002952232 | 294 |
| 302 | 3300006880 | Ga0075429_100009528 | Ga0075429_1000095282 | 294 |
| 303 | 3300006881 | Ga0068865_100003088 | Ga0068865_1000030888 | 294 |
| 304 | 3300007076 | Ga0075435_100006725 | Ga0075435_1000067254 | 294 |
| 305 | 3300007076 | Ga0075435_100017000 | Ga0075435_1000170003 | 294 |
| 306 | 3300007076 | Ga0075435_100032050 | Ga0075435_1000320504 | 294 |
| 307 | 3300007076 | Ga0075435_100318113 | Ga0075435_1003181132 | 294 |
| 308 | 3300009094 | Ga0111539_10000082 | Ga0111539_1000008272 | 294 |
| 309 | 3300009094 | Ga0111539_10005016 | Ga0111539_1000501611 | 294 |
| 310 | 3300009098 | Ga0105245_10006051 | Ga0105245_100060519 | 294 |
| 311 | 3300009098 | Ga0105245_10239174 | Ga0105245_102391741 | 294 |
| 312 | 3300009147 | Ga0114129_10027390 | Ga0114129_100273905 | 294 |
| 313 | 3300009148 | Ga0105243_10001273 | Ga0105243_1000127310 | 294 |
| 314 | 3300009148 | Ga0105243_10121133 | Ga0105243_101211333 | 294 |
| 315 | 3300009174 | Ga0105241_10000977 | Ga0105241_100009774 | 294 |
| 316 | 3300009176 | Ga0105242_10000666 | Ga0105242_100006664 | 294 |
| 317 | 3300009176 | Ga0105242_10063784 | Ga0105242_100637844 | 294 |
| 318 | 3300009177 | Ga0105248_10230243 | Ga0105248_102302433 | 294 |
| 319 | 3300009545 | Ga0105237_10095997 | Ga0105237_100959974 | 294 |
| 320 | 3300010375 | Ga0105239_10006896 | Ga0105239_100068968 | 294 |
| 321 | 3300011119 | Ga0105246_10075082 | Ga0105246_100750823 | 294 |
| 322 | 3300011119 | Ga0105246_10261653 | Ga0105246_102616532 | 294 |
| 323 | 3300013100 | Ga0157373_10026797 | Ga0157373_100267972 | 294 |
| 324 | 3300013296 | Ga0157374_10001732 | Ga0157374_100017324 | 294 |
| 325 | 3300013297 | Ga0157378_10007752 | Ga0157378_100077528 | 294 |
| 326 | 3300013297 | Ga0157378_10114410 | Ga0157378_101144102 | 294 |
| 327 | 3300013297 | Ga0157378_10411044 | Ga0157378_104110441 | 294 |
| 328 | 3300013306 | Ga0163162_10001862 | Ga0163162_1000186215 | 294 |
| 329 | 3300013307 | Ga0157372_10088738 | Ga0157372_100887383 | 294 |
| 330 | 3300013308 | Ga0157375_10000177 | Ga0157375_100001777 | 294 |
| 331 | 3300014325 | Ga0163163_10068172 | Ga0163163_100681723 | 294 |
| 332 | 3300014325 | Ga0163163_10699535 | Ga0163163_106995351 | 294 |
| 333 | 3300014326 | Ga0157380_10000783 | Ga0157380_1000078321 | 294 |
| 334 | 3300014745 | Ga0157377_10017731 | Ga0157377_100177312 | 294 |
| 335 | 3300014968 | Ga0157379_10017484 | Ga0157379_100174844 | 294 |
| 336 | 3300014968 | Ga0157379_10039762 | Ga0157379_100397623 | 294 |
| 337 | 3300017792 | Ga0163161_10002993 | Ga0163161_100029934 | 294 |
| 338 | 3300025271 | Ga0207666_1000012 | Ga0207666_10000127 | 294 |
| 339 | 3300025290 | Ga0207673_1000076 | Ga0207673_10000764 | 294 |
| 340 | 3300025315 | Ga0207697_10000032 | Ga0207697_100000327 | 294 |
| 341 | 3300025893 | Ga0207682_10002281 | Ga0207682_100022816 | 294 |
| 342 | 3300025899 | Ga0207642_10000392 | Ga0207642_1000039211 | 294 |
| 343 | 3300025899 | Ga0207642_10065010 | Ga0207642_100650101 | 294 |
| 344 | 3300025901 | Ga0207688_10002931 | Ga0207688_100029317 | 294 |
| 345 | 3300025904 | Ga0207647_10005102 | Ga0207647_100051025 | 294 |
| 346 | 3300025906 | Ga0207699_10031728 | Ga0207699_100317282 | 294 |
| 347 | 3300025907 | Ga0207645_10000074 | Ga0207645_1000007471 | 294 |
| 348 | 3300025908 | Ga0207643_10006362 | Ga0207643_100063624 | 294 |
| 349 | 3300025911 | Ga0207654_10002888 | Ga0207654_100028884 | 294 |
| 350 | 3300025912 | Ga0207707_10001963 | Ga0207707_1000196313 | 294 |
| 351 | 3300025912 | Ga0207707_10209989 | Ga0207707_102099892 | 294 |
| 352 | 3300025913 | Ga0207695_10320910 | Ga0207695_103209101 | 294 |
| 353 | 3300025914 | Ga0207671_10472257 | Ga0207671_104722571 | 294 |
| 354 | 3300025915 | Ga0207693_10019018 | Ga0207693_100190183 | 294 |
| 355 | 3300025916 | Ga0207663_10106671 | Ga0207663_101066713 | 294 |
| 356 | 3300025917 | Ga0207660_10000243 | Ga0207660_1000024310 | 294 |
| 357 | 3300025918 | Ga0207662_10000753 | Ga0207662_100007534 | 294 |
| 358 | 3300025918 | Ga0207662_10034315 | Ga0207662_100343153 | 294 |
| 359 | 3300025919 | Ga0207657_10002717 | Ga0207657_100027177 | 294 |
| 360 | 3300025920 | Ga0207649_10000201 | Ga0207649_1000020122 | 294 |
| 361 | 3300025923 | Ga0207681_10000375 | Ga0207681_1000037520 | 294 |
| 362 | 3300025925 | Ga0207650_10026632 | Ga0207650_100266322 | 294 |
| 363 | 3300025925 | Ga0207650_10113387 | Ga0207650_101133873 | 294 |
| 364 | 3300025926 | Ga0207659_10000039 | Ga0207659_1000003914 | 294 |
| 365 | 3300025927 | Ga0207687_10000347 | Ga0207687_100003476 | 294 |
| 366 | 3300025928 | Ga0207700_10001324 | Ga0207700_1000132412 | 294 |
| 367 | 3300025929 | Ga0207664_10081969 | Ga0207664_100819692 | 294 |
| 368 | 3300025931 | Ga0207644_10001356 | Ga0207644_100013567 | 294 |
| 369 | 3300025931 | Ga0207644_10012872 | Ga0207644_100128724 | 294 |
| 370 | 3300025932 | Ga0207690_10000271 | Ga0207690_1000027127 | 294 |
| 371 | 3300025933 | Ga0207706_10008840 | Ga0207706_100088404 | 294 |
| 372 | 3300025934 | Ga0207686_10000698 | Ga0207686_100006987 | 294 |
| 373 | 3300025934 | Ga0207686_10077443 | Ga0207686_100774432 | 294 |
| 374 | 3300025934 | Ga0207686_10292788 | Ga0207686_102927881 | 294 |
| 375 | 3300025935 | Ga0207709_10003374 | Ga0207709_100033741 | 294 |
| 376 | 3300025936 | Ga0207670_10000432 | Ga0207670_100004329 | 294 |
| 377 | 3300025937 | Ga0207669_10000043 | Ga0207669_1000004349 | 294 |
| 378 | 3300025938 | Ga0207704_10000285 | Ga0207704_1000028521 | 294 |
| 379 | 3300025939 | Ga0207665_10003696 | Ga0207665_1000369610 | 294 |
| 380 | 3300025940 | Ga0207691_10000169 | Ga0207691_1000016965 | 294 |
| 381 | 3300025941 | Ga0207711_10183741 | Ga0207711_101837413 | 294 |
| 382 | 3300025942 | Ga0207689_10007874 | Ga0207689_100078747 | 294 |
| 383 | 3300025944 | Ga0207661_10000764 | Ga0207661_1000076415 | 294 |
| 384 | 3300025944 | Ga0207661_10072062 | Ga0207661_100720623 | 294 |
| 385 | 3300025945 | Ga0207679_10000030 | Ga0207679_1000003095 | 294 |
| 386 | 3300025945 | Ga0207679_10049665 | Ga0207679_100496652 | 294 |
| 387 | 3300025949 | Ga0207667_10069014 | Ga0207667_100690144 | 294 |
| 388 | 3300025960 | Ga0207651_10001313 | Ga0207651_100013134 | 294 |
| 389 | 3300025961 | Ga0207712_10000396 | Ga0207712_1000039628 | 294 |
| 390 | 3300025972 | Ga0207668_10000312 | Ga0207668_1000031214 | 294 |
| 391 | 3300025981 | Ga0207640_10011962 | Ga0207640_100119623 | 294 |
| 392 | 3300025986 | Ga0207658_10004659 | Ga0207658_100046594 | 294 |
| 393 | 3300026023 | Ga0207677_10001531 | Ga0207677_1000153110 | 294 |
| 394 | 3300026035 | Ga0207703_10001648 | Ga0207703_1000164821 | 294 |
| 395 | 3300026035 | Ga0207703_10086555 | Ga0207703_100865552 | 294 |
| 396 | 3300026035 | Ga0207703_10182261 | Ga0207703_101822611 | 294 |
| 397 | 3300026041 | Ga0207639_10007077 | Ga0207639_100070772 | 294 |
| 398 | 3300026067 | Ga0207678_10000266 | Ga0207678_1000026649 | 294 |
| 399 | 3300026067 | Ga0207678_10057003 | Ga0207678_100570032 | 294 |
| 400 | 3300026075 | Ga0207708_10000383 | Ga0207708_100003837 | 294 |
| 401 | 3300026078 | Ga0207702_10009618 | Ga0207702_100096184 | 294 |
| 402 | 3300026088 | Ga0207641_10001892 | Ga0207641_100018928 | 294 |
| 403 | 3300026088 | Ga0207641_10075261 | Ga0207641_100752615 | 294 |
| 404 | 3300026089 | Ga0207648_10000272 | Ga0207648_1000027259 | 294 |
| 405 | 3300026095 | Ga0207676_10000074 | Ga0207676_1000007471 | 294 |
| 406 | 3300026116 | Ga0207674_10000135 | Ga0207674_100001357 | 294 |
| 407 | 3300026118 | Ga0207675_100003473 | Ga0207675_1000034737 | 294 |
| 408 | 3300026121 | Ga0207683_10000136 | Ga0207683_100001364 | 294 |
| 409 | 3300026121 | Ga0207683_10001596 | Ga0207683_1000159611 | 294 |
| 410 | 3300027695 | Ga0209966_1004920 | Ga0209966_10049203 | 294 |
| 411 | 3300027717 | Ga0209998_10005189 | Ga0209998_100051893 | 294 |
| 412 | 3300027717 | Ga0209998_10005230 | Ga0209998_100052302 | 294 |
| 413 | 3300027717 | Ga0209998_10017982 | Ga0209998_100179822 | 294 |
| 414 | 3300027876 | Ga0209974_10001126 | Ga0209974_100011267 | 294 |
| 415 | 3300027907 | Ga0207428_10000702 | Ga0207428_1000070213 | 294 |
| 416 | 3300027907 | Ga0207428_10001429 | Ga0207428_1000142911 | 294 |
| 417 | 3300028379 | Ga0268266_10013326 | Ga0268266_100133264 | 294 |
| 418 | 3300028380 | Ga0268265_10002284 | Ga0268265_100022847 | 294 |
| 419 | 3300028381 | Ga0268264_10001372 | Ga0268264_1000137211 | 294 |
| 420 | 3300034816 | Ga0373930_0009964 | Ga0373930_0009964_419_1303 | 294 |
| 421 | 3300034818 | Ga0373950_0006978 | Ga0373950_0006978_573_1499 | 294 |
| 422 | 3300034818 | Ga0373950_0017175 | Ga0373950_0017175_281_1165 | 294 |
| 423 | 3300034957 | Ga0373938_0001612 | Ga0373938_0001612_1360_2244 | 294 |
| 424 | 3300035084 | Ga0373928_0001756 | Ga0373928_0001756_1507_2391 | 294 |
| 425 | 3300035089 | Ga0373944_0010557 | Ga0373944_0010557_1472_2398 | 294 |
| 426 | 3300035090 | Ga0373949_0000926 | Ga0373949_0000926_506_1390 | 294 |
| 427 | 3300035091 | Ga0373951_0010729 | Ga0373951_0010729_538_1464 | 294 |
| 428 | 3300035092 | Ga0373952_0001063 | Ga0373952_0001063_641_1525 | 294 |
| 429 | 3300035111 | Ga0373923_0064231 | Ga0373923_0064231_467_1357 | 294 |
| 430 | 3300035112 | Ga0373932_0001553 | Ga0373932_0001553_3162_4046 | 294 |
| 431 | 3300035114 | Ga0373939_0002684 | Ga0373939_0002684_1600_2484 | 294 |
| 432 | 3300035115 | Ga0373941_0002874 | Ga0373941_0002874_1689_2573 | 294 |
| 433 | 3300035116 | Ga0373945_0023132 | Ga0373945_0023132_763_1653 | 294 |
| 434 | 3300035116 | Ga0373945_0105131 | Ga0373945_0105131_72_998 | 294 |
| 435 | 3300035121 | Ga0373960_0010800 | Ga0373960_0010800_584_1510 | 294 |
| 436 | 3300035121 | Ga0373960_0013322 | Ga0373960_0013322_373_1257 | 294 |
| 437 | 3300035170 | Ga0373943_0044158 | Ga0373943_0044158_179_1069 | 294 |
| 438 | 3300035207 | Ga0373942_0002333 | Ga0373942_0002333_1438_2322 | 294 |
| 439 | 3300035241 | Ga0373961_0003246 | Ga0373961_0003246_485_1369 | 294 |
| 440 | 3300035242 | Ga0373962_0000514 | Ga0373962_0000514_1048_1932 | 294 |
| 441 | 3300035242 | Ga0373962_0003428 | Ga0373962_0003428_2307_3233 | 294 |
| 442 | 3300035691 | Ga0373931_0000249 | Ga0373931_0000249_14427_15311 | 294 |
| 443 | 3300035691 | Ga0373931_0232637 | Ga0373931_0232637_63_989 | 294 |
| 444 | 3300035692 | Ga0373935_0160429 | Ga0373935_0160429_528_1454 | 294 |
| 445 | 3300035725 | Ga0373947_0001407 | Ga0373947_0001407_4113_5039 | 294 |
| 446 | 3300037068 | Ga0373925_0023819 | Ga0373925_0023819_1885_2811 | 294 |
| 447 | 3300037312 | Ga0395899_0195447 | Ga0395899_0195447_79_969 | 294 |
| 448 | 3300037418 | Ga0395900_0207412 | Ga0395900_0207412_493_1383 | 294 |
| 449 | 3300037466 | Ga0395898_0003815 | Ga0395898_0003815_108_998 | 294 |
| 450 | 3300046455 | Ga0495603_0002528 | Ga0495603_0002528_9777_10703 | 294 |
| 451 | 3300046459 | Ga0495629_0000473 | Ga0495629_0000473_32550_33476 | 294 |
| 452 | 3300046459 | Ga0495629_0053264 | Ga0495629_0053264_241_1131 | 294 |
| 453 | 3300046461 | Ga0495641_0083376 | Ga0495641_0083376_193_1083 | 294 |
| 454 | 3300046463 | Ga0495653_0144751 | Ga0495653_0144751_495_1385 | 294 |
| 455 | 3300046473 | Ga0495582_0010936 | Ga0495582_0010936_1608_2534 | 294 |
| 456 | 3300046475 | Ga0495639_0067122 | Ga0495639_0067122_306_1196 | 294 |
| 457 | 3300046476 | Ga0495662_0062011 | Ga0495662_0062011_499_1389 | 294 |
| 458 | 3300046477 | Ga0495664_0014986 | Ga0495664_0014986_1862_2752 | 294 |
| 459 | 3300046499 | Ga0495594_0006922 | Ga0495594_0006922_1088_2014 | 294 |
| 460 | 3300046514 | Ga0495618_0189049 | Ga0495618_0189049_226_1116 | 294 |
| 461 | 3300046529 | Ga0495652_0060197 | Ga0495652_0060197_410_1300 | 294 |
| 462 | 3300046533 | Ga0495640_0028912 | Ga0495640_0028912_847_1737 | 294 |
| 463 | 3300046642 | Ga0495634_0058118 | Ga0495634_0058118_390_1280 | 294 |
| 464 | 3300046663 | Ga0495635_0216215 | Ga0495635_0216215_314_1240 | 294 |
| 465 | 3300046681 | Ga0495647_0024570 | Ga0495647_0024570_293_1219 | 294 |
| 466 | 3300046683 | Ga0495658_0000557 | Ga0495658_0000557_12084_13010 | 294 |
| 467 | 3300046689 | Ga0495613_0031441 | Ga0495613_0031441_573_1499 | 294 |
| 468 | 3300047315 | Ga0495581_0023207 | Ga0495581_0023207_2282_3208 | 294 |
| 469 | 3300047321 | Ga0495676_0063324 | Ga0495676_0063324_1686_2612 | 294 |
| 470 | 3300047322 | Ga0495680_0008202 | Ga0495680_0008202_4768_5694 | 294 |
| 471 | 3300047322 | Ga0495680_0094045 | Ga0495680_0094045_1309_2199 | 294 |
| 472 | 3300047471 | Ga0495684_0155879 | Ga0495684_0155879_804_1694 | 294 |
| 473 | 3300047471 | Ga0495684_0183102 | Ga0495684_0183102_42_968 | 294 |
| 474 | 3300047673 | Ga0495593_0024102 | Ga0495593_0024102_1719_2609 | 294 |
| 475 | 3300047673 | Ga0495593_0033599 | Ga0495593_0033599_384_1310 | 294 |
| 476 | 3300048089 | Ga0495614_0082010 | Ga0495614_0082010_60_986 | 294 |
| 477 | 3300048903 | Ga0496100_0000363 | Ga0496100_0000363_17360_18244 | 294 |
| 478 | 3300048903 | Ga0496100_0237753 | Ga0496100_0237753_212_1102 | 294 |
| 479 | 3300048904 | Ga0496101_0000136 | Ga0496101_0000136_11435_12319 | 294 |
| 480 | 3300048904 | Ga0496101_0022404 | Ga0496101_0022404_2173_3096 | 294 |
| 481 | 3300048904 | Ga0496101_0058283 | Ga0496101_0058283_935_1825 | 294 |
| 482 | 3300048904 | Ga0496101_0097743 | Ga0496101_0097743_1014_1904 | 294 |
| 483 | 3300048904 | Ga0496101_0099112 | Ga0496101_0099112_425_1309 | 294 |
| 484 | 3300048905 | Ga0496102_0017179 | Ga0496102_0017179_4198_5082 | 294 |
| 485 | 3300048905 | Ga0496102_0076950 | Ga0496102_0076950_1011_1937 | 294 |
| 486 | 3300048905 | Ga0496102_0091063 | Ga0496102_0091063_1038_1961 | 294 |
| 487 | 3300048905 | Ga0496102_0098641 | Ga0496102_0098641_1005_1928 | 294 |
| 488 | 3300048905 | Ga0496102_0110321 | Ga0496102_0110321_1371_2261 | 294 |
| 489 | 3300048906 | Ga0496103_0001236 | Ga0496103_0001236_15185_16069 | 294 |
| 490 | 3300048906 | Ga0496103_0093342 | Ga0496103_0093342_567_1493 | 294 |
| 491 | 3300048907 | Ga0496104_0024694 | Ga0496104_0024694_2890_3813 | 294 |
| 492 | 3300048907 | Ga0496104_0025731 | Ga0496104_0025731_3516_4439 | 294 |
| 493 | 3300048907 | Ga0496104_0080152 | Ga0496104_0080152_1149_2075 | 294 |
| 494 | 3300048907 | Ga0496104_0180269 | Ga0496104_0180269_105_989 | 294 |
| 495 | 3300048907 | Ga0496104_0231882 | Ga0496104_0231882_20_904 | 294 |
| 496 | 3300048908 | Ga0496105_0012384 | Ga0496105_0012384_1032_1955 | 294 |
| 497 | 3300048908 | Ga0496105_0018275 | Ga0496105_0018275_918_1841 | 294 |
| 498 | 3300048908 | Ga0496105_0029885 | Ga0496105_0029885_2597_3520 | 294 |
| 499 | 3300048908 | Ga0496105_0165831 | Ga0496105_0165831_737_1627 | 294 |
| 500 | 3300048908 | Ga0496105_0303807 | Ga0496105_0303807_76_960 | 294 |
| 501 | 3300048909 | Ga0496106_0010263 | Ga0496106_0010263_926_1849 | 294 |
| 502 | 3300048909 | Ga0496106_0051771 | Ga0496106_0051771_41_925 | 294 |
| 503 | 3300048909 | Ga0496106_0260047 | Ga0496106_0260047_363_1247 | 294 |
| 504 | 3300048910 | Ga0496107_0029806 | Ga0496107_0029806_1166_2089 | 294 |
| 505 | 3300048910 | Ga0496107_0042674 | Ga0496107_0042674_814_1698 | 294 |
| 506 | 3300048910 | Ga0496107_0042757 | Ga0496107_0042757_1899_2825 | 294 |
| 507 | 3300048910 | Ga0496107_0044636 | Ga0496107_0044636_1382_2266 | 294 |
| 508 | 3300048911 | Ga0496108_0018445 | Ga0496108_0018445_2842_3726 | 294 |
| 509 | 3300048911 | Ga0496108_0024030 | Ga0496108_0024030_2628_3551 | 294 |
| 510 | 3300048911 | Ga0496108_0032576 | Ga0496108_0032576_779_1702 | 294 |
| 511 | 3300048911 | Ga0496108_0118472 | Ga0496108_0118472_726_1610 | 294 |
| 512 | 3300048912 | Ga0496109_0000771 | Ga0496109_0000771_8121_9005 | 294 |
| 513 | 3300048912 | Ga0496109_0025662 | Ga0496109_0025662_1863_2786 | 294 |
| 514 | 3300048912 | Ga0496109_0047955 | Ga0496109_0047955_1797_2720 | 294 |
| 515 | 3300048912 | Ga0496109_0105391 | Ga0496109_0105391_978_1904 | 294 |
| 516 | 3300048912 | Ga0496109_0211151 | Ga0496109_0211151_889_1773 | 294 |
| 517 | 3300048913 | Ga0496110_0013968 | Ga0496110_0013968_1916_2839 | 294 |
| 518 | 3300048913 | Ga0496110_0076727 | Ga0496110_0076727_1053_1976 | 294 |
| 519 | 3300048913 | Ga0496110_0175257 | Ga0496110_0175257_802_1686 | 294 |
| 520 | 3300048914 | Ga0496111_0013864 | Ga0496111_0013864_3359_4282 | 294 |
| 521 | 3300048914 | Ga0496111_0037705 | Ga0496111_0037705_1562_2485 | 294 |
| 522 | 3300048914 | Ga0496111_0068548 | Ga0496111_0068548_1037_1921 | 294 |
| 523 | 3300048915 | Ga0496112_0019971 | Ga0496112_0019971_1603_2526 | 294 |
| 524 | 3300048915 | Ga0496112_0028147 | Ga0496112_0028147_1872_2795 | 294 |
| 525 | 3300048915 | Ga0496112_0106001 | Ga0496112_0106001_1051_1974 | 294 |
| 526 | 3300048915 | Ga0496112_0154826 | Ga0496112_0154826_966_1856 | 294 |
| 527 | 3300048916 | Ga0496113_0002900 | Ga0496113_0002900_4588_5511 | 294 |
| 528 | 3300048916 | Ga0496113_0010822 | Ga0496113_0010822_1133_2056 | 294 |
| 529 | 3300048916 | Ga0496113_0026128 | Ga0496113_0026128_709_1593 | 294 |
| 530 | 3300048916 | Ga0496113_0092102 | Ga0496113_0092102_527_1411 | 294 |
| 531 | 3300048916 | Ga0496113_0132826 | Ga0496113_0132826_931_1821 | 294 |
| 532 | 3300048917 | Ga0496114_0063152 | Ga0496114_0063152_933_1817 | 294 |
| 533 | 3300048918 | Ga0496115_0001192 | Ga0496115_0001192_6317_7201 | 294 |
| 534 | 3300048918 | Ga0496115_0031621 | Ga0496115_0031621_620_1543 | 294 |
| 535 | 3300048918 | Ga0496115_0063850 | Ga0496115_0063850_926_1849 | 294 |
| 536 | 3300050507 | nmdc:mga05p37_3938_c1 | nmdc:mga05p37_3938_c1_9460_10350 | 294 |
| 537 | 3300050508 | nmdc:mga09592_3119_c1 | nmdc:mga09592_3119_c1_6762_7652 | 294 |
| 538 | 3300050509 | nmdc:mga0qj67_409837_c1 | nmdc:mga0qj67_409837_c1_170_1054 | 294 |
| 539 | 3300050509 | nmdc:mga0qj67_5979_c1 | nmdc:mga0qj67_5979_c1_4730_5620 | 294 |
| 540 | 3300050510 | nmdc:mga06r32_18804_c1 | nmdc:mga06r32_18804_c1_2602_3486 | 294 |
| 541 | 3300050510 | nmdc:mga06r32_3736_c1 | nmdc:mga06r32_3736_c1_9324_10214 | 294 |
| 542 | 3300050511 | nmdc:mga08y16_3226_c2 | nmdc:mga08y16_3226_c2_4563_5453 | 294 |
| 543 | 3300050511 | nmdc:mga08y16_4462_c1 | nmdc:mga08y16_4462_c1_2737_3621 | 294 |
| 544 | 3300050512 | nmdc:mga0n895_1795_c1 | nmdc:mga0n895_1795_c1_10285_11175 | 294 |
| 545 | 3300050512 | nmdc:mga0n895_1804_c1 | nmdc:mga0n895_1804_c1_4378_5262 | 294 |
| 546 | 3300050512 | nmdc:mga0n895_42739_c1 | nmdc:mga0n895_42739_c1_694_1620 | 294 |
| 547 | 3300050512 | nmdc:mga0n895_44001_c1 | nmdc:mga0n895_44001_c1_3094_4020 | 294 |
| 548 | 3300050512 | nmdc:mga0n895_76827_c1 | nmdc:mga0n895_76827_c1_407_1300 | 294 |
| 549 | 3300050513 | nmdc:mga0rr50_1015_c1 | nmdc:mga0rr50_1015_c1_10809_11699 | 294 |
| 550 | 3300050513 | nmdc:mga0rr50_294391_c1 | nmdc:mga0rr50_294391_c1_95_1021 | 294 |
| 551 | 3300050514 | nmdc:mga08x19_212839_c1 | nmdc:mga08x19_212839_c1_197_1123 | 294 |
| 552 | 3300050515 | nmdc:mga0a205_1082_c1 | nmdc:mga0a205_1082_c1_9347_10237 | 294 |
| 553 | 3300050515 | nmdc:mga0a205_17882_c1 | nmdc:mga0a205_17882_c1_1384_2277 | 294 |
| 554 | 3300050515 | nmdc:mga0a205_301084_c1 | nmdc:mga0a205_301084_c1_94_1020 | 294 |
| 555 | 3300050515 | nmdc:mga0a205_4499_c1 | nmdc:mga0a205_4499_c1_8946_9830 | 294 |
| 556 | 3300053077 | Ga0495601_0000963 | Ga0495601_0000963_7949_8839 | 294 |
| 557 | 3300053078 | Ga0495612_0008798 | Ga0495612_0008798_2354_3244 | 294 |
| 558 | 3300053085 | Ga0495619_0001993 | Ga0495619_0001993_5937_6863 | 294 |
| 559 | 3300053085 | Ga0495619_0018762 | Ga0495619_0018762_3331_4221 | 294 |
| 560 | 3300005344 | Ga0070661_100184835 | Ga0070661_1001848351 | 295 |
| 561 | 3300005344 | Ga0070661_100205584 | Ga0070661_1002055842 | 295 |
| 562 | 3300005366 | Ga0070659_100264718 | Ga0070659_1002647181 | 295 |
| 563 | 3300005471 | Ga0070698_100085336 | Ga0070698_1000853362 | 295 |
| 564 | 3300005616 | Ga0068852_100473179 | Ga0068852_1004731792 | 295 |
| 565 | 3300006173 | Ga0070716_100005900 | Ga0070716_1000059005 | 295 |
| 566 | 3300009094 | Ga0111539_10568800 | Ga0111539_105688001 | 295 |
| 567 | 3300013104 | Ga0157370_10025892 | Ga0157370_100258922 | 295 |
| 568 | 3300013105 | Ga0157369_10433977 | Ga0157369_104339772 | 295 |
| 569 | 3300013307 | Ga0157372_10703965 | Ga0157372_107039651 | 295 |
| 570 | 3300014497 | Ga0182008_10094265 | Ga0182008_100942653 | 295 |
| 571 | 3300025920 | Ga0207649_10067758 | Ga0207649_100677583 | 295 |
| 572 | 3300025932 | Ga0207690_10143017 | Ga0207690_101430171 | 295 |
| 573 | 3300025949 | Ga0207667_10174904 | Ga0207667_101749044 | 295 |
| 574 | 3300035086 | Ga0373934_0090531 | Ga0373934_0090531_42_935 | 295 |
| 575 | 3300035089 | Ga0373944_0004186 | Ga0373944_0004186_1034_1927 | 295 |
| 576 | 3300035113 | Ga0373936_0016212 | Ga0373936_0016212_1686_2624 | 295 |
| 577 | 3300035116 | Ga0373945_0023332 | Ga0373945_0023332_431_1324 | 295 |
| 578 | 3300035116 | Ga0373945_0051728 | Ga0373945_0051728_227_1126 | 295 |
| 579 | 3300035117 | Ga0373953_0101809 | Ga0373953_0101809_40_933 | 295 |
| 580 | 3300035118 | Ga0373954_0101194 | Ga0373954_0101194_433_1326 | 295 |
| 581 | 3300035119 | Ga0373956_0063353 | Ga0373956_0063353_66_959 | 295 |
| 582 | 3300035170 | Ga0373943_0023255 | Ga0373943_0023255_1328_2266 | 295 |
| 583 | 3300035171 | Ga0373946_0023079 | Ga0373946_0023079_540_1433 | 295 |
| 584 | 3300035724 | Ga0373933_0109440 | Ga0373933_0109440_555_1448 | 295 |
| 585 | 3300035725 | Ga0373947_0050559 | Ga0373947_0050559_80_973 | 295 |
| 586 | 3300041408 | Ga0439453_0003702 | Ga0439453_0003702_846_1742 | 295 |
| 587 | 3300046455 | Ga0495603_0040714 | Ga0495603_0040714_899_1792 | 295 |
| 588 | 3300046459 | Ga0495629_0024003 | Ga0495629_0024003_643_1536 | 295 |
| 589 | 3300046460 | Ga0495638_0044451 | Ga0495638_0044451_238_1131 | 295 |
| 590 | 3300046461 | Ga0495641_0021264 | Ga0495641_0021264_2287_3225 | 295 |
| 591 | 3300046462 | Ga0495651_0003643 | Ga0495651_0003643_1668_2606 | 295 |
| 592 | 3300046463 | Ga0495653_0079832 | Ga0495653_0079832_882_1775 | 295 |
| 593 | 3300046472 | Ga0495580_0007386 | Ga0495580_0007386_7060_7953 | 295 |
| 594 | 3300046475 | Ga0495639_0110988 | Ga0495639_0110988_80_973 | 295 |
| 595 | 3300046476 | Ga0495662_0007357 | Ga0495662_0007357_2882_3775 | 295 |
| 596 | 3300046477 | Ga0495664_0161455 | Ga0495664_0161455_450_1343 | 295 |
| 597 | 3300046492 | Ga0495585_0004147 | Ga0495585_0004147_5858_6751 | 295 |
| 598 | 3300046499 | Ga0495594_0048372 | Ga0495594_0048372_79_972 | 295 |
| 599 | 3300046501 | Ga0495607_0108473 | Ga0495607_0108473_572_1465 | 295 |
| 600 | 3300046511 | Ga0495608_0092920 | Ga0495608_0092920_1045_1938 | 295 |
| 601 | 3300046517 | Ga0495630_0068633 | Ga0495630_0068633_1131_2024 | 295 |
| 602 | 3300046523 | Ga0495644_0002015 | Ga0495644_0002015_829_1722 | 295 |
| 603 | 3300046526 | Ga0495666_0097570 | Ga0495666_0097570_440_1333 | 295 |
| 604 | 3300046531 | Ga0495665_0045563 | Ga0495665_0045563_643_1536 | 295 |
| 605 | 3300046533 | Ga0495640_0067441 | Ga0495640_0067441_361_1254 | 295 |
| 606 | 3300046535 | Ga0495586_0104711 | Ga0495586_0104711_298_1191 | 295 |
| 607 | 3300046536 | Ga0495587_0057431 | Ga0495587_0057431_794_1687 | 295 |
| 608 | 3300046557 | Ga0495622_0024704 | Ga0495622_0024704_1420_2313 | 295 |
| 609 | 3300046558 | Ga0495633_0009234 | Ga0495633_0009234_228_1121 | 295 |
| 610 | 3300046615 | Ga0495656_0000562 | Ga0495656_0000562_630_1523 | 295 |
| 611 | 3300046678 | Ga0495599_0113535 | Ga0495599_0113535_111_1004 | 295 |
| 612 | 3300046681 | Ga0495647_0011512 | Ga0495647_0011512_1650_2588 | 295 |
| 613 | 3300046691 | Ga0495670_0007228 | Ga0495670_0007228_1369_2262 | 295 |
| 614 | 3300046692 | Ga0495671_0084933 | Ga0495671_0084933_425_1318 | 295 |
| 615 | 3300046809 | Ga0495600_0026167 | Ga0495600_0026167_1950_2888 | 295 |
| 616 | 3300047317 | Ga0495604_0041603 | Ga0495604_0041603_2258_3151 | 295 |
| 617 | 3300047319 | Ga0495674_0055413 | Ga0495674_0055413_761_1654 | 295 |
| 618 | 3300047322 | Ga0495680_0059042 | Ga0495680_0059042_1823_2716 | 295 |
| 619 | 3300047446 | Ga0495679_022908 | Ga0495679_022908_268_1161 | 295 |
| 620 | 3300047471 | Ga0495684_0021314 | Ga0495684_0021314_1669_2562 | 295 |
| 621 | 3300048088 | Ga0495602_0055382 | Ga0495602_0055382_1043_1936 | 295 |
| 622 | 3300053078 | Ga0495612_0002575 | Ga0495612_0002575_2980_3873 | 295 |
| 623 | 3300053084 | Ga0495595_0010716 | Ga0495595_0010716_2477_3370 | 295 |
| 624 | 3300053085 | Ga0495619_0009900 | Ga0495619_0009900_3598_4491 | 295 |
| 625 | 3300005439 | Ga0070711_100003929 | Ga0070711_1000039295 | 296 |
| 626 | 3300006173 | Ga0070716_100140997 | Ga0070716_1001409973 | 296 |
| 627 | 3300013306 | Ga0163162_10558081 | Ga0163162_105580812 | 296 |
| 628 | 3300025916 | Ga0207663_10017896 | Ga0207663_100178962 | 296 |
| 629 | 3300026121 | Ga0207683_10494004 | Ga0207683_104940041 | 296 |
| 630 | 3300037418 | Ga0395900_0016463 | Ga0395900_0016463_1395_2306 | 296 |
| 631 | 3300037466 | Ga0395898_0022725 | Ga0395898_0022725_1370_2281 | 296 |
| 632 | 3300038443 | Ga0395901_0024020 | Ga0395901_0024020_2504_3415 | 296 |
| 633 | 3300048903 | Ga0496100_0176123 | Ga0496100_0176123_151_1068 | 296 |
| 634 | 3300048905 | Ga0496102_0251867 | Ga0496102_0251867_653_1570 | 296 |
| 635 | 3300048910 | Ga0496107_0081365 | Ga0496107_0081365_1110_2027 | 296 |
| 636 | 3300048918 | Ga0496115_0327671 | Ga0496115_0327671_219_1136 | 296 |
| 637 | 2209111006 | 2214842432 | 2213884776 | 297 |
| 638 | 3300000041 | ARcpr5oldR_c000052 | ARcpr5oldR_00005212 | 297 |
| 639 | 3300000043 | ARcpr5yngRDRAFT_c000046 | ARcpr5yngRDRAFT_0000464 | 297 |
| 640 | 3300005353 | Ga0070669_100059086 | Ga0070669_1000590861 | 297 |
| 641 | 3300005366 | Ga0070659_100082407 | Ga0070659_1000824074 | 297 |
| 642 | 3300005444 | Ga0070694_100062418 | Ga0070694_1000624182 | 297 |
| 643 | 3300005459 | Ga0068867_100083809 | Ga0068867_1000838093 | 297 |
| 644 | 3300005545 | Ga0070695_100004973 | Ga0070695_1000049737 | 297 |
| 645 | 3300005616 | Ga0068852_100278401 | Ga0068852_1002784011 | 297 |
| 646 | 3300005719 | Ga0068861_100129059 | Ga0068861_1001290592 | 297 |
| 647 | 3300005843 | Ga0068860_100334662 | Ga0068860_1003346622 | 297 |
| 648 | 3300005844 | Ga0068862_100047873 | Ga0068862_1000478733 | 297 |
| 649 | 3300005983 | Ga0081540_1000007 | Ga0081540_1000007202 | 297 |
| 650 | 3300006058 | Ga0075432_10011220 | Ga0075432_100112202 | 297 |
| 651 | 3300006163 | Ga0070715_10142118 | Ga0070715_101421182 | 297 |
| 652 | 3300006844 | Ga0075428_100148690 | Ga0075428_1001486903 | 297 |
| 653 | 3300006846 | Ga0075430_100027698 | Ga0075430_1000276984 | 297 |
| 654 | 3300006847 | Ga0075431_100095199 | Ga0075431_1000951994 | 297 |
| 655 | 3300006914 | Ga0075436_100095669 | Ga0075436_1000956693 | 297 |
| 656 | 3300009094 | Ga0111539_10009477 | Ga0111539_100094774 | 297 |
| 657 | 3300009553 | Ga0105249_10138101 | Ga0105249_101381012 | 297 |
| 658 | 3300025923 | Ga0207681_10095323 | Ga0207681_100953233 | 297 |
| 659 | 3300025933 | Ga0207706_10013956 | Ga0207706_100139566 | 297 |
| 660 | 3300025935 | Ga0207709_10152052 | Ga0207709_101520522 | 297 |
| 661 | 3300026041 | Ga0207639_10243645 | Ga0207639_102436451 | 297 |
| 662 | 3300026089 | Ga0207648_10113238 | Ga0207648_101132382 | 297 |
| 663 | 3300026118 | Ga0207675_100034543 | Ga0207675_1000345435 | 297 |
| 664 | 3300026118 | Ga0207675_100486978 | Ga0207675_1004869781 | 297 |
| 665 | 3300027907 | Ga0207428_10002527 | Ga0207428_1000252710 | 297 |
| 666 | 3300028380 | Ga0268265_10046762 | Ga0268265_100467622 | 297 |
| 667 | 3300034817 | Ga0373948_0000977 | Ga0373948_0000977_1684_2577 | 297 |
| 668 | 3300034818 | Ga0373950_0000281 | Ga0373950_0000281_1647_2540 | 297 |
| 669 | 3300035084 | Ga0373928_0002833 | Ga0373928_0002833_22_915 | 297 |
| 670 | 3300035085 | Ga0373929_0001398 | Ga0373929_0001398_2533_3426 | 297 |
| 671 | 3300035088 | Ga0373940_0001217 | Ga0373940_0001217_2414_3316 | 297 |
| 672 | 3300035090 | Ga0373949_0001424 | Ga0373949_0001424_3673_4575 | 297 |
| 673 | 3300035092 | Ga0373952_0000246 | Ga0373952_0000246_4470_5363 | 297 |
| 674 | 3300035112 | Ga0373932_0000229 | Ga0373932_0000229_10262_11164 | 297 |
| 675 | 3300035115 | Ga0373941_0000372 | Ga0373941_0000372_1552_2445 | 297 |
| 676 | 3300035121 | Ga0373960_0002263 | Ga0373960_0002263_1154_2047 | 297 |
| 677 | 3300035207 | Ga0373942_0000944 | Ga0373942_0000944_5296_6189 | 297 |
| 678 | 3300035241 | Ga0373961_0001011 | Ga0373961_0001011_439_1332 | 297 |
| 679 | 3300035242 | Ga0373962_0000208 | Ga0373962_0000208_9705_10598 | 297 |
| 680 | 3300035691 | Ga0373931_0009175 | Ga0373931_0009175_2406_3299 | 297 |
| 681 | 3300044712 | Ga0453684_0316376 | Ga0453684_0316376_591_1484 | 297 |
| 682 | 3300048905 | Ga0496102_0364373 | Ga0496102_0364373_253_1146 | 297 |
| 683 | 3300049571 | Ga0501034_0621695 | Ga0501034_0621695_26_928 | 297 |
| 684 | 3300049583 | Ga0501067_0056607 | Ga0501067_0056607_572_1513 | 297 |
| 685 | 3300049822 | Ga0501035_0303902 | Ga0501035_0303902_369_1271 | 297 |
| 686 | 3300050507 | nmdc:mga05p37_332165_c1 | nmdc:mga05p37_332165_c1_798_1700 | 297 |
| 687 | 3300050509 | nmdc:mga0qj67_10737_c1 | nmdc:mga0qj67_10737_c1_5629_6531 | 297 |
| 688 | 3300053094 | Ga0500566_0008491 | Ga0500566_0008491_4372_5271 | 297 |
| 689 | 3300053148 | Ga0500590_062355 | Ga0500590_062355_252_1151 | 297 |
| 690 | 3300053177 | Ga0500636_0005706 | Ga0500636_0005706_3183_4082 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7at2-assembly2.cif.gz_B | crystal structure of inactive estd11 s144a | 0.9717 | 1 | 292 |
| 7av5-assembly1.cif.gz_AAA | structure of estd11 in complex with fluorescein | 0.9699 | 1 | 292 |
| 7at3-assembly2.cif.gz_B | structure of estd11 in complex with naproxen and methanol | 0.9685 | 1 | 292 |
| 4xvc-assembly3.cif.gz_C | crystal structure of an esterase from the bacterial hormone-sensitive lipase (hsl) family | 0.9662 | 3 | 292 |
| 7at4-assembly1.cif.gz_A | structure of estd11 in complex with naproxen | 0.9626 | 1 | 292 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3g9uA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9529 | 3 | 294 | 3.40.50.1820 |
| 3g9uA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9403 | 3 | 294 | 3.40.50.1820 |
| 3dnmC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9391 | 1 | 291 | 3.40.50.1820 |
| 3dnmC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9267 | 1 | 291 | 3.40.50.1820 |
| 3aikA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9252 | 18 | 295 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A420AVT6-F1-model_v4 | deleted | 0.9879 | 2 | 293 |
|
| AF-X1H4G5-F1-model_v4 | Alpha/beta hydrolase fold-3 domain-containing protein | 0.9855 | 108 | 292 |
GO:0004806
|
| AF-A0A2V6TEZ5-F1-model_v4 | Alpha/beta hydrolase | 0.9845 | 154 | 290 |
GO:0004806
|
| AF-A0A538PVW6-F1-model_v4 | Alpha/beta hydrolase | 0.9809 | 3 | 295 |
GO:0004806
|
| AF-A0A535Y0C5-F1-model_v4 | Alpha/beta hydrolase | 0.9793 | 85 | 294 |
GO:0004806
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar