F475430

General Info

Members Datasets Scaffolds Average Seq Length
690 342 685 297

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10030862|Ga0070681_100308625
Length 328
Sequence MPGRDARTVRPGSKALSDYFTISSIKVCYPDAMSGQEIDAIRALLTSKPRPVSWNERRERIDEIGATWPVAADVRLEEVDVDGVPGEWSIVPGSDAARVLMFFHGGGYCSGSIVSHRRMVTEAGRAARMRTLAVRYRLAPEHPYPAAHEDAMTAWRFLRGQGIAARDIAVGGDSAGGNLTITLINRLRAAGEEQPACAWLASPWTDLTMSGASLETKASVDPLIHKAYLEELADCYAPAPIDRKDPLISPLFADLTGFPPVLIQVGSAETLLDDSVRFARAAGLADVNVTLQVWPHMIHAWPMWNAKLAEGRQALAHAGAFMRQWVRL

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2909042592 Labrys sp. LIt4 Isolate Nodule
3 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
207 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
208 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
209 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
220 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
221 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
239 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
242 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
263 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
268 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
269 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
277 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
286 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
287 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
288 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
335 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
338 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
339 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
340 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
341 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
342 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0.58
Rhizoplane 10.72
Rhizosphere 87.1
Stem 0
Stem Tuber 0
Unclassified 0.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214842432 2209111006 Bacteria 1703
2 ARcpr5oldR_c000052 3300000041 Bacteria 21384
3 ARcpr5yngRDRAFT_c000046 3300000043 Bacteria 19355
4 JGI24746J21847_1000437 3300001977 Bacteria 6225
5 JGI24739J22299_10002728 3300001989 Bacteria 6797
6 JGI24745J21846_1000373 3300002073 Bacteria 3912
7 JGI24748J21848_1000523 3300002074 Bacteria 4195
8 JGI24738J21930_10000045 3300002075 Bacteria 24599
9 JGI24749J21850_1003211 3300002076 Bacteria 2280
10 JGI24033J26618_1001318 3300002155 Bacteria 2449
11 JGI25406J46586_10002241 3300003203 Bacteria 9125
12 JGI25153J46596_10004363 3300003215 Bacteria 7635
13 JGI25404J52841_10003802 3300003659 Bacteria 3015
14 Ga0065712_10026686 3300005290 Bacteria 2172
15 Ga0065712_10087675 3300005290 Bacteria 2562
16 Ga0070676_10000220 3300005328 Bacteria 24496
17 Ga0070676_10098314 3300005328 Bacteria 1804
18 Ga0070683_100000775 3300005329 Bacteria 23502
19 Ga0070690_100009429 3300005330 Bacteria 5654
20 Ga0070670_100005399 3300005331 Bacteria 10787
21 Ga0070677_10000315 3300005333 Bacteria 16873
22 Ga0068869_100000165 3300005334 Bacteria 33038
23 Ga0070680_100020169 3300005336 Bacteria 5289
24 Ga0070682_100000355 3300005337 Bacteria 31144
25 Ga0068868_100112535 3300005338 Bacteria 2213
26 Ga0070660_100001171 3300005339 Bacteria 17747
27 Ga0070660_100045769 3300005339 Bacteria 3351
28 Ga0070689_100000964 3300005340 Bacteria 17950
29 Ga0070689_100198206 3300005340 Bacteria 1638
30 Ga0070691_10000690 3300005341 Bacteria 13173
31 Ga0070687_100000108 3300005343 Bacteria 28016
32 Ga0070661_100001187 3300005344 Bacteria 18373
33 Ga0070661_100028102 3300005344 Bacteria 4055
34 Ga0070661_100184835 3300005344 Bacteria 1587
35 Ga0070661_100205584 3300005344 Bacteria 1506
36 Ga0070692_10013294 3300005345 Bacteria 3833
37 Ga0070668_100001227 3300005347 Bacteria 18235
38 Ga0070668_100012163 3300005347 Bacteria 6408
39 Ga0070668_100019674 3300005347 Bacteria 5083
40 Ga0070668_100085324 3300005347 Bacteria 2481
41 Ga0070669_100000173 3300005353 Bacteria 56673
42 Ga0070669_100059086 3300005353 Bacteria 2815
43 Ga0070675_100008683 3300005354 Bacteria 7891
44 Ga0070675_100009012 3300005354 Bacteria 7750
45 Ga0070675_100187765 3300005354 Bacteria 1790
46 Ga0070671_100001858 3300005355 Bacteria 16112
47 Ga0070671_100059075 3300005355 Bacteria 3191
48 Ga0070674_100000387 3300005356 Bacteria 22089
49 Ga0070674_100006516 3300005356 Bacteria 6818
50 Ga0070673_100003686 3300005364 Bacteria 9598
51 Ga0070688_100000812 3300005365 Bacteria 15421
52 Ga0070688_100126332 3300005365 Bacteria 1719
53 Ga0070659_100001449 3300005366 Bacteria 17099
54 Ga0070659_100008809 3300005366 Bacteria 7390
55 Ga0070659_100082407 3300005366 Bacteria 2570
56 Ga0070659_100264718 3300005366 Bacteria 1427
57 Ga0070667_100002184 3300005367 Bacteria 17225
58 Ga0070703_10005861 3300005406 Bacteria 3441
59 Ga0070714_100034470 3300005435 Bacteria 4239
60 Ga0070713_100001366 3300005436 Bacteria 15607
61 Ga0070713_100003440 3300005436 Bacteria 10447
62 Ga0070713_100128116 3300005436 Bacteria 2235
63 Ga0070713_100385472 3300005436 Bacteria 1306
64 Ga0070710_10004961 3300005437 Bacteria 6296
65 Ga0070701_10000182 3300005438 Bacteria 19472
66 Ga0070711_100003929 3300005439 Bacteria 8736
67 Ga0070711_100087391 3300005439 Bacteria 2238
68 Ga0070711_100104879 3300005439 Bacteria 2063
69 Ga0070711_100129377 3300005439 Bacteria 1878
70 Ga0070705_100001581 3300005440 Bacteria 11931
71 Ga0070700_100000294 3300005441 Bacteria 26210
72 Ga0070700_100015521 3300005441 Bacteria 4321
73 Ga0070700_100103785 3300005441 Bacteria 1878
74 Ga0070694_100017889 3300005444 Bacteria 4486
75 Ga0070694_100025365 3300005444 Bacteria 3835
76 Ga0070694_100062418 3300005444 Bacteria 2546
77 Ga0070708_100063290 3300005445 Bacteria 3311
78 Ga0070663_100000881 3300005455 Bacteria 16323
79 Ga0070663_100054901 3300005455 Bacteria 2849
80 Ga0070678_100000097 3300005456 Bacteria 33580
81 Ga0070678_100064311 3300005456 Bacteria 2718
82 Ga0070678_100073740 3300005456 Bacteria 2562
83 Ga0070678_100187322 3300005456 Bacteria 1699
84 Ga0070662_100018404 3300005457 Bacteria 4725
85 Ga0070662_100149193 3300005457 Bacteria 1818
86 Ga0070681_10000308 3300005458 Bacteria 39593
87 Ga0070681_10030862 3300005458 Bacteria 5379
88 Ga0070681_10574541 3300005458 Bacteria 1041
89 Ga0068867_100001290 3300005459 Bacteria 17283
90 Ga0068867_100083809 3300005459 Bacteria 2407
91 Ga0068867_100089759 3300005459 Bacteria 2331
92 Ga0070685_10003447 3300005466 Bacteria 8043
93 Ga0070698_100085336 3300005471 Bacteria 3145
94 Ga0070698_100363938 3300005471 Bacteria 1378
95 Ga0070679_100001806 3300005530 Bacteria 19298
96 Ga0070679_100142270 3300005530 Bacteria 2377
97 Ga0070679_100147472 3300005530 Bacteria 2330
98 Ga0070679_100443372 3300005530 Bacteria 1243
99 Ga0070684_100000325 3300005535 Bacteria 32964
100 Ga0070684_100106825 3300005535 Bacteria 2507
101 Ga0070684_100388777 3300005535 Bacteria 1285
102 Ga0070697_100123854 3300005536 Bacteria 2164
103 Ga0068853_100009974 3300005539 Bacteria 7670
104 Ga0070672_100034369 3300005543 Bacteria 3847
105 Ga0070686_100001115 3300005544 Bacteria 15442
106 Ga0070686_100246540 3300005544 Bacteria 1303
107 Ga0070695_100001755 3300005545 Bacteria 12193
108 Ga0070695_100004973 3300005545 Bacteria 7836
109 Ga0070696_100000763 3300005546 Bacteria 20623
110 Ga0070693_100000808 3300005547 Bacteria 13860
111 Ga0070693_100041057 3300005547 Bacteria 2601
112 Ga0070665_100188867 3300005548 Bacteria 2061
113 Ga0070665_100207905 3300005548 Bacteria 1958
114 Ga0070665_100406883 3300005548 Bacteria 1369
115 Ga0070704_100000560 3300005549 Bacteria 17882
116 Ga0068855_100035619 3300005563 Bacteria 5928
117 Ga0068855_100273817 3300005563 Bacteria 1876
118 Ga0070664_100000089 3300005564 Bacteria 58202
119 Ga0070664_100142422 3300005564 Bacteria 2112
120 Ga0068857_100000571 3300005577 Bacteria 26945
121 Ga0068857_100451133 3300005577 Bacteria 1202
122 Ga0068854_100001540 3300005578 Bacteria 13990
123 Ga0068856_100001158 3300005614 Bacteria 27731
124 Ga0070702_100000572 3300005615 Bacteria 13439
125 Ga0070702_100254638 3300005615 Bacteria 1192
126 Ga0068852_100001589 3300005616 Bacteria 15453
127 Ga0068852_100058414 3300005616 Bacteria 3341
128 Ga0068852_100278401 3300005616 Bacteria 1612
129 Ga0068852_100473179 3300005616 Bacteria 1244
130 Ga0068859_100071698 3300005617 Bacteria 3500
131 Ga0068859_100100536 3300005617 Bacteria 2947
132 Ga0068864_100006971 3300005618 Bacteria 9268
133 Ga0068864_100221665 3300005618 Bacteria 1745
134 Ga0068864_100373515 3300005618 Bacteria 1350
135 Ga0068866_10001222 3300005718 Bacteria 11158
136 Ga0068861_100001053 3300005719 Bacteria 16973
137 Ga0068861_100010884 3300005719 Bacteria 6320
138 Ga0068861_100050314 3300005719 Bacteria 3159
139 Ga0068861_100129059 3300005719 Bacteria 2050
140 Ga0068870_10000130 3300005840 Bacteria 25869
141 Ga0068863_100008367 3300005841 Bacteria 10102
142 Ga0068863_100011693 3300005841 Bacteria 8488
143 Ga0068863_100328547 3300005841 Bacteria 1486
144 Ga0068858_100009338 3300005842 Bacteria 9365
145 Ga0068858_100112671 3300005842 Bacteria 2541
146 Ga0068858_100162109 3300005842 Bacteria 2105
147 Ga0068860_100005077 3300005843 Bacteria 13388
148 Ga0068860_100013046 3300005843 Bacteria 8156
149 Ga0068860_100090323 3300005843 Bacteria 2917
150 Ga0068860_100334662 3300005843 Bacteria 1487
151 Ga0068862_100005805 3300005844 Bacteria 10291
152 Ga0068862_100047873 3300005844 Bacteria 3649
153 Ga0081455_10000036 3300005937 Bacteria 136303
154 Ga0081455_10007008 3300005937 Bacteria 11977
155 Ga0081455_10011515 3300005937 Bacteria 8882
156 Ga0081455_10021233 3300005937 Bacteria 6095
157 Ga0081455_10027689 3300005937 Bacteria 5190
158 Ga0081540_1000007 3300005983 Bacteria 205328
159 Ga0081540_1003801 3300005983 Bacteria 11817
160 Ga0081540_1004135 3300005983 Bacteria 11193
161 Ga0081540_1005703 3300005983 Bacteria 9239
162 Ga0081540_1020947 3300005983 Bacteria 3913
163 Ga0081540_1023682 3300005983 Bacteria 3584
164 Ga0081539_10000203 3300005985 Bacteria 138096
165 Ga0070717_10000296 3300006028 Bacteria 33438
166 Ga0070717_10004085 3300006028 Bacteria 10526
167 Ga0075432_10011220 3300006058 Bacteria 3046
168 Ga0075432_10026605 3300006058 Bacteria 1988
169 Ga0070715_10142118 3300006163 Bacteria 1167
170 Ga0070716_100005900 3300006173 Bacteria 5959
171 Ga0070716_100005969 3300006173 Bacteria 5928
172 Ga0070716_100029304 3300006173 Bacteria 2974
173 Ga0070716_100140997 3300006173 Bacteria 1537
174 Ga0075427_10001068 3300006194 Bacteria 3434
175 Ga0097621_100000638 3300006237 Bacteria 24786
176 Ga0097621_100261382 3300006237 Bacteria 1519
177 Ga0068871_100006181 3300006358 Bacteria 8441
178 Ga0068871_100186159 3300006358 Bacteria 1787
179 Ga0075428_100021920 3300006844 Bacteria 7074
180 Ga0075428_100148690 3300006844 Bacteria 2545
181 Ga0075430_100001846 3300006846 Bacteria 17326
182 Ga0075430_100018430 3300006846 Bacteria 5939
183 Ga0075430_100027698 3300006846 Bacteria 4813
184 Ga0075430_100027985 3300006846 Bacteria 4788
185 Ga0075431_100020464 3300006847 Bacteria 6760
186 Ga0075431_100033755 3300006847 Bacteria 5273
187 Ga0075431_100036798 3300006847 Bacteria 5042
188 Ga0075431_100039816 3300006847 Bacteria 4842
189 Ga0075431_100095199 3300006847 Bacteria 3074
190 Ga0075433_10001346 3300006852 Bacteria 18007
191 Ga0075433_10038027 3300006852 Bacteria 4154
192 Ga0075433_10094526 3300006852 Bacteria 2646
193 Ga0075434_100000387 3300006871 Bacteria 32179
194 Ga0075434_100009027 3300006871 Bacteria 9288
195 Ga0075434_100032269 3300006871 Bacteria 5164
196 Ga0075434_100045288 3300006871 Bacteria 4365
197 Ga0075434_100077160 3300006871 Bacteria 3327
198 Ga0075434_100295223 3300006871 Bacteria 1640
199 Ga0075429_100009528 3300006880 Bacteria 8425
200 Ga0068865_100003088 3300006881 Bacteria 9962
201 Ga0068865_100158601 3300006881 Bacteria 1724
202 Ga0075436_100095669 3300006914 Bacteria 2066
203 Ga0097620_100071691 3300006931 Bacteria 3500
204 Ga0097620_100100535 3300006931 Bacteria 2947
205 Ga0075435_100006725 3300007076 Bacteria 8156
206 Ga0075435_100017000 3300007076 Bacteria 5494
207 Ga0075435_100032050 3300007076 Bacteria 4148
208 Ga0075435_100318113 3300007076 Bacteria 1332
209 Ga0105240_10098502 3300009093 Bacteria 3560
210 Ga0111539_10000082 3300009094 Bacteria 96811
211 Ga0111539_10005016 3300009094 Bacteria 17214
212 Ga0111539_10009477 3300009094 Bacteria 12287
213 Ga0111539_10568800 3300009094 Bacteria 1320
214 Ga0105245_10006051 3300009098 Bacteria 10634
215 Ga0105245_10084308 3300009098 Bacteria 2911
216 Ga0105245_10239174 3300009098 Bacteria 1759
217 Ga0105245_10609961 3300009098 Bacteria 1119
218 Ga0105247_10055878 3300009101 Bacteria 2437
219 Ga0114129_10007088 3300009147 Bacteria 15950
220 Ga0114129_10027390 3300009147 Bacteria 8068
221 Ga0105243_10001273 3300009148 Bacteria 22624
222 Ga0105243_10121133 3300009148 Bacteria 2206
223 Ga0105241_10000977 3300009174 Bacteria 21655
224 Ga0105241_10043783 3300009174 Bacteria 3391
225 Ga0105242_10000666 3300009176 Bacteria 26877
226 Ga0105242_10038732 3300009176 Bacteria 3835
227 Ga0105242_10063784 3300009176 Bacteria 3035
228 Ga0105242_10119509 3300009176 Bacteria 2259
229 Ga0105248_10083056 3300009177 Bacteria 3604
230 Ga0105248_10230243 3300009177 Bacteria 2086
231 Ga0105237_10073862 3300009545 Bacteria 3402
232 Ga0105237_10095997 3300009545 Bacteria 2955
233 Ga0105237_10167630 3300009545 Bacteria 2196
234 Ga0105249_10138101 3300009553 Bacteria 2335
235 Ga0105249_10152859 3300009553 Bacteria 2223
236 Ga0105249_10303030 3300009553 Bacteria 1603
237 Ga0099796_10017743 3300010159 Bacteria 2125
238 Ga0105239_10006896 3300010375 Bacteria 13103
239 Ga0105246_10075082 3300011119 Bacteria 2392
240 Ga0105246_10261653 3300011119 Bacteria 1379
241 Ga0157373_10026797 3300013100 Bacteria 4160
242 Ga0157370_10025892 3300013104 Bacteria 5800
243 Ga0157370_10271334 3300013104 Bacteria 1567
244 Ga0157369_10433977 3300013105 Bacteria 1361
245 Ga0157374_10001732 3300013296 Bacteria 18295
246 Ga0157378_10007752 3300013297 Bacteria 9369
247 Ga0157378_10114410 3300013297 Bacteria 2478
248 Ga0157378_10260925 3300013297 Bacteria 1662
249 Ga0157378_10411044 3300013297 Bacteria 1335
250 Ga0163162_10001862 3300013306 Bacteria 19850
251 Ga0163162_10019795 3300013306 Bacteria 6608
252 Ga0163162_10220503 3300013306 Bacteria 2026
253 Ga0163162_10558081 3300013306 Bacteria 1273
254 Ga0157372_10088738 3300013307 Bacteria 3511
255 Ga0157372_10703965 3300013307 Bacteria 1175
256 Ga0157375_10000177 3300013308 Bacteria 59436
257 Ga0157375_10055336 3300013308 Bacteria 3912
258 Ga0157375_10080011 3300013308 Bacteria 3305
259 Ga0163163_10068172 3300014325 Bacteria 3539
260 Ga0163163_10443005 3300014325 Bacteria 1359
261 Ga0163163_10699535 3300014325 Bacteria 1077
262 Ga0157380_10000783 3300014326 Bacteria 19941
263 Ga0157380_10011614 3300014326 Bacteria 6365
264 Ga0157380_10231718 3300014326 Bacteria 1659
265 Ga0182008_10094265 3300014497 Bacteria 1477
266 Ga0157377_10009711 3300014745 Bacteria 4734
267 Ga0157377_10017731 3300014745 Bacteria 3688
268 Ga0157379_10017426 3300014968 Bacteria 6325
269 Ga0157379_10017484 3300014968 Bacteria 6313
270 Ga0157379_10039762 3300014968 Bacteria 4196
271 Ga0163161_10002993 3300017792 Bacteria 11947
272 Ga0163161_10113795 3300017792 Bacteria 2026
273 Ga0207666_1000012 3300025271 Bacteria 43336
274 Ga0207673_1000076 3300025290 Bacteria 8624
275 Ga0209758_1000188 3300025297 Bacteria 138749
276 Ga0207697_10000032 3300025315 Bacteria 50984
277 Ga0207682_10002281 3300025893 Bacteria 8649
278 Ga0207642_10000392 3300025899 Bacteria 13105
279 Ga0207642_10065010 3300025899 Bacteria 1712
280 Ga0207642_10189126 3300025899 Bacteria 1128
281 Ga0207710_10043888 3300025900 Bacteria 1990
282 Ga0207688_10002931 3300025901 Bacteria 9277
283 Ga0207647_10005102 3300025904 Bacteria 9674
284 Ga0207647_10014575 3300025904 Bacteria 5417
285 Ga0207699_10031728 3300025906 Bacteria 2969
286 Ga0207699_10152330 3300025906 Bacteria 1531
287 Ga0207645_10000074 3300025907 Bacteria 71544
288 Ga0207643_10006362 3300025908 Bacteria 6325
289 Ga0207654_10002888 3300025911 Bacteria 8717
290 Ga0207707_10001963 3300025912 Bacteria 18692
291 Ga0207707_10209989 3300025912 Bacteria 1696
292 Ga0207695_10320910 3300025913 Bacteria 1438
293 Ga0207695_10349549 3300025913 Bacteria 1366
294 Ga0207671_10236714 3300025914 Bacteria 1433
295 Ga0207671_10472257 3300025914 Bacteria 999
296 Ga0207693_10019018 3300025915 Bacteria 5467
297 Ga0207693_10047508 3300025915 Bacteria 3372
298 Ga0207663_10017896 3300025916 Bacteria 3958
299 Ga0207663_10106671 3300025916 Bacteria 1894
300 Ga0207660_10000243 3300025917 Bacteria 35432
301 Ga0207660_10235785 3300025917 Bacteria 1440
302 Ga0207662_10000753 3300025918 Bacteria 14841
303 Ga0207662_10034315 3300025918 Bacteria 2961
304 Ga0207657_10002717 3300025919 Bacteria 19047
305 Ga0207657_10021647 3300025919 Bacteria 6043
306 Ga0207649_10000201 3300025920 Bacteria 49824
307 Ga0207649_10067758 3300025920 Bacteria 2267
308 Ga0207652_10059276 3300025921 Bacteria 3299
309 Ga0207652_10388815 3300025921 Bacteria 1259
310 Ga0207681_10000375 3300025923 Bacteria 31652
311 Ga0207681_10095323 3300025923 Bacteria 2134
312 Ga0207694_10042227 3300025924 Bacteria 3517
313 Ga0207650_10026632 3300025925 Bacteria 4127
314 Ga0207650_10113387 3300025925 Bacteria 2102
315 Ga0207659_10000039 3300025926 Bacteria 91685
316 Ga0207659_10038137 3300025926 Bacteria 3340
317 Ga0207687_10000347 3300025927 Bacteria 30794
318 Ga0207700_10001101 3300025928 Bacteria 15581
319 Ga0207700_10001324 3300025928 Bacteria 14056
320 Ga0207700_10209165 3300025928 Bacteria 1648
321 Ga0207664_10081969 3300025929 Bacteria 2627
322 Ga0207644_10001356 3300025931 Bacteria 15748
323 Ga0207644_10012872 3300025931 Bacteria 5563
324 Ga0207644_10102751 3300025931 Bacteria 2150
325 Ga0207690_10000271 3300025932 Bacteria 36932
326 Ga0207690_10143017 3300025932 Bacteria 1765
327 Ga0207706_10008840 3300025933 Bacteria 9271
328 Ga0207706_10013956 3300025933 Bacteria 7285
329 Ga0207706_10071135 3300025933 Bacteria 3059
330 Ga0207706_10127011 3300025933 Bacteria 2242
331 Ga0207706_10197750 3300025933 Bacteria 1763
332 Ga0207686_10000698 3300025934 Bacteria 20815
333 Ga0207686_10077443 3300025934 Bacteria 2159
334 Ga0207686_10292788 3300025934 Bacteria 1206
335 Ga0207709_10003374 3300025935 Bacteria 9539
336 Ga0207709_10152052 3300025935 Bacteria 1604
337 Ga0207670_10000432 3300025936 Bacteria 23547
338 Ga0207670_10016639 3300025936 Bacteria 4425
339 Ga0207669_10000043 3300025937 Bacteria 65025
340 Ga0207669_10003759 3300025937 Bacteria 6591
341 Ga0207704_10000285 3300025938 Bacteria 24138
342 Ga0207704_10014215 3300025938 Bacteria 4013
343 Ga0207665_10003696 3300025939 Bacteria 10222
344 Ga0207665_10257569 3300025939 Bacteria 1291
345 Ga0207691_10000169 3300025940 Bacteria 60909
346 Ga0207711_10114424 3300025941 Bacteria 2402
347 Ga0207711_10183741 3300025941 Bacteria 1902
348 Ga0207711_10432970 3300025941 Bacteria 1224
349 Ga0207689_10007874 3300025942 Bacteria 9309
350 Ga0207689_10020170 3300025942 Bacteria 5615
351 Ga0207661_10000764 3300025944 Bacteria 20904
352 Ga0207661_10072062 3300025944 Bacteria 2826
353 Ga0207679_10000030 3300025945 Bacteria 169351
354 Ga0207679_10049665 3300025945 Bacteria 3062
355 Ga0207667_10048477 3300025949 Bacteria 4492
356 Ga0207667_10069014 3300025949 Bacteria 3679
357 Ga0207667_10174904 3300025949 Bacteria 2206
358 Ga0207651_10001313 3300025960 Bacteria 11218
359 Ga0207712_10000396 3300025961 Bacteria 37902
360 Ga0207712_10017027 3300025961 Bacteria 4715
361 Ga0207712_10031769 3300025961 Bacteria 3559
362 Ga0207712_10174217 3300025961 Bacteria 1684
363 Ga0207668_10000312 3300025972 Bacteria 31799
364 Ga0207668_10010748 3300025972 Bacteria 5542
365 Ga0207668_10085572 3300025972 Bacteria 2301
366 Ga0207668_10135942 3300025972 Bacteria 1883
367 Ga0207640_10011962 3300025981 Bacteria 4929
368 Ga0207658_10004659 3300025986 Bacteria 9505
369 Ga0207677_10001531 3300026023 Bacteria 12231
370 Ga0207703_10001648 3300026035 Bacteria 20092
371 Ga0207703_10059578 3300026035 Bacteria 3118
372 Ga0207703_10086555 3300026035 Bacteria 2625
373 Ga0207703_10182261 3300026035 Bacteria 1854
374 Ga0207639_10007077 3300026041 Bacteria 7653
375 Ga0207639_10063579 3300026041 Bacteria 2858
376 Ga0207639_10243645 3300026041 Bacteria 1564
377 Ga0207678_10000266 3300026067 Bacteria 47353
378 Ga0207678_10048367 3300026067 Bacteria 3676
379 Ga0207678_10057003 3300026067 Bacteria 3362
380 Ga0207708_10000383 3300026075 Bacteria 34626
381 Ga0207708_10011040 3300026075 Bacteria 6716
382 Ga0207708_10106365 3300026075 Bacteria 2175
383 Ga0207702_10009618 3300026078 Bacteria 8114
384 Ga0207641_10001892 3300026088 Bacteria 20096
385 Ga0207641_10004239 3300026088 Bacteria 12498
386 Ga0207641_10075261 3300026088 Bacteria 2915
387 Ga0207641_10411654 3300026088 Bacteria 1300
388 Ga0207648_10000272 3300026089 Bacteria 56105
389 Ga0207648_10113238 3300026089 Bacteria 2382
390 Ga0207676_10000074 3300026095 Bacteria 101208
391 Ga0207676_10024313 3300026095 Bacteria 4481
392 Ga0207674_10000135 3300026116 Bacteria 85071
393 Ga0207674_10081560 3300026116 Bacteria 3236
394 Ga0207675_100003473 3300026118 Bacteria 15393
395 Ga0207675_100006357 3300026118 Bacteria 11200
396 Ga0207675_100034543 3300026118 Bacteria 4715
397 Ga0207675_100116316 3300026118 Bacteria 2527
398 Ga0207675_100194154 3300026118 Bacteria 1948
399 Ga0207675_100486978 3300026118 Bacteria 1226
400 Ga0207683_10000136 3300026121 Bacteria 60910
401 Ga0207683_10001596 3300026121 Bacteria 20375
402 Ga0207683_10039380 3300026121 Bacteria 4123
403 Ga0207683_10046302 3300026121 Bacteria 3806
404 Ga0207683_10494004 3300026121 Bacteria 1130
405 Ga0209966_1004920 3300027695 Bacteria 2280
406 Ga0209998_10005189 3300027717 Bacteria 2735
407 Ga0209998_10005230 3300027717 Bacteria 2720
408 Ga0209998_10017982 3300027717 Bacteria 1498
409 Ga0209974_10001126 3300027876 Bacteria 9476
410 Ga0207428_10000702 3300027907 Bacteria 38855
411 Ga0207428_10001429 3300027907 Bacteria 25093
412 Ga0207428_10002527 3300027907 Bacteria 18248
413 Ga0268266_10013326 3300028379 Bacteria 7084
414 Ga0268265_10002284 3300028380 Bacteria 14599
415 Ga0268265_10036443 3300028380 Bacteria 3603
416 Ga0268265_10046762 3300028380 Bacteria 3237
417 Ga0268264_10001372 3300028381 Bacteria 22784
418 Ga0268264_10047489 3300028381 Bacteria 3569
419 Ga0268264_10101539 3300028381 Bacteria 2501
420 Ga0268264_10223266 3300028381 Bacteria 1735
421 Ga0307516_10168450 3300031730 Bacteria 1933
422 Ga0373930_0009964 3300034816 Bacteria 1688
423 Ga0373948_0000977 3300034817 Bacteria 3831
424 Ga0373950_0000281 3300034818 Bacteria 6403
425 Ga0373950_0006978 3300034818 Bacteria 1740
426 Ga0373950_0017175 3300034818 Bacteria 1244
427 Ga0373958_0000312 3300034819 Bacteria 5850
428 Ga0373938_0001612 3300034957 Bacteria 3624
429 Ga0373928_0001756 3300035084 Bacteria 4222
430 Ga0373928_0002833 3300035084 Bacteria 3342
431 Ga0373929_0001398 3300035085 Bacteria 4626
432 Ga0373934_0090531 3300035086 Bacteria 1233
433 Ga0373940_0001217 3300035088 Bacteria 4543
434 Ga0373944_0004186 3300035089 Bacteria 3749
435 Ga0373944_0010557 3300035089 Plasmid 2519
436 Ga0373949_0000926 3300035090 Bacteria 9141
437 Ga0373949_0001424 3300035090 Bacteria 6844
438 Ga0373951_0010729 3300035091 Bacteria 2058
439 Ga0373952_0000246 3300035092 Bacteria 8799
440 Ga0373952_0001063 3300035092 Bacteria 5020
441 Ga0373923_0064231 3300035111 Bacteria 1565
442 Ga0373932_0000229 3300035112 Bacteria 16826
443 Ga0373932_0001553 3300035112 Bacteria 6346
444 Ga0373936_0016212 3300035113 Bacteria 2865
445 Ga0373939_0002684 3300035114 Bacteria 4170
446 Ga0373941_0000372 3300035115 Bacteria 8943
447 Ga0373941_0002874 3300035115 Bacteria 3841
448 Ga0373945_0023132 3300035116 Bacteria 2145
449 Ga0373945_0023332 3300035116 Bacteria 2136
450 Ga0373945_0051728 3300035116 Bacteria 1512
451 Ga0373945_0105131 3300035116 Unclassified 1109
452 Ga0373953_0101809 3300035117 Bacteria 1209
453 Ga0373954_0101194 3300035118 Bacteria 1390
454 Ga0373956_0063353 3300035119 Bacteria 1677
455 Ga0373960_0002263 3300035121 Bacteria 4330
456 Ga0373960_0010800 3300035121 Bacteria 2237
457 Ga0373960_0013322 3300035121 Bacteria 2061
458 Ga0373943_0023255 3300035170 Bacteria 2880
459 Ga0373943_0044158 3300035170 Unclassified 2168
460 Ga0373946_0023079 3300035171 Bacteria 2428
461 Ga0373942_0000944 3300035207 Bacteria 7948
462 Ga0373942_0002333 3300035207 Bacteria 4626
463 Ga0373961_0001011 3300035241 Bacteria 9193
464 Ga0373961_0003246 3300035241 Bacteria 4054
465 Ga0373962_0000208 3300035242 Bacteria 12431
466 Ga0373962_0000514 3300035242 Bacteria 8629
467 Ga0373962_0003428 3300035242 Bacteria 3808
468 Ga0373931_0000249 3300035691 Bacteria 22911
469 Ga0373931_0009175 3300035691 Bacteria 4723
470 Ga0373931_0232637 3300035691 Bacteria 1114
471 Ga0373935_0160429 3300035692 Unclassified 1532
472 Ga0373933_0109440 3300035724 Bacteria 1722
473 Ga0373947_0001407 3300035725 Bacteria 14812
474 Ga0373947_0050559 3300035725 Bacteria 2499
475 Ga0373925_0023819 3300037068 Bacteria 4466
476 Ga0395899_0074613 3300037312 Bacteria 2477
477 Ga0395899_0195447 3300037312 Bacteria 1414
478 Ga0395900_0011525 3300037418 Bacteria 9048
479 Ga0395900_0016463 3300037418 Bacteria 7539
480 Ga0395900_0207412 3300037418 Bacteria 1980
481 Ga0395898_0002494 3300037466 Bacteria 21650
482 Ga0395898_0003815 3300037466 Bacteria 16691
483 Ga0395898_0022725 3300037466 Bacteria 6348
484 Ga0395905_0043920 3300037471 Bacteria 4194
485 Ga0395905_0424060 3300037471 Bacteria 1227
486 Ga0395901_0024020 3300038443 Bacteria 6253
487 Ga0395901_0036020 3300038443 Bacteria 5113
488 Ga0439453_0003702 3300041408 Bacteria 2220
489 Ga0453684_0316376 3300044712 Bacteria 1769
490 Ga0495603_0002528 3300046455 Bacteria 10769
491 Ga0495603_0040714 3300046455 Bacteria 2780
492 Ga0495629_0000473 3300046459 Bacteria 33677
493 Ga0495629_0024003 3300046459 Bacteria 4343
494 Ga0495629_0053264 3300046459 Bacteria 2831
495 Ga0495638_0044451 3300046460 Bacteria 2798
496 Ga0495641_0021264 3300046461 Bacteria 3266
497 Ga0495641_0083376 3300046461 Bacteria 1432
498 Ga0495651_0003643 3300046462 Bacteria 11794
499 Ga0495653_0079832 3300046463 Bacteria 2422
500 Ga0495653_0144751 3300046463 Bacteria 1667
501 Ga0495580_0007386 3300046472 Bacteria 8838
502 Ga0495582_0010936 3300046473 Bacteria 4994
503 Ga0495639_0067122 3300046475 Bacteria 1652
504 Ga0495639_0110988 3300046475 Bacteria 1301
505 Ga0495662_0007357 3300046476 Bacteria 5443
506 Ga0495662_0062011 3300046476 Bacteria 1807
507 Ga0495664_0014986 3300046477 Bacteria 4402
508 Ga0495664_0161455 3300046477 Bacteria 1359
509 Ga0495585_0004147 3300046492 Bacteria 9483
510 Ga0495594_0006922 3300046499 Bacteria 5834
511 Ga0495594_0048372 3300046499 Bacteria 2336
512 Ga0495607_0108473 3300046501 Bacteria 1475
513 Ga0495608_0092920 3300046511 Bacteria 1949
514 Ga0495610_0053036 3300046512 Bacteria 1966
515 Ga0495618_0189049 3300046514 Bacteria 1306
516 Ga0495620_0043818 3300046515 Bacteria 1948
517 Ga0495630_0068633 3300046517 Bacteria 2666
518 Ga0495637_0021172 3300046520 Bacteria 2983
519 Ga0495644_0002015 3300046523 Bacteria 8171
520 Ga0495644_0033032 3300046523 Bacteria 1955
521 Ga0495666_0097570 3300046526 Bacteria 1385
522 Ga0495652_0060197 3300046529 Bacteria 3210
523 Ga0495665_0045563 3300046531 Bacteria 2329
524 Ga0495640_0028912 3300046533 Bacteria 3985
525 Ga0495640_0067441 3300046533 Bacteria 2409
526 Ga0495586_0104711 3300046535 Bacteria 1572
527 Ga0495587_0057431 3300046536 Bacteria 2288
528 Ga0495622_0024704 3300046557 Bacteria 2806
529 Ga0495633_0009234 3300046558 Bacteria 5465
530 Ga0495656_0000562 3300046615 Bacteria 12127
531 Ga0495634_0058118 3300046642 Bacteria 2579
532 Ga0495635_0216215 3300046663 Bacteria 1297
533 Ga0495599_0113535 3300046678 Bacteria 1686
534 Ga0495646_0261458 3300046680 Bacteria 924
535 Ga0495647_0011512 3300046681 Bacteria 3032
536 Ga0495647_0024570 3300046681 Bacteria 2194
537 Ga0495658_0000557 3300046683 Bacteria 20322
538 Ga0495613_0031441 3300046689 Bacteria 3943
539 Ga0495670_0007228 3300046691 Bacteria 5462
540 Ga0495670_0070725 3300046691 Bacteria 1766
541 Ga0495671_0084933 3300046692 Bacteria 1551
542 Ga0495600_0026167 3300046809 Bacteria 3763
543 Ga0495581_0023207 3300047315 Bacteria 3595
544 Ga0495604_0041603 3300047317 Bacteria 3604
545 Ga0495674_0055413 3300047319 Bacteria 3477
546 Ga0495676_0063324 3300047321 Bacteria 2883
547 Ga0495680_0008202 3300047322 Bacteria 9521
548 Ga0495680_0059042 3300047322 Bacteria 2962
549 Ga0495680_0094045 3300047322 Bacteria 2243
550 Ga0495679_022908 3300047446 Bacteria 2129
551 Ga0495684_0021314 3300047471 Bacteria 4990
552 Ga0495684_0155879 3300047471 Bacteria 1706
553 Ga0495684_0183102 3300047471 Unclassified 1552
554 Ga0495593_0024102 3300047673 Bacteria 3376
555 Ga0495593_0033599 3300047673 Bacteria 2793
556 Ga0495602_0055382 3300048088 Bacteria 3493
557 Ga0495614_0082010 3300048089 Unclassified 1398
558 Ga0496100_0000363 3300048903 Bacteria 22088
559 Ga0496100_0176123 3300048903 Bacteria 1544
560 Ga0496100_0237753 3300048903 Bacteria 1343
561 Ga0496101_0000136 3300048904 Bacteria 65392
562 Ga0496101_0022404 3300048904 Bacteria 4348
563 Ga0496101_0058283 3300048904 Bacteria 2796
564 Ga0496101_0065648 3300048904 Bacteria 2646
565 Ga0496101_0097743 3300048904 Bacteria 2193
566 Ga0496101_0099112 3300048904 Bacteria 2178
567 Ga0496101_0137944 3300048904 Bacteria 1857
568 Ga0496102_0017179 3300048905 Bacteria 6335
569 Ga0496102_0076950 3300048905 Bacteria 3070
570 Ga0496102_0091063 3300048905 Bacteria 2822
571 Ga0496102_0098641 3300048905 Bacteria 2711
572 Ga0496102_0110321 3300048905 Bacteria 2564
573 Ga0496102_0205591 3300048905 Bacteria 1856
574 Ga0496102_0251867 3300048905 Bacteria 1665
575 Ga0496102_0364373 3300048905 Bacteria 1361
576 Ga0496103_0001236 3300048906 Bacteria 17450
577 Ga0496103_0093342 3300048906 Unclassified 1900
578 Ga0496104_0024694 3300048907 Bacteria 5532
579 Ga0496104_0025731 3300048907 Bacteria 5426
580 Ga0496104_0080152 3300048907 Bacteria 3112
581 Ga0496104_0180269 3300048907 Bacteria 2023
582 Ga0496104_0231882 3300048907 Bacteria 1758
583 Ga0496105_0012384 3300048908 Bacteria 6752
584 Ga0496105_0018275 3300048908 Bacteria 5630
585 Ga0496105_0029885 3300048908 Bacteria 4461
586 Ga0496105_0165831 3300048908 Unclassified 1812
587 Ga0496105_0303807 3300048908 Bacteria 1282
588 Ga0496106_0010263 3300048909 Bacteria 6925
589 Ga0496106_0051771 3300048909 Bacteria 3096
590 Ga0496106_0093956 3300048909 Bacteria 2318
591 Ga0496106_0095734 3300048909 Bacteria 2297
592 Ga0496106_0119247 3300048909 Bacteria 2061
593 Ga0496106_0260047 3300048909 Bacteria 1389
594 Ga0496106_0260587 3300048909 Bacteria 1387
595 Ga0496107_0029806 3300048910 Bacteria 3885
596 Ga0496107_0042674 3300048910 Bacteria 3258
597 Ga0496107_0042757 3300048910 Bacteria 3254
598 Ga0496107_0044636 3300048910 Bacteria 3186
599 Ga0496107_0081365 3300048910 Bacteria 2362
600 Ga0496108_0018445 3300048911 Bacteria 5712
601 Ga0496108_0024030 3300048911 Bacteria 5017
602 Ga0496108_0032576 3300048911 Bacteria 4329
603 Ga0496108_0118472 3300048911 Bacteria 2269
604 Ga0496108_0169844 3300048911 Bacteria 1887
605 Ga0496109_0000771 3300048912 Bacteria 26630
606 Ga0496109_0025662 3300048912 Bacteria 5252
607 Ga0496109_0047955 3300048912 Bacteria 3885
608 Ga0496109_0105391 3300048912 Bacteria 2618
609 Ga0496109_0211151 3300048912 Bacteria 1825
610 Ga0496110_0013968 3300048913 Bacteria 6653
611 Ga0496110_0076727 3300048913 Bacteria 2971
612 Ga0496110_0175257 3300048913 Bacteria 1946
613 Ga0496111_0013864 3300048914 Bacteria 5497
614 Ga0496111_0037705 3300048914 Bacteria 3460
615 Ga0496111_0068548 3300048914 Bacteria 2578
616 Ga0496112_0008432 3300048915 Bacteria 9230
617 Ga0496112_0019971 3300048915 Bacteria 6340
618 Ga0496112_0028147 3300048915 Bacteria 5422
619 Ga0496112_0106001 3300048915 Bacteria 2780
620 Ga0496112_0154826 3300048915 Bacteria 2259
621 Ga0496113_0002900 3300048916 Bacteria 10103
622 Ga0496113_0010822 3300048916 Bacteria 6052
623 Ga0496113_0026128 3300048916 Bacteria 4171
624 Ga0496113_0092102 3300048916 Bacteria 2337
625 Ga0496113_0132826 3300048916 Bacteria 1954
626 Ga0496114_0063152 3300048917 Bacteria 3100
627 Ga0496115_0001192 3300048918 Bacteria 18634
628 Ga0496115_0031621 3300048918 Bacteria 4170
629 Ga0496115_0063850 3300048918 Bacteria 2971
630 Ga0496115_0124321 3300048918 Bacteria 2124
631 Ga0496115_0327671 3300048918 Bacteria 1252
632 Ga0496121_0079685 3300048924 Bacteria 2599
633 Ga0496126_0082048 3300048929 Bacteria 2850
634 Ga0501034_0621695 3300049571 Bacteria 984
635 Ga0501036_0234145 3300049572 Bacteria 1541
636 Ga0501037_0228930 3300049573 Bacteria 1305
637 Ga0501047_0106974 3300049581 Bacteria 2678
638 Ga0501067_0056607 3300049583 Bacteria 2172
639 Ga0501069_0188958 3300049585 Bacteria 1192
640 Ga0501079_0361855 3300049741 Bacteria 1137
641 Ga0501080_0426369 3300049742 Bacteria 1191
642 Ga0501083_0069615 3300049744 Bacteria 2341
643 Ga0501035_0303902 3300049822 Bacteria 1344
644 Ga0501035_0449839 3300049822 Bacteria 1066
645 nmdc:mga05p37_11799_c1 3300050507 Bacteria 10415
646 nmdc:mga05p37_332165_c1 3300050507 Bacteria 1795
647 nmdc:mga05p37_3938_c1 3300050507 Bacteria 14912
648 nmdc:mga09592_3119_c1 3300050508 Bacteria 13453
649 nmdc:mga0qj67_10737_c1 3300050509 Bacteria 6847
650 nmdc:mga0qj67_17100_c1 3300050509 Bacteria 5512
651 nmdc:mga0qj67_409837_c1 3300050509 Bacteria 1093
652 nmdc:mga0qj67_5979_c1 3300050509 Bacteria 8917
653 nmdc:mga06r32_18804_c1 3300050510 Bacteria 6331
654 nmdc:mga06r32_3736_c1 3300050510 Bacteria 13616
655 nmdc:mga06r32_4793_c1 3300050510 Bacteria 12169
656 nmdc:mga06r32_630_c1 3300050510 Bacteria 30687
657 nmdc:mga08y16_3226_c2 3300050511 Bacteria 14776
658 nmdc:mga08y16_4462_c1 3300050511 Bacteria 14634
659 nmdc:mga0n895_1795_c1 3300050512 Bacteria 16306
660 nmdc:mga0n895_1804_c1 3300050512 Bacteria 16279
661 nmdc:mga0n895_253865_c1 3300050512 Bacteria 1784
662 nmdc:mga0n895_42739_c1 3300050512 Bacteria 4411
663 nmdc:mga0n895_44001_c1 3300050512 Bacteria 4354
664 nmdc:mga0n895_76827_c1 3300050512 Bacteria 3321
665 nmdc:mga0rr50_1015_c1 3300050513 Bacteria 15232
666 nmdc:mga0rr50_294391_c1 3300050513 Bacteria 1357
667 nmdc:mga08x19_212839_c1 3300050514 Bacteria 1327
668 nmdc:mga0a205_1082_c1 3300050515 Bacteria 22615
669 nmdc:mga0a205_17882_c1 3300050515 Bacteria 6653
670 nmdc:mga0a205_301084_c1 3300050515 Bacteria 1476
671 nmdc:mga0a205_4499_c1 3300050515 Bacteria 12507
672 Ga0495601_0000963 3300053077 Bacteria 15732
673 Ga0495612_0002575 3300053078 Bacteria 7481
674 Ga0495612_0008798 3300053078 Bacteria 4093
675 Ga0495595_0010716 3300053084 Bacteria 3818
676 Ga0495619_0001993 3300053085 Bacteria 13592
677 Ga0495619_0009900 3300053085 Bacteria 6007
678 Ga0495619_0018762 3300053085 Bacteria 4391
679 Ga0500566_0008491 3300053094 Bacteria 6073
680 Ga0500595_047456 3300053119 Bacteria 1346
681 Ga0500559_0005828 3300053136 Bacteria 5621
682 Ga0500590_062355 3300053148 Bacteria 1871
683 Ga0500636_0005706 3300053177 Bacteria 7117
684 Ga0501082_0231590 3300060353 Bacteria 1608
685 Ga0530510_0108897 3300061734 Bacteria 2028

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025899 Ga0207642_10189126 Ga0207642_101891262 255
2 3300034819 Ga0373958_0000312 Ga0373958_0000312_4896_5693 255
3 3300006846 Ga0075430_100027985 Ga0075430_1000279853 269
4 3300006847 Ga0075431_100033755 Ga0075431_1000337553 269
5 3300050510 nmdc:mga06r32_4793_c1 nmdc:mga06r32_4793_c1_1012_1827 269
6 3300048918 Ga0496115_0124321 Ga0496115_0124321_1280_2113 277
7 3300005983 Ga0081540_1003801 Ga0081540_10038012 278
8 3300046520 Ga0495637_0021172 Ga0495637_0021172_19_855 278
9 3300046680 Ga0495646_0261458 Ga0495646_0261458_52_888 278
10 3300037471 Ga0395905_0424060 Ga0395905_0424060_354_1208 284
11 3300006846 Ga0075430_100018430 Ga0075430_1000184304 290
12 3300006847 Ga0075431_100036798 Ga0075431_1000367987 290
13 3300009147 Ga0114129_10007088 Ga0114129_100070885 290
14 3300050507 nmdc:mga05p37_11799_c1 nmdc:mga05p37_11799_c1_4523_5401 290
15 3300050509 nmdc:mga0qj67_17100_c1 nmdc:mga0qj67_17100_c1_731_1609 290
16 3300050510 nmdc:mga06r32_630_c1 nmdc:mga06r32_630_c1_19949_20827 290
17 3300048909 Ga0496106_0260587 Ga0496106_0260587_128_1102 291
18 iso_pu_bacteria 2791355199 2793082717 291
19 iso_pu_bacteria 2909042592 2909045636 291
20 iso_pu_bacteria 2922386360 2922388139 291
21 iso_pu_bacteria 8006964411 8006964675 291
22 iso_pu_bacteria 8056673599 8056680321 291
23 3300003215 JGI25153J46596_10004363 JGI25153J46596_100043639 292
24 3300005290 Ga0065712_10026686 Ga0065712_100266861 292
25 3300005328 Ga0070676_10098314 Ga0070676_100983141 292
26 3300005347 Ga0070668_100085324 Ga0070668_1000853243 292
27 3300005436 Ga0070713_100001366 Ga0070713_1000013666 292
28 3300005436 Ga0070713_100128116 Ga0070713_1001281163 292
29 3300005436 Ga0070713_100385472 Ga0070713_1003854722 292
30 3300005439 Ga0070711_100129377 Ga0070711_1001293772 292
31 3300005471 Ga0070698_100363938 Ga0070698_1003639381 292
32 3300005937 Ga0081455_10007008 Ga0081455_1000700810 292
33 3300005937 Ga0081455_10021233 Ga0081455_100212336 292
34 3300006028 Ga0070717_10000296 Ga0070717_1000029637 292
35 3300006173 Ga0070716_100029304 Ga0070716_1000293042 292
36 3300009176 Ga0105242_10119509 Ga0105242_101195092 292
37 3300009545 Ga0105237_10167630 Ga0105237_101676302 292
38 3300010159 Ga0099796_10017743 Ga0099796_100177432 292
39 3300013297 Ga0157378_10260925 Ga0157378_102609251 292
40 3300014325 Ga0163163_10443005 Ga0163163_104430052 292
41 3300025297 Ga0209758_1000188 Ga0209758_1000188122 292
42 3300025906 Ga0207699_10152330 Ga0207699_101523302 292
43 3300025914 Ga0207671_10236714 Ga0207671_102367142 292
44 3300025915 Ga0207693_10047508 Ga0207693_100475083 292
45 3300025928 Ga0207700_10001101 Ga0207700_1000110115 292
46 3300025928 Ga0207700_10209165 Ga0207700_102091652 292
47 3300025939 Ga0207665_10257569 Ga0207665_102575692 292
48 3300025972 Ga0207668_10085572 Ga0207668_100855723 292
49 3300037312 Ga0395899_0074613 Ga0395899_0074613_249_1133 292
50 3300037418 Ga0395900_0011525 Ga0395900_0011525_6901_7785 292
51 3300037466 Ga0395898_0002494 Ga0395898_0002494_3601_4485 292
52 3300038443 Ga0395901_0036020 Ga0395901_0036020_1115_1999 292
53 3300048929 Ga0496126_0082048 Ga0496126_0082048_930_1823 292
54 3300049573 Ga0501037_0228930 Ga0501037_0228930_16_900 292
55 3300049581 Ga0501047_0106974 Ga0501047_0106974_991_1875 292
56 3300049744 Ga0501083_0069615 Ga0501083_0069615_1173_2057 292
57 3300053119 Ga0500595_047456 Ga0500595_047456_436_1320 292
58 3300003203 JGI25406J46586_10002241 JGI25406J46586_100022417 293
59 3300003659 JGI25404J52841_10003802 JGI25404J52841_100038022 293
60 3300005339 Ga0070660_100045769 Ga0070660_1000457694 293
61 3300005347 Ga0070668_100012163 Ga0070668_10001216311 293
62 3300005347 Ga0070668_100019674 Ga0070668_1000196741 293
63 3300005354 Ga0070675_100009012 Ga0070675_1000090129 293
64 3300005356 Ga0070674_100006516 Ga0070674_1000065161 293
65 3300005365 Ga0070688_100126332 Ga0070688_1001263322 293
66 3300005366 Ga0070659_100008809 Ga0070659_1000088095 293
67 3300005441 Ga0070700_100015521 Ga0070700_1000155212 293
68 3300005441 Ga0070700_100103785 Ga0070700_1001037852 293
69 3300005444 Ga0070694_100025365 Ga0070694_1000253652 293
70 3300005455 Ga0070663_100054901 Ga0070663_1000549012 293
71 3300005456 Ga0070678_100073740 Ga0070678_1000737402 293
72 3300005456 Ga0070678_100187322 Ga0070678_1001873222 293
73 3300005457 Ga0070662_100149193 Ga0070662_1001491932 293
74 3300005458 Ga0070681_10574541 Ga0070681_105745411 293
75 3300005459 Ga0068867_100089759 Ga0068867_1000897592 293
76 3300005530 Ga0070679_100147472 Ga0070679_1001474723 293
77 3300005530 Ga0070679_100443372 Ga0070679_1004433722 293
78 3300005547 Ga0070693_100041057 Ga0070693_1000410573 293
79 3300005548 Ga0070665_100188867 Ga0070665_1001888672 293
80 3300005548 Ga0070665_100406883 Ga0070665_1004068832 293
81 3300005563 Ga0068855_100035619 Ga0068855_1000356195 293
82 3300005563 Ga0068855_100273817 Ga0068855_1002738171 293
83 3300005564 Ga0070664_100142422 Ga0070664_1001424222 293
84 3300005577 Ga0068857_100451133 Ga0068857_1004511331 293
85 3300005615 Ga0070702_100254638 Ga0070702_1002546381 293
86 3300005616 Ga0068852_100058414 Ga0068852_1000584143 293
87 3300005617 Ga0068859_100071698 Ga0068859_1000716982 293
88 3300005617 Ga0068859_100100536 Ga0068859_1001005362 293
89 3300005618 Ga0068864_100221665 Ga0068864_1002216653 293
90 3300005618 Ga0068864_100373515 Ga0068864_1003735152 293
91 3300005719 Ga0068861_100010884 Ga0068861_1000108843 293
92 3300005719 Ga0068861_100050314 Ga0068861_1000503143 293
93 3300005841 Ga0068863_100011693 Ga0068863_1000116935 293
94 3300005842 Ga0068858_100162109 Ga0068858_1001621092 293
95 3300005843 Ga0068860_100013046 Ga0068860_1000130466 293
96 3300005937 Ga0081455_10027689 Ga0081455_100276892 293
97 3300005983 Ga0081540_1004135 Ga0081540_10041352 293
98 3300005983 Ga0081540_1005703 Ga0081540_10057032 293
99 3300005983 Ga0081540_1020947 Ga0081540_10209474 293
100 3300005983 Ga0081540_1023682 Ga0081540_10236823 293
101 3300005985 Ga0081539_10000203 Ga0081539_10000203147 293
102 3300006881 Ga0068865_100158601 Ga0068865_1001586012 293
103 3300006931 Ga0097620_100071691 Ga0097620_1000716912 293
104 3300006931 Ga0097620_100100535 Ga0097620_1001005352 293
105 3300009093 Ga0105240_10098502 Ga0105240_100985024 293
106 3300009098 Ga0105245_10084308 Ga0105245_100843082 293
107 3300009098 Ga0105245_10609961 Ga0105245_106099611 293
108 3300009101 Ga0105247_10055878 Ga0105247_100558782 293
109 3300009174 Ga0105241_10043783 Ga0105241_100437832 293
110 3300009176 Ga0105242_10038732 Ga0105242_100387322 293
111 3300009177 Ga0105248_10083056 Ga0105248_100830564 293
112 3300009545 Ga0105237_10073862 Ga0105237_100738622 293
113 3300009553 Ga0105249_10152859 Ga0105249_101528591 293
114 3300009553 Ga0105249_10303030 Ga0105249_103030302 293
115 3300013104 Ga0157370_10271334 Ga0157370_102713342 293
116 3300013306 Ga0163162_10019795 Ga0163162_100197954 293
117 3300013306 Ga0163162_10220503 Ga0163162_102205032 293
118 3300013308 Ga0157375_10055336 Ga0157375_100553362 293
119 3300013308 Ga0157375_10080011 Ga0157375_100800112 293
120 3300014326 Ga0157380_10011614 Ga0157380_100116142 293
121 3300014326 Ga0157380_10231718 Ga0157380_102317182 293
122 3300014745 Ga0157377_10009711 Ga0157377_100097113 293
123 3300014968 Ga0157379_10017426 Ga0157379_100174262 293
124 3300017792 Ga0163161_10113795 Ga0163161_101137952 293
125 3300025900 Ga0207710_10043888 Ga0207710_100438882 293
126 3300025904 Ga0207647_10014575 Ga0207647_100145753 293
127 3300025913 Ga0207695_10349549 Ga0207695_103495491 293
128 3300025917 Ga0207660_10235785 Ga0207660_102357852 293
129 3300025919 Ga0207657_10021647 Ga0207657_100216472 293
130 3300025921 Ga0207652_10059276 Ga0207652_100592763 293
131 3300025921 Ga0207652_10388815 Ga0207652_103888152 293
132 3300025924 Ga0207694_10042227 Ga0207694_100422273 293
133 3300025926 Ga0207659_10038137 Ga0207659_100381372 293
134 3300025931 Ga0207644_10102751 Ga0207644_101027512 293
135 3300025933 Ga0207706_10071135 Ga0207706_100711352 293
136 3300025933 Ga0207706_10127011 Ga0207706_101270112 293
137 3300025933 Ga0207706_10197750 Ga0207706_101977502 293
138 3300025936 Ga0207670_10016639 Ga0207670_100166394 293
139 3300025937 Ga0207669_10003759 Ga0207669_100037593 293
140 3300025938 Ga0207704_10014215 Ga0207704_100142152 293
141 3300025941 Ga0207711_10114424 Ga0207711_101144243 293
142 3300025941 Ga0207711_10432970 Ga0207711_104329702 293
143 3300025942 Ga0207689_10020170 Ga0207689_100201704 293
144 3300025949 Ga0207667_10048477 Ga0207667_100484773 293
145 3300025961 Ga0207712_10017027 Ga0207712_100170274 293
146 3300025961 Ga0207712_10031769 Ga0207712_100317694 293
147 3300025961 Ga0207712_10174217 Ga0207712_101742172 293
148 3300025972 Ga0207668_10010748 Ga0207668_100107484 293
149 3300025972 Ga0207668_10135942 Ga0207668_101359422 293
150 3300026035 Ga0207703_10059578 Ga0207703_100595782 293
151 3300026041 Ga0207639_10063579 Ga0207639_100635791 293
152 3300026067 Ga0207678_10048367 Ga0207678_100483673 293
153 3300026075 Ga0207708_10011040 Ga0207708_100110402 293
154 3300026075 Ga0207708_10106365 Ga0207708_101063652 293
155 3300026088 Ga0207641_10004239 Ga0207641_1000423911 293
156 3300026088 Ga0207641_10411654 Ga0207641_104116542 293
157 3300026095 Ga0207676_10024313 Ga0207676_100243135 293
158 3300026116 Ga0207674_10081560 Ga0207674_100815604 293
159 3300026118 Ga0207675_100006357 Ga0207675_1000063578 293
160 3300026118 Ga0207675_100116316 Ga0207675_1001163162 293
161 3300026118 Ga0207675_100194154 Ga0207675_1001941542 293
162 3300026121 Ga0207683_10039380 Ga0207683_100393805 293
163 3300026121 Ga0207683_10046302 Ga0207683_100463022 293
164 3300028380 Ga0268265_10036443 Ga0268265_100364432 293
165 3300028381 Ga0268264_10047489 Ga0268264_100474892 293
166 3300028381 Ga0268264_10101539 Ga0268264_101015392 293
167 3300028381 Ga0268264_10223266 Ga0268264_102232661 293
168 3300031730 Ga0307516_10168450 Ga0307516_101684502 293
169 3300037471 Ga0395905_0043920 Ga0395905_0043920_1560_2447 293
170 3300046512 Ga0495610_0053036 Ga0495610_0053036_52_939 293
171 3300046515 Ga0495620_0043818 Ga0495620_0043818_27_914 293
172 3300046523 Ga0495644_0033032 Ga0495644_0033032_206_1093 293
173 3300046691 Ga0495670_0070725 Ga0495670_0070725_623_1510 293
174 3300048904 Ga0496101_0065648 Ga0496101_0065648_854_1741 293
175 3300048904 Ga0496101_0137944 Ga0496101_0137944_793_1680 293
176 3300048905 Ga0496102_0205591 Ga0496102_0205591_328_1215 293
177 3300048909 Ga0496106_0093956 Ga0496106_0093956_165_1052 293
178 3300048909 Ga0496106_0095734 Ga0496106_0095734_422_1309 293
179 3300048909 Ga0496106_0119247 Ga0496106_0119247_748_1635 293
180 3300048911 Ga0496108_0169844 Ga0496108_0169844_901_1800 293
181 3300048915 Ga0496112_0008432 Ga0496112_0008432_6261_7148 293
182 3300048924 Ga0496121_0079685 Ga0496121_0079685_609_1496 293
183 3300049572 Ga0501036_0234145 Ga0501036_0234145_116_1018 293
184 3300049585 Ga0501069_0188958 Ga0501069_0188958_32_919 293
185 3300049741 Ga0501079_0361855 Ga0501079_0361855_132_1019 293
186 3300049742 Ga0501080_0426369 Ga0501080_0426369_95_982 293
187 3300049822 Ga0501035_0449839 Ga0501035_0449839_109_996 293
188 3300050512 nmdc:mga0n895_253865_c1 nmdc:mga0n895_253865_c1_205_1125 293
189 3300053136 Ga0500559_0005828 Ga0500559_0005828_3749_4636 293
190 3300060353 Ga0501082_0231590 Ga0501082_0231590_409_1296 293
191 3300061734 Ga0530510_0108897 Ga0530510_0108897_242_1129 293
192 3300001977 JGI24746J21847_1000437 JGI24746J21847_10004376 294
193 3300001989 JGI24739J22299_10002728 JGI24739J22299_100027284 294
194 3300002073 JGI24745J21846_1000373 JGI24745J21846_10003733 294
195 3300002074 JGI24748J21848_1000523 JGI24748J21848_10005234 294
196 3300002075 JGI24738J21930_10000045 JGI24738J21930_1000004513 294
197 3300002076 JGI24749J21850_1003211 JGI24749J21850_10032112 294
198 3300002155 JGI24033J26618_1001318 JGI24033J26618_10013182 294
199 3300005290 Ga0065712_10087675 Ga0065712_100876753 294
200 3300005328 Ga0070676_10000220 Ga0070676_1000022026 294
201 3300005329 Ga0070683_100000775 Ga0070683_1000007755 294
202 3300005330 Ga0070690_100009429 Ga0070690_1000094295 294
203 3300005331 Ga0070670_100005399 Ga0070670_1000053999 294
204 3300005333 Ga0070677_10000315 Ga0070677_1000031514 294
205 3300005334 Ga0068869_100000165 Ga0068869_10000016530 294
206 3300005336 Ga0070680_100020169 Ga0070680_1000201693 294
207 3300005337 Ga0070682_100000355 Ga0070682_1000003557 294
208 3300005338 Ga0068868_100112535 Ga0068868_1001125353 294
209 3300005339 Ga0070660_100001171 Ga0070660_1000011719 294
210 3300005340 Ga0070689_100000964 Ga0070689_1000009647 294
211 3300005340 Ga0070689_100198206 Ga0070689_1001982062 294
212 3300005341 Ga0070691_10000690 Ga0070691_100006904 294
213 3300005343 Ga0070687_100000108 Ga0070687_10000010815 294
214 3300005344 Ga0070661_100001187 Ga0070661_1000011876 294
215 3300005344 Ga0070661_100028102 Ga0070661_1000281026 294
216 3300005345 Ga0070692_10013294 Ga0070692_100132943 294
217 3300005347 Ga0070668_100001227 Ga0070668_1000012275 294
218 3300005353 Ga0070669_100000173 Ga0070669_10000017327 294
219 3300005354 Ga0070675_100008683 Ga0070675_1000086832 294
220 3300005354 Ga0070675_100187765 Ga0070675_1001877651 294
221 3300005355 Ga0070671_100001858 Ga0070671_1000018587 294
222 3300005355 Ga0070671_100059075 Ga0070671_1000590754 294
223 3300005356 Ga0070674_100000387 Ga0070674_10000038721 294
224 3300005364 Ga0070673_100003686 Ga0070673_1000036864 294
225 3300005365 Ga0070688_100000812 Ga0070688_1000008127 294
226 3300005366 Ga0070659_100001449 Ga0070659_1000014497 294
227 3300005367 Ga0070667_100002184 Ga0070667_10000218415 294
228 3300005406 Ga0070703_10005861 Ga0070703_100058614 294
229 3300005435 Ga0070714_100034470 Ga0070714_1000344706 294
230 3300005436 Ga0070713_100003440 Ga0070713_1000034404 294
231 3300005437 Ga0070710_10004961 Ga0070710_100049614 294
232 3300005438 Ga0070701_10000182 Ga0070701_1000018214 294
233 3300005439 Ga0070711_100087391 Ga0070711_1000873911 294
234 3300005439 Ga0070711_100104879 Ga0070711_1001048794 294
235 3300005440 Ga0070705_100001581 Ga0070705_10000158110 294
236 3300005441 Ga0070700_100000294 Ga0070700_10000029415 294
237 3300005444 Ga0070694_100017889 Ga0070694_1000178892 294
238 3300005445 Ga0070708_100063290 Ga0070708_1000632904 294
239 3300005455 Ga0070663_100000881 Ga0070663_10000088113 294
240 3300005456 Ga0070678_100000097 Ga0070678_10000009716 294
241 3300005456 Ga0070678_100064311 Ga0070678_1000643112 294
242 3300005457 Ga0070662_100018404 Ga0070662_1000184044 294
243 3300005458 Ga0070681_10000308 Ga0070681_1000030822 294
244 3300005458 Ga0070681_10030862 Ga0070681_100308625 294
245 3300005459 Ga0068867_100001290 Ga0068867_1000012907 294
246 3300005466 Ga0070685_10003447 Ga0070685_100034474 294
247 3300005530 Ga0070679_100001806 Ga0070679_1000018064 294
248 3300005530 Ga0070679_100142270 Ga0070679_1001422702 294
249 3300005535 Ga0070684_100000325 Ga0070684_1000003257 294
250 3300005535 Ga0070684_100106825 Ga0070684_1001068252 294
251 3300005535 Ga0070684_100388777 Ga0070684_1003887771 294
252 3300005536 Ga0070697_100123854 Ga0070697_1001238542 294
253 3300005539 Ga0068853_100009974 Ga0068853_1000099747 294
254 3300005543 Ga0070672_100034369 Ga0070672_1000343692 294
255 3300005544 Ga0070686_100001115 Ga0070686_1000011157 294
256 3300005544 Ga0070686_100246540 Ga0070686_1002465402 294
257 3300005545 Ga0070695_100001755 Ga0070695_1000017555 294
258 3300005546 Ga0070696_100000763 Ga0070696_10000076320 294
259 3300005547 Ga0070693_100000808 Ga0070693_1000008087 294
260 3300005548 Ga0070665_100207905 Ga0070665_1002079052 294
261 3300005549 Ga0070704_100000560 Ga0070704_1000005605 294
262 3300005564 Ga0070664_100000089 Ga0070664_10000008945 294
263 3300005577 Ga0068857_100000571 Ga0068857_10000057121 294
264 3300005578 Ga0068854_100001540 Ga0068854_10000154013 294
265 3300005614 Ga0068856_100001158 Ga0068856_1000011587 294
266 3300005615 Ga0070702_100000572 Ga0070702_1000005728 294
267 3300005616 Ga0068852_100001589 Ga0068852_1000015891 294
268 3300005618 Ga0068864_100006971 Ga0068864_1000069714 294
269 3300005718 Ga0068866_10001222 Ga0068866_100012226 294
270 3300005719 Ga0068861_100001053 Ga0068861_10000105317 294
271 3300005840 Ga0068870_10000130 Ga0068870_100001304 294
272 3300005841 Ga0068863_100008367 Ga0068863_1000083678 294
273 3300005841 Ga0068863_100328547 Ga0068863_1003285472 294
274 3300005842 Ga0068858_100009338 Ga0068858_1000093384 294
275 3300005842 Ga0068858_100112671 Ga0068858_1001126713 294
276 3300005843 Ga0068860_100005077 Ga0068860_1000050777 294
277 3300005843 Ga0068860_100090323 Ga0068860_1000903232 294
278 3300005844 Ga0068862_100005805 Ga0068862_1000058058 294
279 3300005937 Ga0081455_10000036 Ga0081455_1000003665 294
280 3300005937 Ga0081455_10011515 Ga0081455_100115153 294
281 3300006028 Ga0070717_10004085 Ga0070717_1000408511 294
282 3300006058 Ga0075432_10026605 Ga0075432_100266053 294
283 3300006173 Ga0070716_100005969 Ga0070716_1000059699 294
284 3300006194 Ga0075427_10001068 Ga0075427_100010683 294
285 3300006237 Ga0097621_100000638 Ga0097621_10000063827 294
286 3300006237 Ga0097621_100261382 Ga0097621_1002613822 294
287 3300006358 Ga0068871_100006181 Ga0068871_1000061814 294
288 3300006358 Ga0068871_100186159 Ga0068871_1001861593 294
289 3300006844 Ga0075428_100021920 Ga0075428_1000219202 294
290 3300006846 Ga0075430_100001846 Ga0075430_10000184611 294
291 3300006847 Ga0075431_100020464 Ga0075431_1000204645 294
292 3300006847 Ga0075431_100039816 Ga0075431_1000398166 294
293 3300006852 Ga0075433_10001346 Ga0075433_1000134615 294
294 3300006852 Ga0075433_10038027 Ga0075433_100380274 294
295 3300006852 Ga0075433_10094526 Ga0075433_100945262 294
296 3300006871 Ga0075434_100000387 Ga0075434_10000038723 294
297 3300006871 Ga0075434_100009027 Ga0075434_1000090272 294
298 3300006871 Ga0075434_100032269 Ga0075434_1000322693 294
299 3300006871 Ga0075434_100045288 Ga0075434_1000452881 294
300 3300006871 Ga0075434_100077160 Ga0075434_1000771602 294
301 3300006871 Ga0075434_100295223 Ga0075434_1002952232 294
302 3300006880 Ga0075429_100009528 Ga0075429_1000095282 294
303 3300006881 Ga0068865_100003088 Ga0068865_1000030888 294
304 3300007076 Ga0075435_100006725 Ga0075435_1000067254 294
305 3300007076 Ga0075435_100017000 Ga0075435_1000170003 294
306 3300007076 Ga0075435_100032050 Ga0075435_1000320504 294
307 3300007076 Ga0075435_100318113 Ga0075435_1003181132 294
308 3300009094 Ga0111539_10000082 Ga0111539_1000008272 294
309 3300009094 Ga0111539_10005016 Ga0111539_1000501611 294
310 3300009098 Ga0105245_10006051 Ga0105245_100060519 294
311 3300009098 Ga0105245_10239174 Ga0105245_102391741 294
312 3300009147 Ga0114129_10027390 Ga0114129_100273905 294
313 3300009148 Ga0105243_10001273 Ga0105243_1000127310 294
314 3300009148 Ga0105243_10121133 Ga0105243_101211333 294
315 3300009174 Ga0105241_10000977 Ga0105241_100009774 294
316 3300009176 Ga0105242_10000666 Ga0105242_100006664 294
317 3300009176 Ga0105242_10063784 Ga0105242_100637844 294
318 3300009177 Ga0105248_10230243 Ga0105248_102302433 294
319 3300009545 Ga0105237_10095997 Ga0105237_100959974 294
320 3300010375 Ga0105239_10006896 Ga0105239_100068968 294
321 3300011119 Ga0105246_10075082 Ga0105246_100750823 294
322 3300011119 Ga0105246_10261653 Ga0105246_102616532 294
323 3300013100 Ga0157373_10026797 Ga0157373_100267972 294
324 3300013296 Ga0157374_10001732 Ga0157374_100017324 294
325 3300013297 Ga0157378_10007752 Ga0157378_100077528 294
326 3300013297 Ga0157378_10114410 Ga0157378_101144102 294
327 3300013297 Ga0157378_10411044 Ga0157378_104110441 294
328 3300013306 Ga0163162_10001862 Ga0163162_1000186215 294
329 3300013307 Ga0157372_10088738 Ga0157372_100887383 294
330 3300013308 Ga0157375_10000177 Ga0157375_100001777 294
331 3300014325 Ga0163163_10068172 Ga0163163_100681723 294
332 3300014325 Ga0163163_10699535 Ga0163163_106995351 294
333 3300014326 Ga0157380_10000783 Ga0157380_1000078321 294
334 3300014745 Ga0157377_10017731 Ga0157377_100177312 294
335 3300014968 Ga0157379_10017484 Ga0157379_100174844 294
336 3300014968 Ga0157379_10039762 Ga0157379_100397623 294
337 3300017792 Ga0163161_10002993 Ga0163161_100029934 294
338 3300025271 Ga0207666_1000012 Ga0207666_10000127 294
339 3300025290 Ga0207673_1000076 Ga0207673_10000764 294
340 3300025315 Ga0207697_10000032 Ga0207697_100000327 294
341 3300025893 Ga0207682_10002281 Ga0207682_100022816 294
342 3300025899 Ga0207642_10000392 Ga0207642_1000039211 294
343 3300025899 Ga0207642_10065010 Ga0207642_100650101 294
344 3300025901 Ga0207688_10002931 Ga0207688_100029317 294
345 3300025904 Ga0207647_10005102 Ga0207647_100051025 294
346 3300025906 Ga0207699_10031728 Ga0207699_100317282 294
347 3300025907 Ga0207645_10000074 Ga0207645_1000007471 294
348 3300025908 Ga0207643_10006362 Ga0207643_100063624 294
349 3300025911 Ga0207654_10002888 Ga0207654_100028884 294
350 3300025912 Ga0207707_10001963 Ga0207707_1000196313 294
351 3300025912 Ga0207707_10209989 Ga0207707_102099892 294
352 3300025913 Ga0207695_10320910 Ga0207695_103209101 294
353 3300025914 Ga0207671_10472257 Ga0207671_104722571 294
354 3300025915 Ga0207693_10019018 Ga0207693_100190183 294
355 3300025916 Ga0207663_10106671 Ga0207663_101066713 294
356 3300025917 Ga0207660_10000243 Ga0207660_1000024310 294
357 3300025918 Ga0207662_10000753 Ga0207662_100007534 294
358 3300025918 Ga0207662_10034315 Ga0207662_100343153 294
359 3300025919 Ga0207657_10002717 Ga0207657_100027177 294
360 3300025920 Ga0207649_10000201 Ga0207649_1000020122 294
361 3300025923 Ga0207681_10000375 Ga0207681_1000037520 294
362 3300025925 Ga0207650_10026632 Ga0207650_100266322 294
363 3300025925 Ga0207650_10113387 Ga0207650_101133873 294
364 3300025926 Ga0207659_10000039 Ga0207659_1000003914 294
365 3300025927 Ga0207687_10000347 Ga0207687_100003476 294
366 3300025928 Ga0207700_10001324 Ga0207700_1000132412 294
367 3300025929 Ga0207664_10081969 Ga0207664_100819692 294
368 3300025931 Ga0207644_10001356 Ga0207644_100013567 294
369 3300025931 Ga0207644_10012872 Ga0207644_100128724 294
370 3300025932 Ga0207690_10000271 Ga0207690_1000027127 294
371 3300025933 Ga0207706_10008840 Ga0207706_100088404 294
372 3300025934 Ga0207686_10000698 Ga0207686_100006987 294
373 3300025934 Ga0207686_10077443 Ga0207686_100774432 294
374 3300025934 Ga0207686_10292788 Ga0207686_102927881 294
375 3300025935 Ga0207709_10003374 Ga0207709_100033741 294
376 3300025936 Ga0207670_10000432 Ga0207670_100004329 294
377 3300025937 Ga0207669_10000043 Ga0207669_1000004349 294
378 3300025938 Ga0207704_10000285 Ga0207704_1000028521 294
379 3300025939 Ga0207665_10003696 Ga0207665_1000369610 294
380 3300025940 Ga0207691_10000169 Ga0207691_1000016965 294
381 3300025941 Ga0207711_10183741 Ga0207711_101837413 294
382 3300025942 Ga0207689_10007874 Ga0207689_100078747 294
383 3300025944 Ga0207661_10000764 Ga0207661_1000076415 294
384 3300025944 Ga0207661_10072062 Ga0207661_100720623 294
385 3300025945 Ga0207679_10000030 Ga0207679_1000003095 294
386 3300025945 Ga0207679_10049665 Ga0207679_100496652 294
387 3300025949 Ga0207667_10069014 Ga0207667_100690144 294
388 3300025960 Ga0207651_10001313 Ga0207651_100013134 294
389 3300025961 Ga0207712_10000396 Ga0207712_1000039628 294
390 3300025972 Ga0207668_10000312 Ga0207668_1000031214 294
391 3300025981 Ga0207640_10011962 Ga0207640_100119623 294
392 3300025986 Ga0207658_10004659 Ga0207658_100046594 294
393 3300026023 Ga0207677_10001531 Ga0207677_1000153110 294
394 3300026035 Ga0207703_10001648 Ga0207703_1000164821 294
395 3300026035 Ga0207703_10086555 Ga0207703_100865552 294
396 3300026035 Ga0207703_10182261 Ga0207703_101822611 294
397 3300026041 Ga0207639_10007077 Ga0207639_100070772 294
398 3300026067 Ga0207678_10000266 Ga0207678_1000026649 294
399 3300026067 Ga0207678_10057003 Ga0207678_100570032 294
400 3300026075 Ga0207708_10000383 Ga0207708_100003837 294
401 3300026078 Ga0207702_10009618 Ga0207702_100096184 294
402 3300026088 Ga0207641_10001892 Ga0207641_100018928 294
403 3300026088 Ga0207641_10075261 Ga0207641_100752615 294
404 3300026089 Ga0207648_10000272 Ga0207648_1000027259 294
405 3300026095 Ga0207676_10000074 Ga0207676_1000007471 294
406 3300026116 Ga0207674_10000135 Ga0207674_100001357 294
407 3300026118 Ga0207675_100003473 Ga0207675_1000034737 294
408 3300026121 Ga0207683_10000136 Ga0207683_100001364 294
409 3300026121 Ga0207683_10001596 Ga0207683_1000159611 294
410 3300027695 Ga0209966_1004920 Ga0209966_10049203 294
411 3300027717 Ga0209998_10005189 Ga0209998_100051893 294
412 3300027717 Ga0209998_10005230 Ga0209998_100052302 294
413 3300027717 Ga0209998_10017982 Ga0209998_100179822 294
414 3300027876 Ga0209974_10001126 Ga0209974_100011267 294
415 3300027907 Ga0207428_10000702 Ga0207428_1000070213 294
416 3300027907 Ga0207428_10001429 Ga0207428_1000142911 294
417 3300028379 Ga0268266_10013326 Ga0268266_100133264 294
418 3300028380 Ga0268265_10002284 Ga0268265_100022847 294
419 3300028381 Ga0268264_10001372 Ga0268264_1000137211 294
420 3300034816 Ga0373930_0009964 Ga0373930_0009964_419_1303 294
421 3300034818 Ga0373950_0006978 Ga0373950_0006978_573_1499 294
422 3300034818 Ga0373950_0017175 Ga0373950_0017175_281_1165 294
423 3300034957 Ga0373938_0001612 Ga0373938_0001612_1360_2244 294
424 3300035084 Ga0373928_0001756 Ga0373928_0001756_1507_2391 294
425 3300035089 Ga0373944_0010557 Ga0373944_0010557_1472_2398 294
426 3300035090 Ga0373949_0000926 Ga0373949_0000926_506_1390 294
427 3300035091 Ga0373951_0010729 Ga0373951_0010729_538_1464 294
428 3300035092 Ga0373952_0001063 Ga0373952_0001063_641_1525 294
429 3300035111 Ga0373923_0064231 Ga0373923_0064231_467_1357 294
430 3300035112 Ga0373932_0001553 Ga0373932_0001553_3162_4046 294
431 3300035114 Ga0373939_0002684 Ga0373939_0002684_1600_2484 294
432 3300035115 Ga0373941_0002874 Ga0373941_0002874_1689_2573 294
433 3300035116 Ga0373945_0023132 Ga0373945_0023132_763_1653 294
434 3300035116 Ga0373945_0105131 Ga0373945_0105131_72_998 294
435 3300035121 Ga0373960_0010800 Ga0373960_0010800_584_1510 294
436 3300035121 Ga0373960_0013322 Ga0373960_0013322_373_1257 294
437 3300035170 Ga0373943_0044158 Ga0373943_0044158_179_1069 294
438 3300035207 Ga0373942_0002333 Ga0373942_0002333_1438_2322 294
439 3300035241 Ga0373961_0003246 Ga0373961_0003246_485_1369 294
440 3300035242 Ga0373962_0000514 Ga0373962_0000514_1048_1932 294
441 3300035242 Ga0373962_0003428 Ga0373962_0003428_2307_3233 294
442 3300035691 Ga0373931_0000249 Ga0373931_0000249_14427_15311 294
443 3300035691 Ga0373931_0232637 Ga0373931_0232637_63_989 294
444 3300035692 Ga0373935_0160429 Ga0373935_0160429_528_1454 294
445 3300035725 Ga0373947_0001407 Ga0373947_0001407_4113_5039 294
446 3300037068 Ga0373925_0023819 Ga0373925_0023819_1885_2811 294
447 3300037312 Ga0395899_0195447 Ga0395899_0195447_79_969 294
448 3300037418 Ga0395900_0207412 Ga0395900_0207412_493_1383 294
449 3300037466 Ga0395898_0003815 Ga0395898_0003815_108_998 294
450 3300046455 Ga0495603_0002528 Ga0495603_0002528_9777_10703 294
451 3300046459 Ga0495629_0000473 Ga0495629_0000473_32550_33476 294
452 3300046459 Ga0495629_0053264 Ga0495629_0053264_241_1131 294
453 3300046461 Ga0495641_0083376 Ga0495641_0083376_193_1083 294
454 3300046463 Ga0495653_0144751 Ga0495653_0144751_495_1385 294
455 3300046473 Ga0495582_0010936 Ga0495582_0010936_1608_2534 294
456 3300046475 Ga0495639_0067122 Ga0495639_0067122_306_1196 294
457 3300046476 Ga0495662_0062011 Ga0495662_0062011_499_1389 294
458 3300046477 Ga0495664_0014986 Ga0495664_0014986_1862_2752 294
459 3300046499 Ga0495594_0006922 Ga0495594_0006922_1088_2014 294
460 3300046514 Ga0495618_0189049 Ga0495618_0189049_226_1116 294
461 3300046529 Ga0495652_0060197 Ga0495652_0060197_410_1300 294
462 3300046533 Ga0495640_0028912 Ga0495640_0028912_847_1737 294
463 3300046642 Ga0495634_0058118 Ga0495634_0058118_390_1280 294
464 3300046663 Ga0495635_0216215 Ga0495635_0216215_314_1240 294
465 3300046681 Ga0495647_0024570 Ga0495647_0024570_293_1219 294
466 3300046683 Ga0495658_0000557 Ga0495658_0000557_12084_13010 294
467 3300046689 Ga0495613_0031441 Ga0495613_0031441_573_1499 294
468 3300047315 Ga0495581_0023207 Ga0495581_0023207_2282_3208 294
469 3300047321 Ga0495676_0063324 Ga0495676_0063324_1686_2612 294
470 3300047322 Ga0495680_0008202 Ga0495680_0008202_4768_5694 294
471 3300047322 Ga0495680_0094045 Ga0495680_0094045_1309_2199 294
472 3300047471 Ga0495684_0155879 Ga0495684_0155879_804_1694 294
473 3300047471 Ga0495684_0183102 Ga0495684_0183102_42_968 294
474 3300047673 Ga0495593_0024102 Ga0495593_0024102_1719_2609 294
475 3300047673 Ga0495593_0033599 Ga0495593_0033599_384_1310 294
476 3300048089 Ga0495614_0082010 Ga0495614_0082010_60_986 294
477 3300048903 Ga0496100_0000363 Ga0496100_0000363_17360_18244 294
478 3300048903 Ga0496100_0237753 Ga0496100_0237753_212_1102 294
479 3300048904 Ga0496101_0000136 Ga0496101_0000136_11435_12319 294
480 3300048904 Ga0496101_0022404 Ga0496101_0022404_2173_3096 294
481 3300048904 Ga0496101_0058283 Ga0496101_0058283_935_1825 294
482 3300048904 Ga0496101_0097743 Ga0496101_0097743_1014_1904 294
483 3300048904 Ga0496101_0099112 Ga0496101_0099112_425_1309 294
484 3300048905 Ga0496102_0017179 Ga0496102_0017179_4198_5082 294
485 3300048905 Ga0496102_0076950 Ga0496102_0076950_1011_1937 294
486 3300048905 Ga0496102_0091063 Ga0496102_0091063_1038_1961 294
487 3300048905 Ga0496102_0098641 Ga0496102_0098641_1005_1928 294
488 3300048905 Ga0496102_0110321 Ga0496102_0110321_1371_2261 294
489 3300048906 Ga0496103_0001236 Ga0496103_0001236_15185_16069 294
490 3300048906 Ga0496103_0093342 Ga0496103_0093342_567_1493 294
491 3300048907 Ga0496104_0024694 Ga0496104_0024694_2890_3813 294
492 3300048907 Ga0496104_0025731 Ga0496104_0025731_3516_4439 294
493 3300048907 Ga0496104_0080152 Ga0496104_0080152_1149_2075 294
494 3300048907 Ga0496104_0180269 Ga0496104_0180269_105_989 294
495 3300048907 Ga0496104_0231882 Ga0496104_0231882_20_904 294
496 3300048908 Ga0496105_0012384 Ga0496105_0012384_1032_1955 294
497 3300048908 Ga0496105_0018275 Ga0496105_0018275_918_1841 294
498 3300048908 Ga0496105_0029885 Ga0496105_0029885_2597_3520 294
499 3300048908 Ga0496105_0165831 Ga0496105_0165831_737_1627 294
500 3300048908 Ga0496105_0303807 Ga0496105_0303807_76_960 294
501 3300048909 Ga0496106_0010263 Ga0496106_0010263_926_1849 294
502 3300048909 Ga0496106_0051771 Ga0496106_0051771_41_925 294
503 3300048909 Ga0496106_0260047 Ga0496106_0260047_363_1247 294
504 3300048910 Ga0496107_0029806 Ga0496107_0029806_1166_2089 294
505 3300048910 Ga0496107_0042674 Ga0496107_0042674_814_1698 294
506 3300048910 Ga0496107_0042757 Ga0496107_0042757_1899_2825 294
507 3300048910 Ga0496107_0044636 Ga0496107_0044636_1382_2266 294
508 3300048911 Ga0496108_0018445 Ga0496108_0018445_2842_3726 294
509 3300048911 Ga0496108_0024030 Ga0496108_0024030_2628_3551 294
510 3300048911 Ga0496108_0032576 Ga0496108_0032576_779_1702 294
511 3300048911 Ga0496108_0118472 Ga0496108_0118472_726_1610 294
512 3300048912 Ga0496109_0000771 Ga0496109_0000771_8121_9005 294
513 3300048912 Ga0496109_0025662 Ga0496109_0025662_1863_2786 294
514 3300048912 Ga0496109_0047955 Ga0496109_0047955_1797_2720 294
515 3300048912 Ga0496109_0105391 Ga0496109_0105391_978_1904 294
516 3300048912 Ga0496109_0211151 Ga0496109_0211151_889_1773 294
517 3300048913 Ga0496110_0013968 Ga0496110_0013968_1916_2839 294
518 3300048913 Ga0496110_0076727 Ga0496110_0076727_1053_1976 294
519 3300048913 Ga0496110_0175257 Ga0496110_0175257_802_1686 294
520 3300048914 Ga0496111_0013864 Ga0496111_0013864_3359_4282 294
521 3300048914 Ga0496111_0037705 Ga0496111_0037705_1562_2485 294
522 3300048914 Ga0496111_0068548 Ga0496111_0068548_1037_1921 294
523 3300048915 Ga0496112_0019971 Ga0496112_0019971_1603_2526 294
524 3300048915 Ga0496112_0028147 Ga0496112_0028147_1872_2795 294
525 3300048915 Ga0496112_0106001 Ga0496112_0106001_1051_1974 294
526 3300048915 Ga0496112_0154826 Ga0496112_0154826_966_1856 294
527 3300048916 Ga0496113_0002900 Ga0496113_0002900_4588_5511 294
528 3300048916 Ga0496113_0010822 Ga0496113_0010822_1133_2056 294
529 3300048916 Ga0496113_0026128 Ga0496113_0026128_709_1593 294
530 3300048916 Ga0496113_0092102 Ga0496113_0092102_527_1411 294
531 3300048916 Ga0496113_0132826 Ga0496113_0132826_931_1821 294
532 3300048917 Ga0496114_0063152 Ga0496114_0063152_933_1817 294
533 3300048918 Ga0496115_0001192 Ga0496115_0001192_6317_7201 294
534 3300048918 Ga0496115_0031621 Ga0496115_0031621_620_1543 294
535 3300048918 Ga0496115_0063850 Ga0496115_0063850_926_1849 294
536 3300050507 nmdc:mga05p37_3938_c1 nmdc:mga05p37_3938_c1_9460_10350 294
537 3300050508 nmdc:mga09592_3119_c1 nmdc:mga09592_3119_c1_6762_7652 294
538 3300050509 nmdc:mga0qj67_409837_c1 nmdc:mga0qj67_409837_c1_170_1054 294
539 3300050509 nmdc:mga0qj67_5979_c1 nmdc:mga0qj67_5979_c1_4730_5620 294
540 3300050510 nmdc:mga06r32_18804_c1 nmdc:mga06r32_18804_c1_2602_3486 294
541 3300050510 nmdc:mga06r32_3736_c1 nmdc:mga06r32_3736_c1_9324_10214 294
542 3300050511 nmdc:mga08y16_3226_c2 nmdc:mga08y16_3226_c2_4563_5453 294
543 3300050511 nmdc:mga08y16_4462_c1 nmdc:mga08y16_4462_c1_2737_3621 294
544 3300050512 nmdc:mga0n895_1795_c1 nmdc:mga0n895_1795_c1_10285_11175 294
545 3300050512 nmdc:mga0n895_1804_c1 nmdc:mga0n895_1804_c1_4378_5262 294
546 3300050512 nmdc:mga0n895_42739_c1 nmdc:mga0n895_42739_c1_694_1620 294
547 3300050512 nmdc:mga0n895_44001_c1 nmdc:mga0n895_44001_c1_3094_4020 294
548 3300050512 nmdc:mga0n895_76827_c1 nmdc:mga0n895_76827_c1_407_1300 294
549 3300050513 nmdc:mga0rr50_1015_c1 nmdc:mga0rr50_1015_c1_10809_11699 294
550 3300050513 nmdc:mga0rr50_294391_c1 nmdc:mga0rr50_294391_c1_95_1021 294
551 3300050514 nmdc:mga08x19_212839_c1 nmdc:mga08x19_212839_c1_197_1123 294
552 3300050515 nmdc:mga0a205_1082_c1 nmdc:mga0a205_1082_c1_9347_10237 294
553 3300050515 nmdc:mga0a205_17882_c1 nmdc:mga0a205_17882_c1_1384_2277 294
554 3300050515 nmdc:mga0a205_301084_c1 nmdc:mga0a205_301084_c1_94_1020 294
555 3300050515 nmdc:mga0a205_4499_c1 nmdc:mga0a205_4499_c1_8946_9830 294
556 3300053077 Ga0495601_0000963 Ga0495601_0000963_7949_8839 294
557 3300053078 Ga0495612_0008798 Ga0495612_0008798_2354_3244 294
558 3300053085 Ga0495619_0001993 Ga0495619_0001993_5937_6863 294
559 3300053085 Ga0495619_0018762 Ga0495619_0018762_3331_4221 294
560 3300005344 Ga0070661_100184835 Ga0070661_1001848351 295
561 3300005344 Ga0070661_100205584 Ga0070661_1002055842 295
562 3300005366 Ga0070659_100264718 Ga0070659_1002647181 295
563 3300005471 Ga0070698_100085336 Ga0070698_1000853362 295
564 3300005616 Ga0068852_100473179 Ga0068852_1004731792 295
565 3300006173 Ga0070716_100005900 Ga0070716_1000059005 295
566 3300009094 Ga0111539_10568800 Ga0111539_105688001 295
567 3300013104 Ga0157370_10025892 Ga0157370_100258922 295
568 3300013105 Ga0157369_10433977 Ga0157369_104339772 295
569 3300013307 Ga0157372_10703965 Ga0157372_107039651 295
570 3300014497 Ga0182008_10094265 Ga0182008_100942653 295
571 3300025920 Ga0207649_10067758 Ga0207649_100677583 295
572 3300025932 Ga0207690_10143017 Ga0207690_101430171 295
573 3300025949 Ga0207667_10174904 Ga0207667_101749044 295
574 3300035086 Ga0373934_0090531 Ga0373934_0090531_42_935 295
575 3300035089 Ga0373944_0004186 Ga0373944_0004186_1034_1927 295
576 3300035113 Ga0373936_0016212 Ga0373936_0016212_1686_2624 295
577 3300035116 Ga0373945_0023332 Ga0373945_0023332_431_1324 295
578 3300035116 Ga0373945_0051728 Ga0373945_0051728_227_1126 295
579 3300035117 Ga0373953_0101809 Ga0373953_0101809_40_933 295
580 3300035118 Ga0373954_0101194 Ga0373954_0101194_433_1326 295
581 3300035119 Ga0373956_0063353 Ga0373956_0063353_66_959 295
582 3300035170 Ga0373943_0023255 Ga0373943_0023255_1328_2266 295
583 3300035171 Ga0373946_0023079 Ga0373946_0023079_540_1433 295
584 3300035724 Ga0373933_0109440 Ga0373933_0109440_555_1448 295
585 3300035725 Ga0373947_0050559 Ga0373947_0050559_80_973 295
586 3300041408 Ga0439453_0003702 Ga0439453_0003702_846_1742 295
587 3300046455 Ga0495603_0040714 Ga0495603_0040714_899_1792 295
588 3300046459 Ga0495629_0024003 Ga0495629_0024003_643_1536 295
589 3300046460 Ga0495638_0044451 Ga0495638_0044451_238_1131 295
590 3300046461 Ga0495641_0021264 Ga0495641_0021264_2287_3225 295
591 3300046462 Ga0495651_0003643 Ga0495651_0003643_1668_2606 295
592 3300046463 Ga0495653_0079832 Ga0495653_0079832_882_1775 295
593 3300046472 Ga0495580_0007386 Ga0495580_0007386_7060_7953 295
594 3300046475 Ga0495639_0110988 Ga0495639_0110988_80_973 295
595 3300046476 Ga0495662_0007357 Ga0495662_0007357_2882_3775 295
596 3300046477 Ga0495664_0161455 Ga0495664_0161455_450_1343 295
597 3300046492 Ga0495585_0004147 Ga0495585_0004147_5858_6751 295
598 3300046499 Ga0495594_0048372 Ga0495594_0048372_79_972 295
599 3300046501 Ga0495607_0108473 Ga0495607_0108473_572_1465 295
600 3300046511 Ga0495608_0092920 Ga0495608_0092920_1045_1938 295
601 3300046517 Ga0495630_0068633 Ga0495630_0068633_1131_2024 295
602 3300046523 Ga0495644_0002015 Ga0495644_0002015_829_1722 295
603 3300046526 Ga0495666_0097570 Ga0495666_0097570_440_1333 295
604 3300046531 Ga0495665_0045563 Ga0495665_0045563_643_1536 295
605 3300046533 Ga0495640_0067441 Ga0495640_0067441_361_1254 295
606 3300046535 Ga0495586_0104711 Ga0495586_0104711_298_1191 295
607 3300046536 Ga0495587_0057431 Ga0495587_0057431_794_1687 295
608 3300046557 Ga0495622_0024704 Ga0495622_0024704_1420_2313 295
609 3300046558 Ga0495633_0009234 Ga0495633_0009234_228_1121 295
610 3300046615 Ga0495656_0000562 Ga0495656_0000562_630_1523 295
611 3300046678 Ga0495599_0113535 Ga0495599_0113535_111_1004 295
612 3300046681 Ga0495647_0011512 Ga0495647_0011512_1650_2588 295
613 3300046691 Ga0495670_0007228 Ga0495670_0007228_1369_2262 295
614 3300046692 Ga0495671_0084933 Ga0495671_0084933_425_1318 295
615 3300046809 Ga0495600_0026167 Ga0495600_0026167_1950_2888 295
616 3300047317 Ga0495604_0041603 Ga0495604_0041603_2258_3151 295
617 3300047319 Ga0495674_0055413 Ga0495674_0055413_761_1654 295
618 3300047322 Ga0495680_0059042 Ga0495680_0059042_1823_2716 295
619 3300047446 Ga0495679_022908 Ga0495679_022908_268_1161 295
620 3300047471 Ga0495684_0021314 Ga0495684_0021314_1669_2562 295
621 3300048088 Ga0495602_0055382 Ga0495602_0055382_1043_1936 295
622 3300053078 Ga0495612_0002575 Ga0495612_0002575_2980_3873 295
623 3300053084 Ga0495595_0010716 Ga0495595_0010716_2477_3370 295
624 3300053085 Ga0495619_0009900 Ga0495619_0009900_3598_4491 295
625 3300005439 Ga0070711_100003929 Ga0070711_1000039295 296
626 3300006173 Ga0070716_100140997 Ga0070716_1001409973 296
627 3300013306 Ga0163162_10558081 Ga0163162_105580812 296
628 3300025916 Ga0207663_10017896 Ga0207663_100178962 296
629 3300026121 Ga0207683_10494004 Ga0207683_104940041 296
630 3300037418 Ga0395900_0016463 Ga0395900_0016463_1395_2306 296
631 3300037466 Ga0395898_0022725 Ga0395898_0022725_1370_2281 296
632 3300038443 Ga0395901_0024020 Ga0395901_0024020_2504_3415 296
633 3300048903 Ga0496100_0176123 Ga0496100_0176123_151_1068 296
634 3300048905 Ga0496102_0251867 Ga0496102_0251867_653_1570 296
635 3300048910 Ga0496107_0081365 Ga0496107_0081365_1110_2027 296
636 3300048918 Ga0496115_0327671 Ga0496115_0327671_219_1136 296
637 2209111006 2214842432 2213884776 297
638 3300000041 ARcpr5oldR_c000052 ARcpr5oldR_00005212 297
639 3300000043 ARcpr5yngRDRAFT_c000046 ARcpr5yngRDRAFT_0000464 297
640 3300005353 Ga0070669_100059086 Ga0070669_1000590861 297
641 3300005366 Ga0070659_100082407 Ga0070659_1000824074 297
642 3300005444 Ga0070694_100062418 Ga0070694_1000624182 297
643 3300005459 Ga0068867_100083809 Ga0068867_1000838093 297
644 3300005545 Ga0070695_100004973 Ga0070695_1000049737 297
645 3300005616 Ga0068852_100278401 Ga0068852_1002784011 297
646 3300005719 Ga0068861_100129059 Ga0068861_1001290592 297
647 3300005843 Ga0068860_100334662 Ga0068860_1003346622 297
648 3300005844 Ga0068862_100047873 Ga0068862_1000478733 297
649 3300005983 Ga0081540_1000007 Ga0081540_1000007202 297
650 3300006058 Ga0075432_10011220 Ga0075432_100112202 297
651 3300006163 Ga0070715_10142118 Ga0070715_101421182 297
652 3300006844 Ga0075428_100148690 Ga0075428_1001486903 297
653 3300006846 Ga0075430_100027698 Ga0075430_1000276984 297
654 3300006847 Ga0075431_100095199 Ga0075431_1000951994 297
655 3300006914 Ga0075436_100095669 Ga0075436_1000956693 297
656 3300009094 Ga0111539_10009477 Ga0111539_100094774 297
657 3300009553 Ga0105249_10138101 Ga0105249_101381012 297
658 3300025923 Ga0207681_10095323 Ga0207681_100953233 297
659 3300025933 Ga0207706_10013956 Ga0207706_100139566 297
660 3300025935 Ga0207709_10152052 Ga0207709_101520522 297
661 3300026041 Ga0207639_10243645 Ga0207639_102436451 297
662 3300026089 Ga0207648_10113238 Ga0207648_101132382 297
663 3300026118 Ga0207675_100034543 Ga0207675_1000345435 297
664 3300026118 Ga0207675_100486978 Ga0207675_1004869781 297
665 3300027907 Ga0207428_10002527 Ga0207428_1000252710 297
666 3300028380 Ga0268265_10046762 Ga0268265_100467622 297
667 3300034817 Ga0373948_0000977 Ga0373948_0000977_1684_2577 297
668 3300034818 Ga0373950_0000281 Ga0373950_0000281_1647_2540 297
669 3300035084 Ga0373928_0002833 Ga0373928_0002833_22_915 297
670 3300035085 Ga0373929_0001398 Ga0373929_0001398_2533_3426 297
671 3300035088 Ga0373940_0001217 Ga0373940_0001217_2414_3316 297
672 3300035090 Ga0373949_0001424 Ga0373949_0001424_3673_4575 297
673 3300035092 Ga0373952_0000246 Ga0373952_0000246_4470_5363 297
674 3300035112 Ga0373932_0000229 Ga0373932_0000229_10262_11164 297
675 3300035115 Ga0373941_0000372 Ga0373941_0000372_1552_2445 297
676 3300035121 Ga0373960_0002263 Ga0373960_0002263_1154_2047 297
677 3300035207 Ga0373942_0000944 Ga0373942_0000944_5296_6189 297
678 3300035241 Ga0373961_0001011 Ga0373961_0001011_439_1332 297
679 3300035242 Ga0373962_0000208 Ga0373962_0000208_9705_10598 297
680 3300035691 Ga0373931_0009175 Ga0373931_0009175_2406_3299 297
681 3300044712 Ga0453684_0316376 Ga0453684_0316376_591_1484 297
682 3300048905 Ga0496102_0364373 Ga0496102_0364373_253_1146 297
683 3300049571 Ga0501034_0621695 Ga0501034_0621695_26_928 297
684 3300049583 Ga0501067_0056607 Ga0501067_0056607_572_1513 297
685 3300049822 Ga0501035_0303902 Ga0501035_0303902_369_1271 297
686 3300050507 nmdc:mga05p37_332165_c1 nmdc:mga05p37_332165_c1_798_1700 297
687 3300050509 nmdc:mga0qj67_10737_c1 nmdc:mga0qj67_10737_c1_5629_6531 297
688 3300053094 Ga0500566_0008491 Ga0500566_0008491_4372_5271 297
689 3300053148 Ga0500590_062355 Ga0500590_062355_252_1151 297
690 3300053177 Ga0500636_0005706 Ga0500636_0005706_3183_4082 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

100

303

0.97

PF20434

BD-FAE

BD-FAE

92

193

0.89

PF10340

Say1_Mug180

Steryl acetyl hydrolase

85

248

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7at2-assembly2.cif.gz_B crystal structure of inactive estd11 s144a 0.9717 1 292
7av5-assembly1.cif.gz_AAA structure of estd11 in complex with fluorescein 0.9699 1 292
7at3-assembly2.cif.gz_B structure of estd11 in complex with naproxen and methanol 0.9685 1 292
4xvc-assembly3.cif.gz_C crystal structure of an esterase from the bacterial hormone-sensitive lipase (hsl) family 0.9662 3 292
7at4-assembly1.cif.gz_A structure of estd11 in complex with naproxen 0.9626 1 292
ID Description Score Start End Superfamily
3g9uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9529 3 294 3.40.50.1820
3g9uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9403 3 294 3.40.50.1820
3dnmC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9391 1 291 3.40.50.1820
3dnmC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9267 1 291 3.40.50.1820
3aikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9252 18 295 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A420AVT6-F1-model_v4 deleted 0.9879 2 293
AF-X1H4G5-F1-model_v4 Alpha/beta hydrolase fold-3 domain-containing protein 0.9855 108 292 GO:0004806
AF-A0A2V6TEZ5-F1-model_v4 Alpha/beta hydrolase 0.9845 154 290 GO:0004806
AF-A0A538PVW6-F1-model_v4 Alpha/beta hydrolase 0.9809 3 295 GO:0004806
AF-A0A535Y0C5-F1-model_v4 Alpha/beta hydrolase 0.9793 85 294 GO:0004806

Feature Viewer

pLDDT pTM Quality
94.02 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map