F475342
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 688 | 370 | 662 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300046457|Ga0495590_0035320|Ga0495590_0035320_397_1149 |
| Length | 250 |
| Sequence | VSAAAAIQRRARGACSELSHRIHRIDITLTNAKGWNIMDRFLEALRVQRWDDHRYYHHSRINQSLHLLSAISFLFAYVMMFTDPALAALAGWLVAMTSRQIGHFFFEPKDYDVVNQASHEYKEEIKVGYNLQRKVVLMTIWALSPLPLYFDPTLFGIFTPHTGSLEFVRHVGLIWLVVGLGGLLFRTIQLFFTKDVQTGLVWATKILTDPFHDIKLYHKAPLYLMRGELIDPRLHADWIDEDAEEAPRAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 4 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 5 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 6 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 7 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 8 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 9 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 10 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 11 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 12 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 13 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 14 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 15 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 16 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 17 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 18 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 19 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 20 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 97 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 98 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 105 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 106 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 107 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 108 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 110 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 125 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 142 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 197 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 213 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 221 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 244 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 245 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 246 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 247 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 248 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 249 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 250 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 251 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 316 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 325 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 326 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 327 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 345 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 346 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 347 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 360 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 362 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 363 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 364 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 367 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 368 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 369 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 370 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.5 |
| Metatranscriptomes | 0 |
| Isolates | 3.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.69 |
| Nodule | 3.78 |
| Rhizoplane | 7.56 |
| Rhizosphere | 75.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10013519 | 3300002075 | Bacteria | 1763 |
| 2 | JGI24742J22300_10002527 | 3300002244 | Bacteria | 2919 |
| 3 | JGI24751J29686_10012785 | 3300002459 | Bacteria | 1732 |
| 4 | JGI25406J46586_10083757 | 3300003203 | Bacteria | 973 |
| 5 | Ga0065707_10082160 | 3300005295 | Bacteria | 20515 |
| 6 | Ga0065707_10086978 | 3300005295 | Bacteria | 5211 |
| 7 | Ga0065707_10243856 | 3300005295 | Bacteria | 1147 |
| 8 | Ga0070683_100005456 | 3300005329 | Bacteria | 10626 |
| 9 | Ga0070683_100325727 | 3300005329 | Bacteria | 1463 |
| 10 | Ga0070690_100050904 | 3300005330 | Bacteria | 2642 |
| 11 | Ga0070670_100029346 | 3300005331 | Bacteria | 4734 |
| 12 | Ga0070670_100059809 | 3300005331 | Bacteria | 3271 |
| 13 | Ga0070670_100341469 | 3300005331 | Bacteria | 1314 |
| 14 | Ga0070666_10007822 | 3300005335 | Bacteria | 6601 |
| 15 | Ga0070666_10014598 | 3300005335 | Bacteria | 5001 |
| 16 | Ga0070666_10135376 | 3300005335 | Bacteria | 1714 |
| 17 | Ga0068868_100212153 | 3300005338 | Bacteria | 1618 |
| 18 | Ga0070660_100101243 | 3300005339 | Bacteria | 2283 |
| 19 | Ga0070689_100019528 | 3300005340 | Bacteria | 5012 |
| 20 | Ga0070689_100070646 | 3300005340 | Bacteria | 2726 |
| 21 | Ga0070689_100209815 | 3300005340 | Bacteria | 1594 |
| 22 | Ga0070687_100001575 | 3300005343 | Bacteria | 8111 |
| 23 | Ga0070668_100008384 | 3300005347 | Bacteria | 7675 |
| 24 | Ga0070668_100599329 | 3300005347 | Bacteria | 964 |
| 25 | Ga0070668_100904596 | 3300005347 | Bacteria | 789 |
| 26 | Ga0070669_100001489 | 3300005353 | Bacteria | 16923 |
| 27 | Ga0070669_100205900 | 3300005353 | Bacteria | 1550 |
| 28 | Ga0070675_100291323 | 3300005354 | Bacteria | 1437 |
| 29 | Ga0070671_100001709 | 3300005355 | Bacteria | 16660 |
| 30 | Ga0070671_100054688 | 3300005355 | Bacteria | 3319 |
| 31 | Ga0070671_100722399 | 3300005355 | Bacteria | 865 |
| 32 | Ga0070674_100355375 | 3300005356 | Bacteria | 1185 |
| 33 | Ga0070688_100470697 | 3300005365 | Bacteria | 943 |
| 34 | Ga0070667_100019202 | 3300005367 | Bacteria | 5668 |
| 35 | Ga0070667_100024186 | 3300005367 | Bacteria | 5045 |
| 36 | Ga0070667_100104363 | 3300005367 | Bacteria | 2452 |
| 37 | Ga0070703_10021001 | 3300005406 | Bacteria | 1905 |
| 38 | Ga0070709_10008191 | 3300005434 | Bacteria | 5739 |
| 39 | Ga0070709_10142422 | 3300005434 | Bacteria | 1648 |
| 40 | Ga0070714_100027888 | 3300005435 | Bacteria | 4679 |
| 41 | Ga0070714_100102705 | 3300005435 | Bacteria | 2521 |
| 42 | Ga0070713_100003459 | 3300005436 | Bacteria | 10428 |
| 43 | Ga0070713_100069688 | 3300005436 | Bacteria | 2966 |
| 44 | Ga0070713_100444985 | 3300005436 | Bacteria | 1216 |
| 45 | Ga0070713_100513604 | 3300005436 | Bacteria | 1132 |
| 46 | Ga0070710_10015742 | 3300005437 | Bacteria | 3834 |
| 47 | Ga0070710_10069799 | 3300005437 | Bacteria | 2022 |
| 48 | Ga0070701_10001746 | 3300005438 | Bacteria | 8180 |
| 49 | Ga0070711_100042369 | 3300005439 | Bacteria | 3077 |
| 50 | Ga0070711_100049397 | 3300005439 | Bacteria | 2881 |
| 51 | Ga0070705_100303501 | 3300005440 | Bacteria | 1145 |
| 52 | Ga0070700_100191742 | 3300005441 | Bacteria | 1429 |
| 53 | Ga0070708_100028912 | 3300005445 | Bacteria | 4774 |
| 54 | Ga0070708_100049539 | 3300005445 | Bacteria | 3716 |
| 55 | Ga0070663_100040341 | 3300005455 | Bacteria | 3267 |
| 56 | Ga0070678_100124732 | 3300005456 | Bacteria | 2036 |
| 57 | Ga0070662_100203744 | 3300005457 | Bacteria | 1571 |
| 58 | Ga0070662_100635597 | 3300005457 | Bacteria | 900 |
| 59 | Ga0070681_10087284 | 3300005458 | Bacteria | 3073 |
| 60 | Ga0070685_10009109 | 3300005466 | Bacteria | 5121 |
| 61 | Ga0070706_100110008 | 3300005467 | Bacteria | 2564 |
| 62 | Ga0070706_100819125 | 3300005467 | Bacteria | 861 |
| 63 | Ga0070707_100237479 | 3300005468 | Bacteria | 1774 |
| 64 | Ga0070699_100000717 | 3300005518 | Bacteria | 30798 |
| 65 | Ga0070699_100036672 | 3300005518 | Bacteria | 4241 |
| 66 | Ga0070679_100011913 | 3300005530 | Bacteria | 8300 |
| 67 | Ga0070684_100094649 | 3300005535 | Bacteria | 2661 |
| 68 | Ga0070684_100234321 | 3300005535 | Bacteria | 1677 |
| 69 | Ga0070697_100156271 | 3300005536 | Bacteria | 1925 |
| 70 | Ga0070697_100250049 | 3300005536 | Bacteria | 1516 |
| 71 | Ga0070697_100677961 | 3300005536 | Bacteria | 909 |
| 72 | Ga0068853_100084749 | 3300005539 | Bacteria | 2777 |
| 73 | Ga0068853_100576132 | 3300005539 | Bacteria | 1068 |
| 74 | Ga0070672_100002423 | 3300005543 | Bacteria | 11819 |
| 75 | Ga0070672_100288078 | 3300005543 | Bacteria | 1390 |
| 76 | Ga0070686_100015395 | 3300005544 | Bacteria | 4430 |
| 77 | Ga0070686_100051639 | 3300005544 | Bacteria | 2618 |
| 78 | Ga0070696_100432946 | 3300005546 | Bacteria | 1035 |
| 79 | Ga0070665_100000878 | 3300005548 | Bacteria | 38691 |
| 80 | Ga0070665_100179628 | 3300005548 | Bacteria | 2117 |
| 81 | Ga0070665_100296757 | 3300005548 | Bacteria | 1619 |
| 82 | Ga0070665_100486803 | 3300005548 | Bacteria | 1244 |
| 83 | Ga0070665_100552463 | 3300005548 | Bacteria | 1164 |
| 84 | Ga0070665_100628769 | 3300005548 | Bacteria | 1086 |
| 85 | Ga0070704_100099533 | 3300005549 | Bacteria | 2187 |
| 86 | Ga0068855_100158370 | 3300005563 | Bacteria | 2571 |
| 87 | Ga0068855_100161916 | 3300005563 | Bacteria | 2539 |
| 88 | Ga0068855_100165476 | 3300005563 | Bacteria | 2507 |
| 89 | Ga0068855_100284905 | 3300005563 | Bacteria | 1833 |
| 90 | Ga0070664_100029016 | 3300005564 | Bacteria | 4609 |
| 91 | Ga0070664_100180645 | 3300005564 | Bacteria | 1875 |
| 92 | Ga0068857_100071066 | 3300005577 | Bacteria | 3101 |
| 93 | Ga0068854_100094741 | 3300005578 | Bacteria | 2227 |
| 94 | Ga0068856_100024659 | 3300005614 | Bacteria | 5856 |
| 95 | Ga0068856_100201123 | 3300005614 | Bacteria | 2007 |
| 96 | Ga0068859_100059542 | 3300005617 | Bacteria | 3847 |
| 97 | Ga0068864_100017927 | 3300005618 | Bacteria | 5906 |
| 98 | Ga0068864_100146926 | 3300005618 | Bacteria | 2132 |
| 99 | Ga0068864_100722170 | 3300005618 | Bacteria | 975 |
| 100 | Ga0068866_10249146 | 3300005718 | Bacteria | 1086 |
| 101 | Ga0068861_100020438 | 3300005719 | Bacteria | 4743 |
| 102 | Ga0068861_100123913 | 3300005719 | Bacteria | 2088 |
| 103 | Ga0068861_100493072 | 3300005719 | Bacteria | 1106 |
| 104 | Ga0068851_10059535 | 3300005834 | Bacteria | 1954 |
| 105 | Ga0068851_10235888 | 3300005834 | Bacteria | 1033 |
| 106 | Ga0068870_10013821 | 3300005840 | Bacteria | 3801 |
| 107 | Ga0068863_100005190 | 3300005841 | Bacteria | 12849 |
| 108 | Ga0068858_100098872 | 3300005842 | Bacteria | 2720 |
| 109 | Ga0068858_100190548 | 3300005842 | Bacteria | 1938 |
| 110 | Ga0068860_100008518 | 3300005843 | Bacteria | 10217 |
| 111 | Ga0068860_100034327 | 3300005843 | Bacteria | 4864 |
| 112 | Ga0068860_100396868 | 3300005843 | Bacteria | 1364 |
| 113 | Ga0068862_100038784 | 3300005844 | Bacteria | 4042 |
| 114 | Ga0081455_10004816 | 3300005937 | Bacteria | 14997 |
| 115 | Ga0081455_10016316 | 3300005937 | Bacteria | 7176 |
| 116 | Ga0081455_10047841 | 3300005937 | Bacteria | 3700 |
| 117 | Ga0081538_10119520 | 3300005981 | Bacteria | 1270 |
| 118 | Ga0081540_1006146 | 3300005983 | Bacteria | 8814 |
| 119 | Ga0081540_1026123 | 3300005983 | Bacteria | 3341 |
| 120 | Ga0081540_1027834 | 3300005983 | Bacteria | 3191 |
| 121 | Ga0081540_1044506 | 3300005983 | Bacteria | 2265 |
| 122 | Ga0081540_1093159 | 3300005983 | Bacteria | 1320 |
| 123 | Ga0081539_10003518 | 3300005985 | Bacteria | 19096 |
| 124 | Ga0081539_10036773 | 3300005985 | Bacteria | 2924 |
| 125 | Ga0070717_10048895 | 3300006028 | Bacteria | 3470 |
| 126 | Ga0070717_10400721 | 3300006028 | Bacteria | 1233 |
| 127 | Ga0070717_10690714 | 3300006028 | Bacteria | 927 |
| 128 | Ga0075365_10020959 | 3300006038 | Bacteria | 4067 |
| 129 | Ga0075365_10027361 | 3300006038 | Bacteria | 3628 |
| 130 | Ga0075365_10110049 | 3300006038 | Bacteria | 1893 |
| 131 | Ga0075368_10040532 | 3300006042 | Bacteria | 1829 |
| 132 | Ga0075368_10096447 | 3300006042 | Bacteria | 1212 |
| 133 | Ga0075363_100317717 | 3300006048 | Bacteria | 906 |
| 134 | Ga0075364_10049166 | 3300006051 | Bacteria | 2750 |
| 135 | Ga0075364_10139548 | 3300006051 | Bacteria | 1629 |
| 136 | Ga0075364_10318966 | 3300006051 | Bacteria | 1058 |
| 137 | Ga0070715_10352543 | 3300006163 | Bacteria | 804 |
| 138 | Ga0070716_100161921 | 3300006173 | Bacteria | 1451 |
| 139 | Ga0070716_100234783 | 3300006173 | Bacteria | 1240 |
| 140 | Ga0070712_100001343 | 3300006175 | Bacteria | 14919 |
| 141 | Ga0070712_100014615 | 3300006175 | Bacteria | 5038 |
| 142 | Ga0070712_100165235 | 3300006175 | Bacteria | 1712 |
| 143 | Ga0070712_100196549 | 3300006175 | Bacteria | 1581 |
| 144 | Ga0070712_100245625 | 3300006175 | Bacteria | 1428 |
| 145 | Ga0070712_100259710 | 3300006175 | Bacteria | 1391 |
| 146 | Ga0070712_100308161 | 3300006175 | Bacteria | 1284 |
| 147 | Ga0075362_10209003 | 3300006177 | Bacteria | 952 |
| 148 | Ga0075369_10065649 | 3300006186 | Bacteria | 1591 |
| 149 | Ga0075366_10006588 | 3300006195 | Bacteria | 6373 |
| 150 | Ga0097621_100008043 | 3300006237 | Bacteria | 7571 |
| 151 | Ga0097621_100384174 | 3300006237 | Bacteria | 1255 |
| 152 | Ga0075370_10025723 | 3300006353 | Bacteria | 3256 |
| 153 | Ga0075370_10350461 | 3300006353 | Bacteria | 882 |
| 154 | Ga0068871_100317150 | 3300006358 | Bacteria | 1372 |
| 155 | Ga0075428_100009253 | 3300006844 | Bacteria | 10926 |
| 156 | Ga0075428_100028270 | 3300006844 | Bacteria | 6201 |
| 157 | Ga0075428_100028529 | 3300006844 | Bacteria | 6175 |
| 158 | Ga0075428_100825653 | 3300006844 | Bacteria | 985 |
| 159 | Ga0075430_100012173 | 3300006846 | Bacteria | 7324 |
| 160 | Ga0075430_100062697 | 3300006846 | Bacteria | 3122 |
| 161 | Ga0075430_100157895 | 3300006846 | Bacteria | 1888 |
| 162 | Ga0075431_100001953 | 3300006847 | Bacteria | 19671 |
| 163 | Ga0075431_100026428 | 3300006847 | Bacteria | 5955 |
| 164 | Ga0075431_100780565 | 3300006847 | Bacteria | 929 |
| 165 | Ga0075434_100041554 | 3300006871 | Bacteria | 4555 |
| 166 | Ga0075434_100126898 | 3300006871 | Bacteria | 2568 |
| 167 | Ga0075434_100203965 | 3300006871 | Bacteria | 1998 |
| 168 | Ga0075434_100230744 | 3300006871 | Bacteria | 1870 |
| 169 | Ga0075429_100189038 | 3300006880 | Bacteria | 1805 |
| 170 | Ga0075429_100255844 | 3300006880 | Bacteria | 1533 |
| 171 | Ga0068865_100100265 | 3300006881 | Bacteria | 2119 |
| 172 | Ga0075436_100053515 | 3300006914 | Bacteria | 2787 |
| 173 | Ga0075436_100466644 | 3300006914 | Bacteria | 921 |
| 174 | Ga0075436_100513875 | 3300006914 | Bacteria | 877 |
| 175 | Ga0097620_100059542 | 3300006931 | Bacteria | 3847 |
| 176 | Ga0099824_1005291 | 3300006942 | Bacteria | 18236 |
| 177 | Ga0099822_1009136 | 3300006943 | Bacteria | 12548 |
| 178 | Ga0075435_100411046 | 3300007076 | Bacteria | 1165 |
| 179 | Ga0099794_10088432 | 3300007265 | Bacteria | 1535 |
| 180 | Ga0099794_10104583 | 3300007265 | Bacteria | 1415 |
| 181 | Ga0099795_10030859 | 3300007788 | Bacteria | 1842 |
| 182 | Ga0099795_10066638 | 3300007788 | Bacteria | 1349 |
| 183 | Ga0099795_10092521 | 3300007788 | Bacteria | 1174 |
| 184 | Ga0105251_10001607 | 3300009011 | Bacteria | 19211 |
| 185 | Ga0105251_10081356 | 3300009011 | Bacteria | 1496 |
| 186 | Ga0105240_10463334 | 3300009093 | Bacteria | 1416 |
| 187 | Ga0105240_10601656 | 3300009093 | Bacteria | 1210 |
| 188 | Ga0105240_10729270 | 3300009093 | Bacteria | 1079 |
| 189 | Ga0111539_10000738 | 3300009094 | Bacteria | 42458 |
| 190 | Ga0111539_10011258 | 3300009094 | Bacteria | 11240 |
| 191 | Ga0111539_10320595 | 3300009094 | Bacteria | 1803 |
| 192 | Ga0111539_10370171 | 3300009094 | Bacteria | 1668 |
| 193 | Ga0111539_10644208 | 3300009094 | Bacteria | 1234 |
| 194 | Ga0105245_10056795 | 3300009098 | Bacteria | 3519 |
| 195 | Ga0105245_10620426 | 3300009098 | Bacteria | 1109 |
| 196 | Ga0105247_10154430 | 3300009101 | Bacteria | 1515 |
| 197 | Ga0105247_10160061 | 3300009101 | Bacteria | 1490 |
| 198 | Ga0105247_10282670 | 3300009101 | Bacteria | 1145 |
| 199 | Ga0114129_10000066 | 3300009147 | Bacteria | 93802 |
| 200 | Ga0114129_10001660 | 3300009147 | Bacteria | 30291 |
| 201 | Ga0114129_10006951 | 3300009147 | Bacteria | 16099 |
| 202 | Ga0114129_10079963 | 3300009147 | Bacteria | 4545 |
| 203 | Ga0105242_10333190 | 3300009176 | Bacteria | 1396 |
| 204 | Ga0105242_10744350 | 3300009176 | Bacteria | 964 |
| 205 | Ga0105248_10003673 | 3300009177 | Bacteria | 16996 |
| 206 | Ga0105248_10054219 | 3300009177 | Bacteria | 4496 |
| 207 | Ga0105248_11075705 | 3300009177 | Bacteria | 909 |
| 208 | Ga0105238_10016713 | 3300009551 | Bacteria | 7435 |
| 209 | Ga0105238_10063079 | 3300009551 | Bacteria | 3706 |
| 210 | Ga0105238_10128894 | 3300009551 | Bacteria | 2508 |
| 211 | Ga0105238_10278341 | 3300009551 | Bacteria | 1654 |
| 212 | Ga0105238_11395569 | 3300009551 | Bacteria | 728 |
| 213 | Ga0105249_10014702 | 3300009553 | Bacteria | 6919 |
| 214 | Ga0105249_10242254 | 3300009553 | Bacteria | 1783 |
| 215 | Ga0099796_10052025 | 3300010159 | Bacteria | 1425 |
| 216 | Ga0105239_10083591 | 3300010375 | Bacteria | 3516 |
| 217 | Ga0105239_10417386 | 3300010375 | Bacteria | 1520 |
| 218 | Ga0105239_10521684 | 3300010375 | Bacteria | 1351 |
| 219 | Ga0105246_10002911 | 3300011119 | Bacteria | 10360 |
| 220 | Ga0157370_10019448 | 3300013104 | Bacteria | 6812 |
| 221 | Ga0157374_10021511 | 3300013296 | Bacteria | 5742 |
| 222 | Ga0157374_10023190 | 3300013296 | Bacteria | 5545 |
| 223 | Ga0157374_11152836 | 3300013296 | Bacteria | 796 |
| 224 | Ga0157378_10731701 | 3300013297 | Bacteria | 1011 |
| 225 | Ga0163162_10254662 | 3300013306 | Bacteria | 1887 |
| 226 | Ga0163162_10340694 | 3300013306 | Bacteria | 1632 |
| 227 | Ga0163162_10441334 | 3300013306 | Bacteria | 1434 |
| 228 | Ga0163162_10491180 | 3300013306 | Bacteria | 1359 |
| 229 | Ga0163162_10735479 | 3300013306 | Bacteria | 1106 |
| 230 | Ga0157372_10510489 | 3300013307 | Bacteria | 1402 |
| 231 | Ga0157375_10004170 | 3300013308 | Bacteria | 12545 |
| 232 | Ga0163163_10054759 | 3300014325 | Bacteria | 3942 |
| 233 | Ga0163163_10060794 | 3300014325 | Bacteria | 3742 |
| 234 | Ga0163163_10130068 | 3300014325 | Bacteria | 2557 |
| 235 | Ga0157380_10914808 | 3300014326 | Bacteria | 904 |
| 236 | Ga0157377_10008253 | 3300014745 | Bacteria | 5071 |
| 237 | Ga0157379_10000337 | 3300014968 | Bacteria | 37644 |
| 238 | Ga0157379_10201161 | 3300014968 | Bacteria | 1801 |
| 239 | Ga0157379_10472790 | 3300014968 | Bacteria | 1159 |
| 240 | Ga0157376_10253271 | 3300014969 | Bacteria | 1646 |
| 241 | Ga0163161_10176237 | 3300017792 | Bacteria | 1637 |
| 242 | Ga0213872_10047326 | 3300021361 | Bacteria | 1956 |
| 243 | Ga0213876_10255639 | 3300021384 | Bacteria | 931 |
| 244 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 245 | Ga0213875_10014516 | 3300021388 | Bacteria | 3842 |
| 246 | Ga0209233_1001106 | 3300025261 | Bacteria | 11025 |
| 247 | Ga0207697_10065121 | 3300025315 | Bacteria | 1520 |
| 248 | Ga0207696_1000069 | 3300025711 | Bacteria | 227744 |
| 249 | Ga0207713_1024593 | 3300025735 | Bacteria | 2804 |
| 250 | Ga0207692_10012729 | 3300025898 | Bacteria | 3622 |
| 251 | Ga0207692_10056398 | 3300025898 | Bacteria | 2015 |
| 252 | Ga0207642_10024956 | 3300025899 | Bacteria | 2411 |
| 253 | Ga0207642_10259968 | 3300025899 | Bacteria | 989 |
| 254 | Ga0207710_10002725 | 3300025900 | Bacteria | 8091 |
| 255 | Ga0207710_10068985 | 3300025900 | Bacteria | 1618 |
| 256 | Ga0207688_10002899 | 3300025901 | Bacteria | 9323 |
| 257 | Ga0207680_10143822 | 3300025903 | Bacteria | 1583 |
| 258 | Ga0207647_10264749 | 3300025904 | Bacteria | 984 |
| 259 | Ga0207685_10044480 | 3300025905 | Bacteria | 1679 |
| 260 | Ga0207685_10179596 | 3300025905 | Bacteria | 980 |
| 261 | Ga0207699_10002630 | 3300025906 | Bacteria | 8485 |
| 262 | Ga0207699_10061074 | 3300025906 | Bacteria | 2266 |
| 263 | Ga0207645_10078327 | 3300025907 | Bacteria | 2118 |
| 264 | Ga0207643_10010894 | 3300025908 | Bacteria | 4904 |
| 265 | Ga0207684_10060869 | 3300025910 | Bacteria | 3207 |
| 266 | Ga0207684_10300491 | 3300025910 | Bacteria | 1384 |
| 267 | Ga0207684_10371854 | 3300025910 | Bacteria | 1230 |
| 268 | Ga0207707_10209679 | 3300025912 | Bacteria | 1697 |
| 269 | Ga0207695_10254109 | 3300025913 | Bacteria | 1656 |
| 270 | Ga0207695_10400739 | 3300025913 | Bacteria | 1256 |
| 271 | Ga0207693_10003110 | 3300025915 | Bacteria | 14279 |
| 272 | Ga0207693_10003660 | 3300025915 | Bacteria | 13116 |
| 273 | Ga0207693_10009510 | 3300025915 | Bacteria | 7919 |
| 274 | Ga0207693_10010641 | 3300025915 | Bacteria | 7464 |
| 275 | Ga0207693_10069552 | 3300025915 | Bacteria | 2755 |
| 276 | Ga0207693_10118075 | 3300025915 | Bacteria | 2083 |
| 277 | Ga0207693_10179919 | 3300025915 | Bacteria | 1664 |
| 278 | Ga0207693_10325227 | 3300025915 | Bacteria | 1204 |
| 279 | Ga0207663_10024028 | 3300025916 | Bacteria | 3506 |
| 280 | Ga0207663_10039429 | 3300025916 | Bacteria | 2862 |
| 281 | Ga0207663_10839291 | 3300025916 | Bacteria | 733 |
| 282 | Ga0207662_10012930 | 3300025918 | Bacteria | 4659 |
| 283 | Ga0207662_10133272 | 3300025918 | Bacteria | 1568 |
| 284 | Ga0207662_10227613 | 3300025918 | Bacteria | 1216 |
| 285 | Ga0207657_10023776 | 3300025919 | Bacteria | 5698 |
| 286 | Ga0207652_10236858 | 3300025921 | Bacteria | 1645 |
| 287 | Ga0207681_10004621 | 3300025923 | Bacteria | 8464 |
| 288 | Ga0207681_10396750 | 3300025923 | Bacteria | 1113 |
| 289 | Ga0207694_10080844 | 3300025924 | Bacteria | 2551 |
| 290 | Ga0207694_10228986 | 3300025924 | Bacteria | 1517 |
| 291 | Ga0207694_10796247 | 3300025924 | Bacteria | 798 |
| 292 | Ga0207650_10566048 | 3300025925 | Bacteria | 953 |
| 293 | Ga0207659_10177489 | 3300025926 | Bacteria | 1685 |
| 294 | Ga0207700_10007283 | 3300025928 | Bacteria | 6751 |
| 295 | Ga0207700_10014254 | 3300025928 | Bacteria | 5202 |
| 296 | Ga0207700_10066662 | 3300025928 | Bacteria | 2752 |
| 297 | Ga0207700_10082668 | 3300025928 | Bacteria | 2511 |
| 298 | Ga0207700_10361957 | 3300025928 | Bacteria | 1265 |
| 299 | Ga0207700_10374834 | 3300025928 | Bacteria | 1243 |
| 300 | Ga0207664_10015284 | 3300025929 | Bacteria | 5565 |
| 301 | Ga0207664_10261761 | 3300025929 | Bacteria | 1513 |
| 302 | Ga0207644_10000766 | 3300025931 | Bacteria | 20334 |
| 303 | Ga0207644_10366151 | 3300025931 | Bacteria | 1173 |
| 304 | Ga0207706_10006548 | 3300025933 | Bacteria | 10789 |
| 305 | Ga0207686_10052111 | 3300025934 | Bacteria | 2552 |
| 306 | Ga0207686_10622156 | 3300025934 | Bacteria | 852 |
| 307 | Ga0207670_10117060 | 3300025936 | Bacteria | 1930 |
| 308 | Ga0207669_10103541 | 3300025937 | Bacteria | 1888 |
| 309 | Ga0207704_10012670 | 3300025938 | Bacteria | 4189 |
| 310 | Ga0207704_10275206 | 3300025938 | Bacteria | 1277 |
| 311 | Ga0207704_10552667 | 3300025938 | Bacteria | 936 |
| 312 | Ga0207665_10009844 | 3300025939 | Bacteria | 6274 |
| 313 | Ga0207665_10090679 | 3300025939 | Bacteria | 2119 |
| 314 | Ga0207665_10164180 | 3300025939 | Bacteria | 1600 |
| 315 | Ga0207691_10003357 | 3300025940 | Bacteria | 15574 |
| 316 | Ga0207691_10357093 | 3300025940 | Bacteria | 1250 |
| 317 | Ga0207691_10539881 | 3300025940 | Bacteria | 989 |
| 318 | Ga0207711_10021216 | 3300025941 | Bacteria | 5425 |
| 319 | Ga0207711_10028224 | 3300025941 | Bacteria | 4721 |
| 320 | Ga0207711_10055922 | 3300025941 | Bacteria | 3389 |
| 321 | Ga0207689_10006940 | 3300025942 | Bacteria | 9955 |
| 322 | Ga0207661_10075743 | 3300025944 | Bacteria | 2762 |
| 323 | Ga0207667_10235367 | 3300025949 | Bacteria | 1875 |
| 324 | Ga0207667_10263950 | 3300025949 | Bacteria | 1761 |
| 325 | Ga0207651_10049729 | 3300025960 | Bacteria | 2842 |
| 326 | Ga0207668_10003508 | 3300025972 | Bacteria | 9212 |
| 327 | Ga0207658_10121106 | 3300025986 | Bacteria | 2086 |
| 328 | Ga0207677_10108897 | 3300026023 | Bacteria | 2058 |
| 329 | Ga0207677_10190094 | 3300026023 | Bacteria | 1623 |
| 330 | Ga0207703_10393635 | 3300026035 | Bacteria | 1284 |
| 331 | Ga0207703_10496398 | 3300026035 | Bacteria | 1145 |
| 332 | Ga0207678_10020239 | 3300026067 | Bacteria | 5841 |
| 333 | Ga0207708_10020532 | 3300026075 | Bacteria | 4982 |
| 334 | Ga0207702_10680116 | 3300026078 | Bacteria | 1013 |
| 335 | Ga0207641_10002368 | 3300026088 | Bacteria | 17394 |
| 336 | Ga0207641_10168052 | 3300026088 | Bacteria | 1999 |
| 337 | Ga0207648_10009789 | 3300026089 | Bacteria | 9159 |
| 338 | Ga0207674_10016631 | 3300026116 | Bacteria | 8043 |
| 339 | Ga0207675_100027113 | 3300026118 | Bacteria | 5335 |
| 340 | Ga0207675_100035708 | 3300026118 | Bacteria | 4636 |
| 341 | Ga0207675_100297291 | 3300026118 | Bacteria | 1572 |
| 342 | Ga0207683_10004116 | 3300026121 | Bacteria | 12575 |
| 343 | Ga0207683_10377477 | 3300026121 | Bacteria | 1303 |
| 344 | Ga0209589_1000169 | 3300027357 | Bacteria | 74106 |
| 345 | Ga0209489_100493 | 3300027361 | Bacteria | 74106 |
| 346 | Ga0209700_100497 | 3300027363 | Bacteria | 74106 |
| 347 | Ga0209179_1016447 | 3300027512 | Bacteria | 1388 |
| 348 | Ga0209179_1042443 | 3300027512 | Bacteria | 961 |
| 349 | Ga0209588_1081018 | 3300027671 | Bacteria | 1048 |
| 350 | Ga0207428_10009685 | 3300027907 | Bacteria | 8632 |
| 351 | Ga0207428_10038770 | 3300027907 | Bacteria | 3871 |
| 352 | Ga0207428_10264532 | 3300027907 | Bacteria | 1280 |
| 353 | Ga0268266_10001045 | 3300028379 | Bacteria | 34723 |
| 354 | Ga0268266_10439028 | 3300028379 | Bacteria | 1239 |
| 355 | Ga0268265_10248672 | 3300028380 | Bacteria | 1573 |
| 356 | Ga0268264_10027604 | 3300028381 | Bacteria | 4640 |
| 357 | Ga0268264_10431014 | 3300028381 | Bacteria | 1273 |
| 358 | Ga0268264_11071567 | 3300028381 | Bacteria | 814 |
| 359 | Ga0265337_1033729 | 3300028556 | Bacteria | 1509 |
| 360 | Ga0265318_10002991 | 3300028577 | Bacteria | 8732 |
| 361 | Ga0265338_10040511 | 3300028800 | Bacteria | 4375 |
| 362 | Ga0265332_10004192 | 3300031238 | Bacteria | 6824 |
| 363 | Ga0265328_10002177 | 3300031239 | Bacteria | 8837 |
| 364 | Ga0265329_10004078 | 3300031242 | Bacteria | 6203 |
| 365 | Ga0265340_10018198 | 3300031247 | Bacteria | 3626 |
| 366 | Ga0265339_10000560 | 3300031249 | Bacteria | 29070 |
| 367 | Ga0265339_10089663 | 3300031249 | Bacteria | 1614 |
| 368 | Ga0265331_10007385 | 3300031250 | Bacteria | 6363 |
| 369 | Ga0265331_10088808 | 3300031250 | Bacteria | 1430 |
| 370 | Ga0265316_10010754 | 3300031344 | Bacteria | 8313 |
| 371 | Ga0265316_10450598 | 3300031344 | Bacteria | 923 |
| 372 | Ga0307513_10318621 | 3300031456 | Bacteria | 1314 |
| 373 | Ga0265313_10056460 | 3300031595 | Bacteria | 1857 |
| 374 | Ga0265313_10113189 | 3300031595 | Bacteria | 1191 |
| 375 | Ga0265314_10021351 | 3300031711 | Bacteria | 4979 |
| 376 | Ga0265342_10024786 | 3300031712 | Bacteria | 3782 |
| 377 | Ga0265342_10221330 | 3300031712 | Bacteria | 1020 |
| 378 | Ga0307516_10001689 | 3300031730 | Bacteria | 30398 |
| 379 | Ga0307412_10687239 | 3300031911 | Bacteria | 877 |
| 380 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 381 | Ga0373959_0033404 | 3300034820 | Bacteria | 1050 |
| 382 | Ga0373923_0060006 | 3300035111 | Bacteria | 1614 |
| 383 | Ga0373923_0080451 | 3300035111 | Bacteria | 1413 |
| 384 | Ga0373923_0179373 | 3300035111 | Bacteria | 973 |
| 385 | Ga0373936_0069859 | 3300035113 | Bacteria | 1446 |
| 386 | Ga0373936_0226874 | 3300035113 | Bacteria | 830 |
| 387 | Ga0373939_0084490 | 3300035114 | Bacteria | 1061 |
| 388 | Ga0373953_0009911 | 3300035117 | Bacteria | 3300 |
| 389 | Ga0373953_0076702 | 3300035117 | Bacteria | 1385 |
| 390 | Ga0373954_0083020 | 3300035118 | Bacteria | 1533 |
| 391 | Ga0373943_0006818 | 3300035170 | Bacteria | 5124 |
| 392 | Ga0373943_0260670 | 3300035170 | Bacteria | 976 |
| 393 | Ga0373946_0027806 | 3300035171 | Bacteria | 2240 |
| 394 | Ga0373946_0041774 | 3300035171 | Bacteria | 1882 |
| 395 | Ga0373946_0046375 | 3300035171 | Bacteria | 1801 |
| 396 | Ga0373946_0216268 | 3300035171 | Bacteria | 924 |
| 397 | Ga0373955_0131500 | 3300035172 | Bacteria | 1461 |
| 398 | Ga0373961_0036898 | 3300035241 | Bacteria | 1394 |
| 399 | Ga0373961_0054874 | 3300035241 | Bacteria | 1192 |
| 400 | Ga0373924_0016771 | 3300035410 | Bacteria | 2801 |
| 401 | Ga0373931_0003811 | 3300035691 | Bacteria | 6813 |
| 402 | Ga0373931_0041850 | 3300035691 | Bacteria | 2408 |
| 403 | Ga0373935_0111923 | 3300035692 | Bacteria | 1813 |
| 404 | Ga0373927_0001542 | 3300035695 | Bacteria | 17306 |
| 405 | Ga0373927_0023442 | 3300035695 | Bacteria | 4042 |
| 406 | Ga0373927_0262302 | 3300035695 | Bacteria | 1136 |
| 407 | Ga0373933_0000241 | 3300035724 | Bacteria | 35958 |
| 408 | Ga0373933_0038660 | 3300035724 | Bacteria | 2804 |
| 409 | Ga0373933_0088942 | 3300035724 | Bacteria | 1903 |
| 410 | Ga0373947_0055198 | 3300035725 | Bacteria | 2398 |
| 411 | Ga0373947_0337935 | 3300035725 | Bacteria | 1009 |
| 412 | Ga0373937_0000443 | 3300036401 | Bacteria | 38365 |
| 413 | Ga0373937_0004815 | 3300036401 | Bacteria | 11472 |
| 414 | Ga0373937_0029738 | 3300036401 | Bacteria | 4949 |
| 415 | Ga0373937_0094017 | 3300036401 | Bacteria | 2780 |
| 416 | Ga0373925_0135223 | 3300037068 | Bacteria | 1926 |
| 417 | Ga0395900_0306356 | 3300037418 | Bacteria | 1573 |
| 418 | Ga0395905_0189760 | 3300037471 | Bacteria | 1928 |
| 419 | Ga0436364_0010210 | 3300037853 | Bacteria | 5361 |
| 420 | Ga0436364_0645586 | 3300037853 | Bacteria | 957 |
| 421 | Ga0436364_0693200 | 3300037853 | Bacteria | 3616 |
| 422 | Ga0436364_0858723 | 3300037853 | Bacteria | 883 |
| 423 | Ga0436364_0875435 | 3300037853 | Bacteria | 49936 |
| 424 | Ga0395901_0145072 | 3300038443 | Bacteria | 2495 |
| 425 | Ga0436365_0464318 | 3300039437 | Bacteria | 4661 |
| 426 | Ga0436365_0650883 | 3300039437 | Bacteria | 1467 |
| 427 | Ga0436365_1522619 | 3300039437 | Bacteria | 2033 |
| 428 | Ga0436365_1878830 | 3300039437 | Bacteria | 1402 |
| 429 | Ga0436360_0364414 | 3300039438 | Bacteria | 19147 |
| 430 | Ga0436360_0651179 | 3300039438 | Bacteria | 810 |
| 431 | Ga0436361_0210879 | 3300039447 | Bacteria | 17162 |
| 432 | Ga0436361_0213695 | 3300039447 | Bacteria | 9267 |
| 433 | Ga0436363_1328344 | 3300039450 | Bacteria | 1394 |
| 434 | Ga0436363_1586335 | 3300039450 | Bacteria | 1078 |
| 435 | Ga0439453_0002403 | 3300041408 | Bacteria | 2581 |
| 436 | Ga0451853_0208434 | 3300041512 | Bacteria | 1846 |
| 437 | Ga0451853_0775028 | 3300041512 | Bacteria | 1814 |
| 438 | Ga0451853_2874200 | 3300041512 | Bacteria | 2182 |
| 439 | Ga0439445_0078464 | 3300042004 | Bacteria | 921 |
| 440 | Ga0439435_0071635 | 3300042436 | Bacteria | 1027 |
| 441 | Ga0439464_0089113 | 3300042439 | Bacteria | 928 |
| 442 | Ga0439464_0153295 | 3300042439 | Bacteria | 722 |
| 443 | Ga0466969_0133123 | 3300044656 | Bacteria | 1152 |
| 444 | Ga0495603_0003868 | 3300046455 | Bacteria | 8914 |
| 445 | Ga0495603_0271087 | 3300046455 | Bacteria | 976 |
| 446 | Ga0495590_0035320 | 3300046457 | Bacteria | 1746 |
| 447 | Ga0495629_0092226 | 3300046459 | Bacteria | 2114 |
| 448 | Ga0495638_0001008 | 3300046460 | Bacteria | 28102 |
| 449 | Ga0495638_0143486 | 3300046460 | Bacteria | 1391 |
| 450 | Ga0495653_0012660 | 3300046463 | Bacteria | 6890 |
| 451 | Ga0495650_0039296 | 3300046471 | Bacteria | 2043 |
| 452 | Ga0495580_0462668 | 3300046472 | Bacteria | 850 |
| 453 | Ga0495639_0030518 | 3300046475 | Bacteria | 2396 |
| 454 | Ga0495662_0003605 | 3300046476 | Bacteria | 7810 |
| 455 | Ga0495664_0000470 | 3300046477 | Bacteria | 19968 |
| 456 | Ga0495583_0000030 | 3300046506 | Bacteria | 254970 |
| 457 | Ga0495616_0185918 | 3300046513 | Bacteria | 921 |
| 458 | Ga0495618_0002529 | 3300046514 | Bacteria | 11712 |
| 459 | Ga0495618_0045054 | 3300046514 | Bacteria | 2782 |
| 460 | Ga0495628_0266660 | 3300046516 | Bacteria | 1275 |
| 461 | Ga0495630_0012167 | 3300046517 | Bacteria | 6241 |
| 462 | Ga0495630_0131397 | 3300046517 | Bacteria | 1901 |
| 463 | Ga0495663_0105543 | 3300046525 | Bacteria | 932 |
| 464 | Ga0495652_0040999 | 3300046529 | Bacteria | 3999 |
| 465 | Ga0495665_0170716 | 3300046531 | Bacteria | 1132 |
| 466 | Ga0495640_0063900 | 3300046533 | Bacteria | 2490 |
| 467 | Ga0495587_0022150 | 3300046536 | Bacteria | 3914 |
| 468 | Ga0495598_0001623 | 3300046537 | Bacteria | 4507 |
| 469 | Ga0495598_0037712 | 3300046537 | Bacteria | 1395 |
| 470 | Ga0495597_0189544 | 3300046542 | Bacteria | 828 |
| 471 | Ga0495645_0024307 | 3300046543 | Bacteria | 4395 |
| 472 | Ga0495645_0278167 | 3300046543 | Bacteria | 1102 |
| 473 | Ga0495622_0069274 | 3300046557 | Bacteria | 1629 |
| 474 | Ga0495667_0029980 | 3300046559 | Bacteria | 3658 |
| 475 | Ga0495667_0200899 | 3300046559 | Bacteria | 1276 |
| 476 | Ga0495656_0090592 | 3300046615 | Bacteria | 1398 |
| 477 | Ga0495634_0004229 | 3300046642 | Bacteria | 11333 |
| 478 | Ga0495634_0017525 | 3300046642 | Bacteria | 5107 |
| 479 | Ga0495625_0005241 | 3300046660 | Bacteria | 11930 |
| 480 | Ga0495635_0000867 | 3300046663 | Bacteria | 19857 |
| 481 | Ga0495659_0094622 | 3300046664 | Bacteria | 1151 |
| 482 | Ga0495661_0045282 | 3300046665 | Bacteria | 2692 |
| 483 | Ga0495588_0277551 | 3300046674 | Bacteria | 883 |
| 484 | Ga0495599_0039406 | 3300046678 | Bacteria | 2969 |
| 485 | Ga0495623_0097719 | 3300046679 | Bacteria | 1793 |
| 486 | Ga0495646_0083260 | 3300046680 | Bacteria | 1860 |
| 487 | Ga0495647_0243790 | 3300046681 | Bacteria | 799 |
| 488 | Ga0495613_0076922 | 3300046689 | Bacteria | 2428 |
| 489 | Ga0495670_0007381 | 3300046691 | Bacteria | 5404 |
| 490 | Ga0495670_0255100 | 3300046691 | Bacteria | 935 |
| 491 | Ga0495649_0104271 | 3300046694 | Bacteria | 1506 |
| 492 | Ga0495600_0339950 | 3300046809 | Bacteria | 941 |
| 493 | Ga0495581_0051698 | 3300047315 | Bacteria | 2373 |
| 494 | Ga0495604_0155548 | 3300047317 | Bacteria | 1620 |
| 495 | Ga0495604_0256999 | 3300047317 | Bacteria | 1189 |
| 496 | Ga0495674_0014795 | 3300047319 | Bacteria | 7299 |
| 497 | Ga0495672_0024237 | 3300047320 | Bacteria | 3913 |
| 498 | Ga0495672_0070699 | 3300047320 | Bacteria | 1977 |
| 499 | Ga0495676_0027638 | 3300047321 | Bacteria | 4861 |
| 500 | Ga0495675_0038586 | 3300047444 | Bacteria | 3041 |
| 501 | Ga0495684_0042111 | 3300047471 | Bacteria | 3498 |
| 502 | Ga0495684_0091366 | 3300047471 | Bacteria | 2306 |
| 503 | Ga0495684_0175165 | 3300047471 | Bacteria | 1593 |
| 504 | Ga0495686_0000811 | 3300047472 | Bacteria | 40468 |
| 505 | Ga0495686_0007753 | 3300047472 | Bacteria | 7997 |
| 506 | Ga0495593_0051386 | 3300047673 | Bacteria | 2181 |
| 507 | Ga0495593_0085345 | 3300047673 | Bacteria | 1629 |
| 508 | Ga0495602_0402147 | 3300048088 | Bacteria | 976 |
| 509 | Ga0496100_0000732 | 3300048903 | Bacteria | 15681 |
| 510 | Ga0496100_0292383 | 3300048903 | Bacteria | 1217 |
| 511 | Ga0496101_0043904 | 3300048904 | Bacteria | 3196 |
| 512 | Ga0496101_0366390 | 3300048904 | Bacteria | 1133 |
| 513 | Ga0496102_0012404 | 3300048905 | Bacteria | 7374 |
| 514 | Ga0496102_0014870 | 3300048905 | Bacteria | 6770 |
| 515 | Ga0496102_0062343 | 3300048905 | Bacteria | 3414 |
| 516 | Ga0496102_0235571 | 3300048905 | Bacteria | 1726 |
| 517 | Ga0496103_0033054 | 3300048906 | Bacteria | 3159 |
| 518 | Ga0496104_0000206 | 3300048907 | Bacteria | 52627 |
| 519 | Ga0496104_0005540 | 3300048907 | Bacteria | 11059 |
| 520 | Ga0496104_0021277 | 3300048907 | Bacteria | 5952 |
| 521 | Ga0496104_0076846 | 3300048907 | Bacteria | 3180 |
| 522 | Ga0496105_0016883 | 3300048908 | Bacteria | 5840 |
| 523 | Ga0496106_0014703 | 3300048909 | Bacteria | 5785 |
| 524 | Ga0496106_0101315 | 3300048909 | Bacteria | 2234 |
| 525 | Ga0496107_0006176 | 3300048910 | Bacteria | 8229 |
| 526 | Ga0496107_0222909 | 3300048910 | Bacteria | 1403 |
| 527 | Ga0496107_0285951 | 3300048910 | Bacteria | 1227 |
| 528 | Ga0496108_0000822 | 3300048911 | Bacteria | 24137 |
| 529 | Ga0496108_0043926 | 3300048911 | Bacteria | 3732 |
| 530 | Ga0496108_0293393 | 3300048911 | Bacteria | 1416 |
| 531 | Ga0496108_0795824 | 3300048911 | Bacteria | 816 |
| 532 | Ga0496109_0001115 | 3300048912 | Bacteria | 22294 |
| 533 | Ga0496109_0045438 | 3300048912 | Bacteria | 3986 |
| 534 | Ga0496109_0875009 | 3300048912 | Bacteria | 836 |
| 535 | Ga0496110_0021839 | 3300048913 | Bacteria | 5427 |
| 536 | Ga0496110_0026250 | 3300048913 | Bacteria | 4982 |
| 537 | Ga0496110_0032798 | 3300048913 | Bacteria | 4489 |
| 538 | Ga0496110_0150019 | 3300048913 | Bacteria | 2110 |
| 539 | Ga0496110_0196993 | 3300048913 | Bacteria | 1829 |
| 540 | Ga0496110_0438800 | 3300048913 | Bacteria | 1190 |
| 541 | Ga0496111_0003041 | 3300048914 | Bacteria | 10287 |
| 542 | Ga0496111_0035832 | 3300048914 | Bacteria | 3547 |
| 543 | Ga0496111_0138244 | 3300048914 | Bacteria | 1805 |
| 544 | Ga0496112_0001495 | 3300048915 | Bacteria | 18003 |
| 545 | Ga0496112_0004396 | 3300048915 | Bacteria | 11925 |
| 546 | Ga0496112_0018494 | 3300048915 | Bacteria | 6561 |
| 547 | Ga0496112_0664350 | 3300048915 | Bacteria | 971 |
| 548 | Ga0496113_0003524 | 3300048916 | Bacteria | 9393 |
| 549 | Ga0496113_0041380 | 3300048916 | Bacteria | 3400 |
| 550 | Ga0496113_0499072 | 3300048916 | Bacteria | 977 |
| 551 | Ga0496114_0015030 | 3300048917 | Bacteria | 6223 |
| 552 | Ga0496114_0020954 | 3300048917 | Bacteria | 5310 |
| 553 | Ga0496115_0010899 | 3300048918 | Bacteria | 6805 |
| 554 | Ga0496115_0020878 | 3300048918 | Bacteria | 5055 |
| 555 | Ga0496115_0061380 | 3300048918 | Bacteria | 3030 |
| 556 | Ga0496115_0067660 | 3300048918 | Bacteria | 2889 |
| 557 | Ga0496115_0164267 | 3300048918 | Bacteria | 1836 |
| 558 | Ga0496115_0175129 | 3300048918 | Bacteria | 1774 |
| 559 | Ga0496115_0207488 | 3300048918 | Bacteria | 1618 |
| 560 | Ga0496116_0269129 | 3300048919 | Bacteria | 834 |
| 561 | Ga0496118_0027055 | 3300048921 | Bacteria | 4864 |
| 562 | Ga0496118_0041510 | 3300048921 | Bacteria | 3641 |
| 563 | Ga0496119_0008671 | 3300048922 | Bacteria | 8891 |
| 564 | Ga0496119_0140041 | 3300048922 | Bacteria | 1307 |
| 565 | Ga0496120_0069541 | 3300048923 | Bacteria | 1939 |
| 566 | Ga0496121_0000923 | 3300048924 | Bacteria | 53102 |
| 567 | Ga0496121_0008770 | 3300048924 | Bacteria | 11796 |
| 568 | Ga0496121_0183637 | 3300048924 | Bacteria | 1507 |
| 569 | Ga0496123_0137237 | 3300048926 | Bacteria | 1344 |
| 570 | Ga0496123_0222752 | 3300048926 | Bacteria | 950 |
| 571 | Ga0496124_0089663 | 3300048927 | Bacteria | 2510 |
| 572 | Ga0496124_0224791 | 3300048927 | Bacteria | 1409 |
| 573 | Ga0496125_0055387 | 3300048928 | Bacteria | 3231 |
| 574 | Ga0496125_0065358 | 3300048928 | Bacteria | 2882 |
| 575 | Ga0496126_0002227 | 3300048929 | Bacteria | 26819 |
| 576 | Ga0496126_0069530 | 3300048929 | Bacteria | 3140 |
| 577 | Ga0496126_0101280 | 3300048929 | Bacteria | 2520 |
| 578 | Ga0496126_0368407 | 3300048929 | Bacteria | 1172 |
| 579 | Ga0496126_0450369 | 3300048929 | Bacteria | 1036 |
| 580 | Ga0501031_0421220 | 3300049568 | Bacteria | 863 |
| 581 | Ga0501036_0480833 | 3300049572 | Bacteria | 1034 |
| 582 | Ga0501046_0164933 | 3300049580 | Bacteria | 1664 |
| 583 | Ga0501046_0205092 | 3300049580 | Bacteria | 1466 |
| 584 | Ga0501047_0222923 | 3300049581 | Bacteria | 1741 |
| 585 | Ga0501072_0017442 | 3300049588 | Bacteria | 5516 |
| 586 | Ga0501072_0206770 | 3300049588 | Bacteria | 1565 |
| 587 | Ga0501076_0108736 | 3300049592 | Bacteria | 2240 |
| 588 | Ga0501077_0074876 | 3300049593 | Bacteria | 2144 |
| 589 | Ga0501079_0380106 | 3300049741 | Bacteria | 1107 |
| 590 | Ga0501080_0878199 | 3300049742 | Bacteria | 783 |
| 591 | Ga0501081_0054244 | 3300049743 | Bacteria | 2770 |
| 592 | Ga0501081_0233668 | 3300049743 | Bacteria | 1340 |
| 593 | Ga0501081_0269933 | 3300049743 | Bacteria | 1244 |
| 594 | Ga0501081_0502410 | 3300049743 | Bacteria | 904 |
| 595 | Ga0501083_0015836 | 3300049744 | Bacteria | 5278 |
| 596 | Ga0501083_0381416 | 3300049744 | Bacteria | 917 |
| 597 | Ga0501045_0014870 | 3300049824 | Bacteria | 5520 |
| 598 | nmdc:mga03683_11845_c2 | 3300050489 | Bacteria | 2660 |
| 599 | nmdc:mga03683_69359_c1 | 3300050489 | Bacteria | 1504 |
| 600 | nmdc:mga03683_8694_c1 | 3300050489 | Bacteria | 3579 |
| 601 | nmdc:mga03n38_149464_c1 | 3300050490 | Bacteria | 1174 |
| 602 | nmdc:mga0yw44_1495_c1 | 3300050492 | Bacteria | 6905 |
| 603 | nmdc:mga0yw44_9814_c1 | 3300050492 | Bacteria | 4861 |
| 604 | nmdc:mga0yw44_98448_c1 | 3300050492 | Bacteria | 1859 |
| 605 | nmdc:mga0k408_11727_c1 | 3300050493 | Bacteria | 4780 |
| 606 | nmdc:mga0k408_371521_c1 | 3300050493 | Bacteria | 852 |
| 607 | nmdc:mga0k408_5327_c1 | 3300050493 | Bacteria | 6832 |
| 608 | nmdc:mga06z11_14848_c1 | 3300050494 | Bacteria | 3461 |
| 609 | nmdc:mga06z11_214082_c1 | 3300050494 | Bacteria | 1124 |
| 610 | nmdc:mga06z11_27431_c1 | 3300050494 | Bacteria | 2722 |
| 611 | nmdc:mga06z11_32286_c1 | 3300050494 | Bacteria | 2552 |
| 612 | nmdc:mga06z11_89510_c1 | 3300050494 | Bacteria | 1668 |
| 613 | nmdc:mga04h51_100923_c1 | 3300050495 | Bacteria | 1051 |
| 614 | nmdc:mga04h51_213639_c1 | 3300050495 | Bacteria | 762 |
| 615 | nmdc:mga07m45_180557_c1 | 3300050496 | Bacteria | 1227 |
| 616 | nmdc:mga07m45_30738_c1 | 3300050496 | Bacteria | 2975 |
| 617 | nmdc:mga07m45_324956_c1 | 3300050496 | Bacteria | 894 |
| 618 | nmdc:mga07m45_83547_c1 | 3300050496 | Bacteria | 1825 |
| 619 | nmdc:mga05p37_1072_c1 | 3300050507 | Bacteria | 31317 |
| 620 | nmdc:mga05p37_18171_c1 | 3300050507 | Bacteria | 8496 |
| 621 | nmdc:mga05p37_4399_c1 | 3300050507 | Bacteria | 16466 |
| 622 | nmdc:mga05p37_467604_c1 | 3300050507 | Bacteria | 1456 |
| 623 | nmdc:mga09592_146073_c1 | 3300050508 | Bacteria | 2039 |
| 624 | nmdc:mga0qj67_170347_c1 | 3300050509 | Bacteria | 1768 |
| 625 | nmdc:mga0qj67_229523_c1 | 3300050509 | Bacteria | 1506 |
| 626 | nmdc:mga0qj67_91553_c1 | 3300050509 | Bacteria | 2444 |
| 627 | nmdc:mga0qj67_98121_c1 | 3300050509 | Bacteria | 2360 |
| 628 | nmdc:mga06r32_20124_c1 | 3300050510 | Bacteria | 6139 |
| 629 | nmdc:mga06r32_458_c1 | 3300050510 | Bacteria | 34859 |
| 630 | nmdc:mga08y16_24138_c1 | 3300050511 | Bacteria | 6420 |
| 631 | nmdc:mga08y16_3771_c1 | 3300050511 | Bacteria | 15779 |
| 632 | nmdc:mga0n895_1118069_c1 | 3300050512 | Bacteria | 765 |
| 633 | nmdc:mga0n895_188745_c1 | 3300050512 | Bacteria | 2092 |
| 634 | nmdc:mga0n895_32503_c1 | 3300050512 | Bacteria | 5008 |
| 635 | nmdc:mga0n895_588117_c1 | 3300050512 | Bacteria | 1116 |
| 636 | nmdc:mga0rr50_174553_c1 | 3300050513 | Bacteria | 1753 |
| 637 | nmdc:mga0rr50_243265_c1 | 3300050513 | Bacteria | 1492 |
| 638 | nmdc:mga0sz30_1382_c2 | 3300050516 | Bacteria | 8451 |
| 639 | nmdc:mga0sz30_164682_c1 | 3300050516 | Bacteria | 982 |
| 640 | nmdc:mga0sz30_56311_c1 | 3300050516 | Bacteria | 1674 |
| 641 | nmdc:mga0sz30_85955_c1 | 3300050516 | Bacteria | 1365 |
| 642 | Ga0495601_0045232 | 3300053077 | Bacteria | 2767 |
| 643 | Ga0495601_0103176 | 3300053077 | Bacteria | 1843 |
| 644 | Ga0495601_0242278 | 3300053077 | Bacteria | 1177 |
| 645 | Ga0495612_0011958 | 3300053078 | Bacteria | 3498 |
| 646 | Ga0495612_0036385 | 3300053078 | Bacteria | 1998 |
| 647 | Ga0495612_0122871 | 3300053078 | Bacteria | 1118 |
| 648 | Ga0495595_0177475 | 3300053084 | Bacteria | 1055 |
| 649 | Ga0495619_0031257 | 3300053085 | Bacteria | 3449 |
| 650 | Ga0495619_0223507 | 3300053085 | Bacteria | 1304 |
| 651 | Ga0500555_000310 | 3300053103 | Bacteria | 20978 |
| 652 | Ga0500559_0014141 | 3300053136 | Bacteria | 3374 |
| 653 | Ga0500568_0028671 | 3300053139 | Bacteria | 2319 |
| 654 | Ga0500636_0009768 | 3300053177 | Bacteria | 5589 |
| 655 | Ga0500636_0245015 | 3300053177 | Bacteria | 918 |
| 656 | Ga0500552_000141 | 3300053733 | Bacteria | 6206 |
| 657 | Ga0501084_0137295 | 3300054114 | Bacteria | 2058 |
| 658 | Ga0501082_0000038 | 3300060353 | Bacteria | 94168 |
| 659 | Ga0501082_0220648 | 3300060353 | Bacteria | 1650 |
| 660 | Ga0501082_0421149 | 3300060353 | Bacteria | 1166 |
| 661 | Ga0530510_0246063 | 3300061734 | Bacteria | 1332 |
| 662 | Ga0530510_0570622 | 3300061734 | Bacteria | 860 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006038 | Ga0075365_10110049 | Ga0075365_101100493 | 193 |
| 2 | 3300006353 | Ga0075370_10350461 | Ga0075370_103504611 | 193 |
| 3 | 3300050496 | nmdc:mga07m45_324956_c1 | nmdc:mga07m45_324956_c1_23_679 | 193 |
| 4 | 3300005331 | Ga0070670_100029346 | Ga0070670_1000293462 | 194 |
| 5 | 3300005335 | Ga0070666_10135376 | Ga0070666_101353762 | 194 |
| 6 | 3300005347 | Ga0070668_100008384 | Ga0070668_1000083845 | 194 |
| 7 | 3300005353 | Ga0070669_100001489 | Ga0070669_10000148916 | 194 |
| 8 | 3300005355 | Ga0070671_100001709 | Ga0070671_1000017097 | 194 |
| 9 | 3300005367 | Ga0070667_100024186 | Ga0070667_1000241864 | 194 |
| 10 | 3300005548 | Ga0070665_100000878 | Ga0070665_10000087817 | 194 |
| 11 | 3300005841 | Ga0068863_100005190 | Ga0068863_1000051904 | 194 |
| 12 | 3300005842 | Ga0068858_100098872 | Ga0068858_1000988724 | 194 |
| 13 | 3300005843 | Ga0068860_100034327 | Ga0068860_1000343276 | 194 |
| 14 | 3300005844 | Ga0068862_100038784 | Ga0068862_1000387845 | 194 |
| 15 | 3300006871 | Ga0075434_100041554 | Ga0075434_1000415542 | 194 |
| 16 | 3300009011 | Ga0105251_10001607 | Ga0105251_100016071 | 194 |
| 17 | 3300009177 | Ga0105248_10003673 | Ga0105248_1000367313 | 194 |
| 18 | 3300009553 | Ga0105249_10242254 | Ga0105249_102422542 | 194 |
| 19 | 3300025735 | Ga0207713_1024593 | Ga0207713_10245933 | 194 |
| 20 | 3300025923 | Ga0207681_10004621 | Ga0207681_100046212 | 194 |
| 21 | 3300025931 | Ga0207644_10000766 | Ga0207644_1000076614 | 194 |
| 22 | 3300025972 | Ga0207668_10003508 | Ga0207668_100035086 | 194 |
| 23 | 3300026035 | Ga0207703_10393635 | Ga0207703_103936352 | 194 |
| 24 | 3300026088 | Ga0207641_10002368 | Ga0207641_100023689 | 194 |
| 25 | 3300028379 | Ga0268266_10001045 | Ga0268266_1000104514 | 194 |
| 26 | 3300028380 | Ga0268265_10248672 | Ga0268265_102486722 | 194 |
| 27 | 3300028381 | Ga0268264_10027604 | Ga0268264_100276042 | 194 |
| 28 | 3300048905 | Ga0496102_0235571 | Ga0496102_0235571_129_764 | 194 |
| 29 | 3300048919 | Ga0496116_0269129 | Ga0496116_0269129_175_810 | 194 |
| 30 | 3300048921 | Ga0496118_0041510 | Ga0496118_0041510_334_969 | 194 |
| 31 | 3300048922 | Ga0496119_0140041 | Ga0496119_0140041_553_1188 | 194 |
| 32 | 3300048924 | Ga0496121_0008770 | Ga0496121_0008770_947_1582 | 194 |
| 33 | 3300048926 | Ga0496123_0137237 | Ga0496123_0137237_604_1239 | 194 |
| 34 | 3300048927 | Ga0496124_0224791 | Ga0496124_0224791_158_793 | 194 |
| 35 | 3300048928 | Ga0496125_0065358 | Ga0496125_0065358_1759_2394 | 194 |
| 36 | 3300046506 | Ga0495583_0000030 | Ga0495583_0000030_218984_219616 | 195 |
| 37 | 3300046665 | Ga0495661_0045282 | Ga0495661_0045282_85_717 | 195 |
| 38 | 3300046691 | Ga0495670_0007381 | Ga0495670_0007381_1417_2049 | 195 |
| 39 | 3300048926 | Ga0496123_0222752 | Ga0496123_0222752_152_784 | 195 |
| 40 | 3300053103 | Ga0500555_000310 | Ga0500555_000310_15524_16156 | 195 |
| 41 | 3300005937 | Ga0081455_10047841 | Ga0081455_100478414 | 196 |
| 42 | 3300047472 | Ga0495686_0000811 | Ga0495686_0000811_5603_6238 | 196 |
| 43 | iso_pu_bacteria | 2513237096 | 2513655074 | 196 |
| 44 | iso_pu_bacteria | 2513237137 | 2513861094 | 196 |
| 45 | iso_pu_bacteria | 2513237145 | 2513915903 | 196 |
| 46 | iso_pu_bacteria | 2517572143 | 2517894792 | 196 |
| 47 | iso_pu_bacteria | 2667528175 | 2671119208 | 196 |
| 48 | iso_pu_bacteria | 2728368998 | 2728747555 | 196 |
| 49 | iso_pu_bacteria | 2791355197 | 2793071262 | 196 |
| 50 | iso_pu_bacteria | 2885374607 | 2885376944 | 196 |
| 51 | iso_pu_bacteria | 2903748898 | 2903753003 | 196 |
| 52 | iso_pu_bacteria | 2904690495 | 2904697776 | 196 |
| 53 | iso_pu_bacteria | 2906610324 | 2906611513 | 196 |
| 54 | iso_pu_bacteria | 2906635258 | 2906642445 | 196 |
| 55 | iso_pu_bacteria | 2906660503 | 2906660752 | 196 |
| 56 | iso_pu_bacteria | 2908739725 | 2908745097 | 196 |
| 57 | iso_pu_bacteria | 2908756301 | 2908757127 | 196 |
| 58 | iso_pu_bacteria | 2922425934 | 2922427843 | 196 |
| 59 | iso_pu_bacteria | 2935630451 | 2935632222 | 196 |
| 60 | iso_pu_bacteria | 2941507105 | 2941508170 | 196 |
| 61 | iso_pu_bacteria | 2941515067 | 2941515325 | 196 |
| 62 | iso_pu_bacteria | 2941523033 | 2941524100 | 196 |
| 63 | iso_pu_bacteria | 3005474847 | 3005477554 | 196 |
| 64 | iso_pu_bacteria | 8019555841 | 8019559611 | 196 |
| 65 | iso_pu_bacteria | 8019565922 | 8019569714 | 196 |
| 66 | iso_pu_bacteria | 8056689827 | 8056695208 | 196 |
| 67 | 3300005434 | Ga0070709_10008191 | Ga0070709_100081914 | 197 |
| 68 | 3300005436 | Ga0070713_100003459 | Ga0070713_10000345910 | 197 |
| 69 | 3300006163 | Ga0070715_10352543 | Ga0070715_103525432 | 197 |
| 70 | 3300025906 | Ga0207699_10002630 | Ga0207699_100026306 | 197 |
| 71 | 3300025916 | Ga0207663_10839291 | Ga0207663_108392911 | 197 |
| 72 | 3300025928 | Ga0207700_10014254 | Ga0207700_100142541 | 197 |
| 73 | 3300028577 | Ga0265318_10002991 | Ga0265318_100029913 | 197 |
| 74 | 3300031238 | Ga0265332_10004192 | Ga0265332_100041927 | 197 |
| 75 | 3300031239 | Ga0265328_10002177 | Ga0265328_100021775 | 197 |
| 76 | 3300031242 | Ga0265329_10004078 | Ga0265329_100040783 | 197 |
| 77 | 3300031250 | Ga0265331_10007385 | Ga0265331_100073856 | 197 |
| 78 | 3300031344 | Ga0265316_10010754 | Ga0265316_100107547 | 197 |
| 79 | 3300031595 | Ga0265313_10113189 | Ga0265313_101131892 | 197 |
| 80 | 3300031711 | Ga0265314_10021351 | Ga0265314_100213513 | 197 |
| 81 | 3300031712 | Ga0265342_10024786 | Ga0265342_100247863 | 197 |
| 82 | 3300046460 | Ga0495638_0143486 | Ga0495638_0143486_103_738 | 197 |
| 83 | 3300047472 | Ga0495686_0007753 | Ga0495686_0007753_137_772 | 197 |
| 84 | 3300053136 | Ga0500559_0014141 | Ga0500559_0014141_1908_2543 | 197 |
| 85 | iso_pu_bacteria | 2545555834 | 2545676769 | 197 |
| 86 | iso_pu_bacteria | 641522639 | 641642900 | 197 |
| 87 | 3300005295 | Ga0065707_10082160 | Ga0065707_100821604 | 198 |
| 88 | 3300005434 | Ga0070709_10142422 | Ga0070709_101424222 | 198 |
| 89 | 3300005437 | Ga0070710_10015742 | Ga0070710_100157422 | 198 |
| 90 | 3300005439 | Ga0070711_100042369 | Ga0070711_1000423692 | 198 |
| 91 | 3300005445 | Ga0070708_100028912 | Ga0070708_1000289125 | 198 |
| 92 | 3300005467 | Ga0070706_100110008 | Ga0070706_1001100082 | 198 |
| 93 | 3300005536 | Ga0070697_100250049 | Ga0070697_1002500492 | 198 |
| 94 | 3300005536 | Ga0070697_100677961 | Ga0070697_1006779611 | 198 |
| 95 | 3300005539 | Ga0068853_100576132 | Ga0068853_1005761322 | 198 |
| 96 | 3300005548 | Ga0070665_100552463 | Ga0070665_1005524632 | 198 |
| 97 | 3300005563 | Ga0068855_100158370 | Ga0068855_1001583703 | 198 |
| 98 | 3300005614 | Ga0068856_100024659 | Ga0068856_1000246591 | 198 |
| 99 | 3300005719 | Ga0068861_100020438 | Ga0068861_1000204382 | 198 |
| 100 | 3300005937 | Ga0081455_10004816 | Ga0081455_100048168 | 198 |
| 101 | 3300006028 | Ga0070717_10690714 | Ga0070717_106907141 | 198 |
| 102 | 3300006042 | Ga0075368_10040532 | Ga0075368_100405323 | 198 |
| 103 | 3300006051 | Ga0075364_10318966 | Ga0075364_103189662 | 198 |
| 104 | 3300006173 | Ga0070716_100161921 | Ga0070716_1001619211 | 198 |
| 105 | 3300006175 | Ga0070712_100165235 | Ga0070712_1001652352 | 198 |
| 106 | 3300006175 | Ga0070712_100245625 | Ga0070712_1002456252 | 198 |
| 107 | 3300006846 | Ga0075430_100062697 | Ga0075430_1000626972 | 198 |
| 108 | 3300007788 | Ga0099795_10030859 | Ga0099795_100308592 | 198 |
| 109 | 3300009101 | Ga0105247_10282670 | Ga0105247_102826701 | 198 |
| 110 | 3300009551 | Ga0105238_10278341 | Ga0105238_102783412 | 198 |
| 111 | 3300010375 | Ga0105239_10417386 | Ga0105239_104173861 | 198 |
| 112 | 3300013296 | Ga0157374_10023190 | Ga0157374_100231904 | 198 |
| 113 | 3300013306 | Ga0163162_10735479 | Ga0163162_107354792 | 198 |
| 114 | 3300014325 | Ga0163163_10054759 | Ga0163163_100547591 | 198 |
| 115 | 3300014326 | Ga0157380_10914808 | Ga0157380_109148081 | 198 |
| 116 | 3300025910 | Ga0207684_10060869 | Ga0207684_100608694 | 198 |
| 117 | 3300025915 | Ga0207693_10009510 | Ga0207693_100095102 | 198 |
| 118 | 3300025915 | Ga0207693_10179919 | Ga0207693_101799192 | 198 |
| 119 | 3300025924 | Ga0207694_10796247 | Ga0207694_107962471 | 198 |
| 120 | 3300025939 | Ga0207665_10164180 | Ga0207665_101641801 | 198 |
| 121 | 3300025949 | Ga0207667_10235367 | Ga0207667_102353672 | 198 |
| 122 | 3300026078 | Ga0207702_10680116 | Ga0207702_106801161 | 198 |
| 123 | 3300026118 | Ga0207675_100027113 | Ga0207675_1000271137 | 198 |
| 124 | 3300031247 | Ga0265340_10018198 | Ga0265340_100181983 | 198 |
| 125 | 3300031249 | Ga0265339_10000560 | Ga0265339_1000056019 | 198 |
| 126 | 3300031249 | Ga0265339_10089663 | Ga0265339_100896632 | 198 |
| 127 | 3300031250 | Ga0265331_10088808 | Ga0265331_100888082 | 198 |
| 128 | 3300031456 | Ga0307513_10318621 | Ga0307513_103186211 | 198 |
| 129 | 3300031712 | Ga0265342_10221330 | Ga0265342_102213301 | 198 |
| 130 | 3300031911 | Ga0307412_10687239 | Ga0307412_106872392 | 198 |
| 131 | 3300034820 | Ga0373959_0033404 | Ga0373959_0033404_47_655 | 198 |
| 132 | 3300035114 | Ga0373939_0084490 | Ga0373939_0084490_128_757 | 198 |
| 133 | 3300035695 | Ga0373927_0001542 | Ga0373927_0001542_4589_5221 | 198 |
| 134 | 3300035724 | Ga0373933_0000241 | Ga0373933_0000241_26634_27266 | 198 |
| 135 | 3300037853 | Ga0436364_0693200 | Ga0436364_0693200_1220_1828 | 198 |
| 136 | 3300042004 | Ga0439445_0078464 | Ga0439445_0078464_249_881 | 198 |
| 137 | 3300042439 | Ga0439464_0153295 | Ga0439464_0153295_78_686 | 198 |
| 138 | 3300044656 | Ga0466969_0133123 | Ga0466969_0133123_80_721 | 198 |
| 139 | 3300046455 | Ga0495603_0003868 | Ga0495603_0003868_4523_5155 | 198 |
| 140 | 3300046460 | Ga0495638_0001008 | Ga0495638_0001008_2541_3149 | 198 |
| 141 | 3300046471 | Ga0495650_0039296 | Ga0495650_0039296_132_761 | 198 |
| 142 | 3300046660 | Ga0495625_0005241 | Ga0495625_0005241_4981_5589 | 198 |
| 143 | 3300048911 | Ga0496108_0795824 | Ga0496108_0795824_151_783 | 198 |
| 144 | 3300048918 | Ga0496115_0164267 | Ga0496115_0164267_1056_1688 | 198 |
| 145 | 3300048918 | Ga0496115_0175129 | Ga0496115_0175129_700_1335 | 198 |
| 146 | 3300048921 | Ga0496118_0027055 | Ga0496118_0027055_951_1559 | 198 |
| 147 | 3300048927 | Ga0496124_0089663 | Ga0496124_0089663_1403_2035 | 198 |
| 148 | 3300048928 | Ga0496125_0055387 | Ga0496125_0055387_2190_2822 | 198 |
| 149 | 3300048929 | Ga0496126_0069530 | Ga0496126_0069530_98_733 | 198 |
| 150 | 3300048929 | Ga0496126_0450369 | Ga0496126_0450369_81_713 | 198 |
| 151 | 3300050490 | nmdc:mga03n38_149464_c1 | nmdc:mga03n38_149464_c1_277_906 | 198 |
| 152 | 3300050494 | nmdc:mga06z11_32286_c1 | nmdc:mga06z11_32286_c1_287_916 | 198 |
| 153 | 3300050496 | nmdc:mga07m45_83547_c1 | nmdc:mga07m45_83547_c1_709_1338 | 198 |
| 154 | 3300050509 | nmdc:mga0qj67_170347_c1 | nmdc:mga0qj67_170347_c1_867_1475 | 198 |
| 155 | 3300050513 | nmdc:mga0rr50_174553_c1 | nmdc:mga0rr50_174553_c1_143_778 | 198 |
| 156 | 3300050516 | nmdc:mga0sz30_85955_c1 | nmdc:mga0sz30_85955_c1_693_1298 | 198 |
| 157 | 3300005347 | Ga0070668_100599329 | Ga0070668_1005993291 | 199 |
| 158 | 3300005356 | Ga0070674_100355375 | Ga0070674_1003553752 | 199 |
| 159 | 3300005458 | Ga0070681_10087284 | Ga0070681_100872844 | 199 |
| 160 | 3300005530 | Ga0070679_100011913 | Ga0070679_1000119133 | 199 |
| 161 | 3300005546 | Ga0070696_100432946 | Ga0070696_1004329462 | 199 |
| 162 | 3300005563 | Ga0068855_100165476 | Ga0068855_1001654763 | 199 |
| 163 | 3300005718 | Ga0068866_10249146 | Ga0068866_102491462 | 199 |
| 164 | 3300005834 | Ga0068851_10235888 | Ga0068851_102358881 | 199 |
| 165 | 3300006175 | Ga0070712_100196549 | Ga0070712_1001965491 | 199 |
| 166 | 3300006942 | Ga0099824_1005291 | Ga0099824_100529110 | 199 |
| 167 | 3300006943 | Ga0099822_1009136 | Ga0099822_10091362 | 199 |
| 168 | 3300007788 | Ga0099795_10066638 | Ga0099795_100666382 | 199 |
| 169 | 3300009098 | Ga0105245_10620426 | Ga0105245_106204261 | 199 |
| 170 | 3300009176 | Ga0105242_10744350 | Ga0105242_107443501 | 199 |
| 171 | 3300009177 | Ga0105248_11075705 | Ga0105248_110757051 | 199 |
| 172 | 3300013104 | Ga0157370_10019448 | Ga0157370_100194484 | 199 |
| 173 | 3300025261 | Ga0209233_1001106 | Ga0209233_100110611 | 199 |
| 174 | 3300025898 | Ga0207692_10056398 | Ga0207692_100563983 | 199 |
| 175 | 3300025899 | Ga0207642_10259968 | Ga0207642_102599681 | 199 |
| 176 | 3300025904 | Ga0207647_10264749 | Ga0207647_102647491 | 199 |
| 177 | 3300025910 | Ga0207684_10300491 | Ga0207684_103004912 | 199 |
| 178 | 3300025912 | Ga0207707_10209679 | Ga0207707_102096792 | 199 |
| 179 | 3300025913 | Ga0207695_10254109 | Ga0207695_102541092 | 199 |
| 180 | 3300025918 | Ga0207662_10133272 | Ga0207662_101332722 | 199 |
| 181 | 3300025921 | Ga0207652_10236858 | Ga0207652_102368582 | 199 |
| 182 | 3300025926 | Ga0207659_10177489 | Ga0207659_101774893 | 199 |
| 183 | 3300025934 | Ga0207686_10622156 | Ga0207686_106221561 | 199 |
| 184 | 3300027357 | Ga0209589_1000169 | Ga0209589_100016912 | 199 |
| 185 | 3300027361 | Ga0209489_100493 | Ga0209489_10049312 | 199 |
| 186 | 3300027363 | Ga0209700_100497 | Ga0209700_10049712 | 199 |
| 187 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010105 | 199 |
| 188 | 3300035117 | Ga0373953_0009911 | Ga0373953_0009911_2389_2991 | 199 |
| 189 | 3300035171 | Ga0373946_0027806 | Ga0373946_0027806_710_1327 | 199 |
| 190 | 3300035172 | Ga0373955_0131500 | Ga0373955_0131500_801_1403 | 199 |
| 191 | 3300035410 | Ga0373924_0016771 | Ga0373924_0016771_1132_1734 | 199 |
| 192 | 3300035724 | Ga0373933_0088942 | Ga0373933_0088942_836_1438 | 199 |
| 193 | 3300036401 | Ga0373937_0004815 | Ga0373937_0004815_2615_3217 | 199 |
| 194 | 3300037471 | Ga0395905_0189760 | Ga0395905_0189760_104_721 | 199 |
| 195 | 3300041512 | Ga0451853_0208434 | Ga0451853_0208434_65_670 | 199 |
| 196 | 3300046681 | Ga0495647_0243790 | Ga0495647_0243790_108_725 | 199 |
| 197 | 3300047320 | Ga0495672_0024237 | Ga0495672_0024237_2308_2925 | 199 |
| 198 | 3300047320 | Ga0495672_0070699 | Ga0495672_0070699_164_778 | 199 |
| 199 | 3300047471 | Ga0495684_0175165 | Ga0495684_0175165_256_864 | 199 |
| 200 | 3300048903 | Ga0496100_0292383 | Ga0496100_0292383_490_1107 | 199 |
| 201 | 3300048924 | Ga0496121_0000923 | Ga0496121_0000923_9679_10296 | 199 |
| 202 | 3300048924 | Ga0496121_0183637 | Ga0496121_0183637_848_1465 | 199 |
| 203 | 3300050493 | nmdc:mga0k408_5327_c1 | nmdc:mga0k408_5327_c1_5077_5685 | 199 |
| 204 | 3300053078 | Ga0495612_0036385 | Ga0495612_0036385_561_1178 | 199 |
| 205 | 3300053139 | Ga0500568_0028671 | Ga0500568_0028671_1499_2116 | 199 |
| 206 | 3300021388 | Ga0213875_10014516 | Ga0213875_100145163 | 200 |
| 207 | 3300035118 | Ga0373954_0083020 | Ga0373954_0083020_108_716 | 200 |
| 208 | 3300036401 | Ga0373937_0000443 | Ga0373937_0000443_37687_38295 | 200 |
| 209 | 3300037853 | Ga0436364_0010210 | Ga0436364_0010210_1738_2367 | 200 |
| 210 | 3300039438 | Ga0436360_0651179 | Ga0436360_0651179_92_712 | 200 |
| 211 | 3300039450 | Ga0436363_1328344 | Ga0436363_1328344_689_1309 | 200 |
| 212 | 3300048922 | Ga0496119_0008671 | Ga0496119_0008671_1998_2615 | 200 |
| 213 | 3300048923 | Ga0496120_0069541 | Ga0496120_0069541_1093_1710 | 200 |
| 214 | 3300049568 | Ga0501031_0421220 | Ga0501031_0421220_222_845 | 200 |
| 215 | 3300049580 | Ga0501046_0164933 | Ga0501046_0164933_254_877 | 200 |
| 216 | 3300049741 | Ga0501079_0380106 | Ga0501079_0380106_98_721 | 200 |
| 217 | 3300049743 | Ga0501081_0054244 | Ga0501081_0054244_1254_1877 | 200 |
| 218 | 3300049824 | Ga0501045_0014870 | Ga0501045_0014870_2036_2659 | 200 |
| 219 | 3300003203 | JGI25406J46586_10083757 | JGI25406J46586_100837571 | 201 |
| 220 | 3300005440 | Ga0070705_100303501 | Ga0070705_1003035012 | 201 |
| 221 | 3300005983 | Ga0081540_1093159 | Ga0081540_10931591 | 201 |
| 222 | 3300005985 | Ga0081539_10036773 | Ga0081539_100367732 | 201 |
| 223 | 3300021384 | Ga0213876_10255639 | Ga0213876_102556392 | 201 |
| 224 | 3300021388 | Ga0213875_10000003 | Ga0213875_1000000385 | 201 |
| 225 | 3300037853 | Ga0436364_0875435 | Ga0436364_0875435_31180_31881 | 201 |
| 226 | 3300039437 | Ga0436365_0464318 | Ga0436365_0464318_348_998 | 201 |
| 227 | 3300039437 | Ga0436365_0650883 | Ga0436365_0650883_179_865 | 201 |
| 228 | 3300039450 | Ga0436363_1586335 | Ga0436363_1586335_190_876 | 201 |
| 229 | 3300041512 | Ga0451853_2874200 | Ga0451853_2874200_1557_2171 | 201 |
| 230 | 3300046517 | Ga0495630_0131397 | Ga0495630_0131397_1106_1720 | 201 |
| 231 | 3300047444 | Ga0495675_0038586 | Ga0495675_0038586_1545_2153 | 201 |
| 232 | 3300005983 | Ga0081540_1027834 | Ga0081540_10278343 | 202 |
| 233 | 3300006177 | Ga0075362_10209003 | Ga0075362_102090032 | 202 |
| 234 | 3300028556 | Ga0265337_1033729 | Ga0265337_10337291 | 202 |
| 235 | 3300028800 | Ga0265338_10040511 | Ga0265338_100405112 | 202 |
| 236 | 3300035241 | Ga0373961_0036898 | Ga0373961_0036898_363_983 | 202 |
| 237 | 3300039437 | Ga0436365_1878830 | Ga0436365_1878830_598_1293 | 202 |
| 238 | 3300048907 | Ga0496104_0000206 | Ga0496104_0000206_21730_22368 | 202 |
| 239 | 3300050494 | nmdc:mga06z11_89510_c1 | nmdc:mga06z11_89510_c1_17_700 | 202 |
| 240 | 3300053733 | Ga0500552_000141 | Ga0500552_000141_4958_5635 | 202 |
| 241 | 3300006186 | Ga0075369_10065649 | Ga0075369_100656492 | 203 |
| 242 | 3300031344 | Ga0265316_10450598 | Ga0265316_104505981 | 203 |
| 243 | 3300037853 | Ga0436364_0645586 | Ga0436364_0645586_185_835 | 203 |
| 244 | 3300048912 | Ga0496109_0045438 | Ga0496109_0045438_1629_2267 | 203 |
| 245 | 3300048918 | Ga0496115_0010899 | Ga0496115_0010899_1053_1691 | 203 |
| 246 | 3300048918 | Ga0496115_0207488 | Ga0496115_0207488_528_1142 | 203 |
| 247 | 3300050489 | nmdc:mga03683_11845_c2 | nmdc:mga03683_11845_c2_929_1585 | 203 |
| 248 | 3300050492 | nmdc:mga0yw44_9814_c1 | nmdc:mga0yw44_9814_c1_835_1491 | 203 |
| 249 | 3300050494 | nmdc:mga06z11_14848_c1 | nmdc:mga06z11_14848_c1_1053_1709 | 203 |
| 250 | 3300050516 | nmdc:mga0sz30_56311_c1 | nmdc:mga0sz30_56311_c1_547_1203 | 203 |
| 251 | 3300005295 | Ga0065707_10086978 | Ga0065707_100869783 | 204 |
| 252 | 3300005536 | Ga0070697_100156271 | Ga0070697_1001562712 | 204 |
| 253 | 3300009551 | Ga0105238_10128894 | Ga0105238_101288943 | 204 |
| 254 | 3300010159 | Ga0099796_10052025 | Ga0099796_100520252 | 204 |
| 255 | 3300014968 | Ga0157379_10000337 | Ga0157379_1000033728 | 204 |
| 256 | 3300025711 | Ga0207696_1000069 | Ga0207696_1000069191 | 204 |
| 257 | 3300025910 | Ga0207684_10371854 | Ga0207684_103718542 | 204 |
| 258 | 3300025915 | Ga0207693_10325227 | Ga0207693_103252272 | 204 |
| 259 | 3300048929 | Ga0496126_0368407 | Ga0496126_0368407_221_889 | 204 |
| 260 | 3300049580 | Ga0501046_0205092 | Ga0501046_0205092_790_1440 | 204 |
| 261 | 3300049581 | Ga0501047_0222923 | Ga0501047_0222923_125_775 | 204 |
| 262 | 3300028379 | Ga0268266_10439028 | Ga0268266_104390281 | 205 |
| 263 | 3300035111 | Ga0373923_0080451 | Ga0373923_0080451_94_726 | 205 |
| 264 | 3300039438 | Ga0436360_0364414 | Ga0436360_0364414_1799_2470 | 205 |
| 265 | 3300039447 | Ga0436361_0213695 | Ga0436361_0213695_2442_3113 | 205 |
| 266 | 3300048929 | Ga0496126_0002227 | Ga0496126_0002227_13340_13975 | 205 |
| 267 | 3300053177 | Ga0500636_0009768 | Ga0500636_0009768_2951_3613 | 205 |
| 268 | 3300053177 | Ga0500636_0245015 | Ga0500636_0245015_133_777 | 205 |
| 269 | 3300005355 | Ga0070671_100722399 | Ga0070671_1007223992 | 206 |
| 270 | 3300005548 | Ga0070665_100486803 | Ga0070665_1004868031 | 206 |
| 271 | 3300025940 | Ga0207691_10539881 | Ga0207691_105398811 | 206 |
| 272 | 3300039437 | Ga0436365_1522619 | Ga0436365_1522619_833_1483 | 206 |
| 273 | 3300049742 | Ga0501080_0878199 | Ga0501080_0878199_91_717 | 206 |
| 274 | 3300049744 | Ga0501083_0381416 | Ga0501083_0381416_124_750 | 206 |
| 275 | 3300005295 | Ga0065707_10243856 | Ga0065707_102438561 | 207 |
| 276 | 3300005354 | Ga0070675_100291323 | Ga0070675_1002913232 | 207 |
| 277 | 3300005543 | Ga0070672_100288078 | Ga0070672_1002880782 | 207 |
| 278 | 3300006051 | Ga0075364_10139548 | Ga0075364_101395482 | 207 |
| 279 | 3300006195 | Ga0075366_10006588 | Ga0075366_100065884 | 207 |
| 280 | 3300006844 | Ga0075428_100009253 | Ga0075428_1000092531 | 207 |
| 281 | 3300006846 | Ga0075430_100012173 | Ga0075430_1000121739 | 207 |
| 282 | 3300006847 | Ga0075431_100001953 | Ga0075431_1000019532 | 207 |
| 283 | 3300009094 | Ga0111539_10000738 | Ga0111539_1000073840 | 207 |
| 284 | 3300009094 | Ga0111539_10320595 | Ga0111539_103205952 | 207 |
| 285 | 3300009147 | Ga0114129_10000066 | Ga0114129_1000006671 | 207 |
| 286 | 3300014968 | Ga0157379_10201161 | Ga0157379_102011612 | 207 |
| 287 | 3300025940 | Ga0207691_10357093 | Ga0207691_103570932 | 207 |
| 288 | 3300027907 | Ga0207428_10009685 | Ga0207428_100096858 | 207 |
| 289 | 3300027907 | Ga0207428_10264532 | Ga0207428_102645322 | 207 |
| 290 | 3300041408 | Ga0439453_0002403 | Ga0439453_0002403_1158_1793 | 207 |
| 291 | 3300042436 | Ga0439435_0071635 | Ga0439435_0071635_235_870 | 207 |
| 292 | 3300042439 | Ga0439464_0089113 | Ga0439464_0089113_154_789 | 207 |
| 293 | 3300048907 | Ga0496104_0005540 | Ga0496104_0005540_10117_10773 | 207 |
| 294 | 3300049572 | Ga0501036_0480833 | Ga0501036_0480833_62_745 | 207 |
| 295 | 3300050493 | nmdc:mga0k408_11727_c1 | nmdc:mga0k408_11727_c1_1862_2497 | 207 |
| 296 | 3300050496 | nmdc:mga07m45_180557_c1 | nmdc:mga07m45_180557_c1_119_754 | 207 |
| 297 | 3300050507 | nmdc:mga05p37_1072_c1 | nmdc:mga05p37_1072_c1_29776_30411 | 207 |
| 298 | 3300050509 | nmdc:mga0qj67_98121_c1 | nmdc:mga0qj67_98121_c1_247_882 | 207 |
| 299 | 3300050510 | nmdc:mga06r32_458_c1 | nmdc:mga06r32_458_c1_21741_22376 | 207 |
| 300 | 3300050511 | nmdc:mga08y16_3771_c1 | nmdc:mga08y16_3771_c1_12320_12955 | 207 |
| 301 | 3300005347 | Ga0070668_100904596 | Ga0070668_1009045961 | 208 |
| 302 | 3300005435 | Ga0070714_100027888 | Ga0070714_1000278883 | 208 |
| 303 | 3300005435 | Ga0070714_100102705 | Ga0070714_1001027053 | 208 |
| 304 | 3300005437 | Ga0070710_10069799 | Ga0070710_100697992 | 208 |
| 305 | 3300005981 | Ga0081538_10119520 | Ga0081538_101195202 | 208 |
| 306 | 3300005985 | Ga0081539_10003518 | Ga0081539_100035189 | 208 |
| 307 | 3300006028 | Ga0070717_10048895 | Ga0070717_100488953 | 208 |
| 308 | 3300006871 | Ga0075434_100126898 | Ga0075434_1001268983 | 208 |
| 309 | 3300006914 | Ga0075436_100513875 | Ga0075436_1005138751 | 208 |
| 310 | 3300009094 | Ga0111539_10370171 | Ga0111539_103701712 | 208 |
| 311 | 3300010375 | Ga0105239_10521684 | Ga0105239_105216842 | 208 |
| 312 | 3300013297 | Ga0157378_10731701 | Ga0157378_107317011 | 208 |
| 313 | 3300025898 | Ga0207692_10012729 | Ga0207692_100127292 | 208 |
| 314 | 3300025905 | Ga0207685_10044480 | Ga0207685_100444801 | 208 |
| 315 | 3300025906 | Ga0207699_10061074 | Ga0207699_100610742 | 208 |
| 316 | 3300025915 | Ga0207693_10010641 | Ga0207693_100106414 | 208 |
| 317 | 3300025916 | Ga0207663_10039429 | Ga0207663_100394292 | 208 |
| 318 | 3300025928 | Ga0207700_10007283 | Ga0207700_100072832 | 208 |
| 319 | 3300025928 | Ga0207700_10082668 | Ga0207700_100826682 | 208 |
| 320 | 3300025929 | Ga0207664_10015284 | Ga0207664_100152843 | 208 |
| 321 | 3300025929 | Ga0207664_10261761 | Ga0207664_102617612 | 208 |
| 322 | 3300025939 | Ga0207665_10009844 | Ga0207665_100098444 | 208 |
| 323 | 3300048904 | Ga0496101_0366390 | Ga0496101_0366390_156_827 | 208 |
| 324 | 3300048910 | Ga0496107_0222909 | Ga0496107_0222909_522_1193 | 208 |
| 325 | 3300048913 | Ga0496110_0438800 | Ga0496110_0438800_309_980 | 208 |
| 326 | 3300048929 | Ga0496126_0101280 | Ga0496126_0101280_1350_2006 | 208 |
| 327 | 3300049588 | Ga0501072_0206770 | Ga0501072_0206770_864_1547 | 208 |
| 328 | 3300049743 | Ga0501081_0233668 | Ga0501081_0233668_187_867 | 208 |
| 329 | 3300050489 | nmdc:mga03683_69359_c1 | nmdc:mga03683_69359_c1_221_916 | 208 |
| 330 | 3300050489 | nmdc:mga03683_8694_c1 | nmdc:mga03683_8694_c1_1849_2541 | 208 |
| 331 | 3300050493 | nmdc:mga0k408_371521_c1 | nmdc:mga0k408_371521_c1_144_836 | 208 |
| 332 | 3300050512 | nmdc:mga0n895_188745_c1 | nmdc:mga0n895_188745_c1_662_1333 | 208 |
| 333 | 3300050516 | nmdc:mga0sz30_1382_c2 | nmdc:mga0sz30_1382_c2_3400_4092 | 208 |
| 334 | 3300060353 | Ga0501082_0000038 | Ga0501082_0000038_70302_70943 | 208 |
| 335 | 3300061734 | Ga0530510_0246063 | Ga0530510_0246063_73_753 | 208 |
| 336 | 3300005331 | Ga0070670_100341469 | Ga0070670_1003414692 | 209 |
| 337 | 3300005335 | Ga0070666_10007822 | Ga0070666_100078225 | 209 |
| 338 | 3300005338 | Ga0068868_100212153 | Ga0068868_1002121532 | 209 |
| 339 | 3300005340 | Ga0070689_100070646 | Ga0070689_1000706462 | 209 |
| 340 | 3300005355 | Ga0070671_100054688 | Ga0070671_1000546882 | 209 |
| 341 | 3300005367 | Ga0070667_100019202 | Ga0070667_1000192026 | 209 |
| 342 | 3300005457 | Ga0070662_100203744 | Ga0070662_1002037442 | 209 |
| 343 | 3300005535 | Ga0070684_100094649 | Ga0070684_1000946492 | 209 |
| 344 | 3300005544 | Ga0070686_100015395 | Ga0070686_1000153952 | 209 |
| 345 | 3300005548 | Ga0070665_100296757 | Ga0070665_1002967572 | 209 |
| 346 | 3300005563 | Ga0068855_100161916 | Ga0068855_1001619162 | 209 |
| 347 | 3300005564 | Ga0070664_100029016 | Ga0070664_1000290162 | 209 |
| 348 | 3300005618 | Ga0068864_100017927 | Ga0068864_1000179277 | 209 |
| 349 | 3300005719 | Ga0068861_100493072 | Ga0068861_1004930722 | 209 |
| 350 | 3300005983 | Ga0081540_1006146 | Ga0081540_10061464 | 209 |
| 351 | 3300006237 | Ga0097621_100384174 | Ga0097621_1003841742 | 209 |
| 352 | 3300006358 | Ga0068871_100317150 | Ga0068871_1003171501 | 209 |
| 353 | 3300006846 | Ga0075430_100157895 | Ga0075430_1001578952 | 209 |
| 354 | 3300006880 | Ga0075429_100189038 | Ga0075429_1001890382 | 209 |
| 355 | 3300009093 | Ga0105240_10463334 | Ga0105240_104633341 | 209 |
| 356 | 3300009094 | Ga0111539_10011258 | Ga0111539_100112583 | 209 |
| 357 | 3300009098 | Ga0105245_10056795 | Ga0105245_100567952 | 209 |
| 358 | 3300009101 | Ga0105247_10154430 | Ga0105247_101544302 | 209 |
| 359 | 3300011119 | Ga0105246_10002911 | Ga0105246_100029112 | 209 |
| 360 | 3300013306 | Ga0163162_10254662 | Ga0163162_102546622 | 209 |
| 361 | 3300013308 | Ga0157375_10004170 | Ga0157375_100041704 | 209 |
| 362 | 3300014325 | Ga0163163_10130068 | Ga0163163_101300682 | 209 |
| 363 | 3300014968 | Ga0157379_10472790 | Ga0157379_104727902 | 209 |
| 364 | 3300014969 | Ga0157376_10253271 | Ga0157376_102532712 | 209 |
| 365 | 3300025900 | Ga0207710_10068985 | Ga0207710_100689852 | 209 |
| 366 | 3300025903 | Ga0207680_10143822 | Ga0207680_101438222 | 209 |
| 367 | 3300025913 | Ga0207695_10400739 | Ga0207695_104007392 | 209 |
| 368 | 3300025918 | Ga0207662_10227613 | Ga0207662_102276132 | 209 |
| 369 | 3300025924 | Ga0207694_10228986 | Ga0207694_102289862 | 209 |
| 370 | 3300025925 | Ga0207650_10566048 | Ga0207650_105660481 | 209 |
| 371 | 3300025936 | Ga0207670_10117060 | Ga0207670_101170602 | 209 |
| 372 | 3300025941 | Ga0207711_10055922 | Ga0207711_100559224 | 209 |
| 373 | 3300025949 | Ga0207667_10263950 | Ga0207667_102639502 | 209 |
| 374 | 3300025986 | Ga0207658_10121106 | Ga0207658_101211062 | 209 |
| 375 | 3300026023 | Ga0207677_10108897 | Ga0207677_101088972 | 209 |
| 376 | 3300026035 | Ga0207703_10496398 | Ga0207703_104963981 | 209 |
| 377 | 3300026088 | Ga0207641_10168052 | Ga0207641_101680522 | 209 |
| 378 | 3300026118 | Ga0207675_100297291 | Ga0207675_1002972912 | 209 |
| 379 | 3300028381 | Ga0268264_10431014 | Ga0268264_104310142 | 209 |
| 380 | 3300031730 | Ga0307516_10001689 | Ga0307516_1000168910 | 209 |
| 381 | 3300048911 | Ga0496108_0293393 | Ga0496108_0293393_402_1100 | 209 |
| 382 | 3300048912 | Ga0496109_0875009 | Ga0496109_0875009_72_770 | 209 |
| 383 | 3300048915 | Ga0496112_0004396 | Ga0496112_0004396_10791_11489 | 209 |
| 384 | 3300048916 | Ga0496113_0499072 | Ga0496113_0499072_201_899 | 209 |
| 385 | 3300049592 | Ga0501076_0108736 | Ga0501076_0108736_296_979 | 209 |
| 386 | 3300049593 | Ga0501077_0074876 | Ga0501077_0074876_419_1102 | 209 |
| 387 | 3300049743 | Ga0501081_0269933 | Ga0501081_0269933_47_730 | 209 |
| 388 | 3300049744 | Ga0501083_0015836 | Ga0501083_0015836_390_1043 | 209 |
| 389 | 3300050509 | nmdc:mga0qj67_91553_c1 | nmdc:mga0qj67_91553_c1_64_774 | 209 |
| 390 | 3300050511 | nmdc:mga08y16_24138_c1 | nmdc:mga08y16_24138_c1_938_1648 | 209 |
| 391 | 3300061734 | Ga0530510_0570622 | Ga0530510_0570622_95_778 | 209 |
| 392 | 3300005436 | Ga0070713_100444985 | Ga0070713_1004449852 | 210 |
| 393 | 3300005983 | Ga0081540_1044506 | Ga0081540_10445062 | 210 |
| 394 | 3300006038 | Ga0075365_10020959 | Ga0075365_100209594 | 210 |
| 395 | 3300006051 | Ga0075364_10049166 | Ga0075364_100491662 | 210 |
| 396 | 3300006844 | Ga0075428_100028270 | Ga0075428_1000282706 | 210 |
| 397 | 3300006847 | Ga0075431_100780565 | Ga0075431_1007805652 | 210 |
| 398 | 3300025928 | Ga0207700_10361957 | Ga0207700_103619572 | 210 |
| 399 | 3300031595 | Ga0265313_10056460 | Ga0265313_100564602 | 210 |
| 400 | 3300050492 | nmdc:mga0yw44_1495_c1 | nmdc:mga0yw44_1495_c1_3361_3993 | 210 |
| 401 | 3300050509 | nmdc:mga0qj67_229523_c1 | nmdc:mga0qj67_229523_c1_83_778 | 210 |
| 402 | 3300060353 | Ga0501082_0220648 | Ga0501082_0220648_958_1599 | 210 |
| 403 | 3300060353 | Ga0501082_0421149 | Ga0501082_0421149_356_1012 | 210 |
| 404 | 3300005365 | Ga0070688_100470697 | Ga0070688_1004706971 | 211 |
| 405 | 3300005843 | Ga0068860_100396868 | Ga0068860_1003968681 | 211 |
| 406 | 3300005983 | Ga0081540_1026123 | Ga0081540_10261232 | 211 |
| 407 | 3300006042 | Ga0075368_10096447 | Ga0075368_100964471 | 211 |
| 408 | 3300013296 | Ga0157374_11152836 | Ga0157374_111528362 | 211 |
| 409 | 3300013306 | Ga0163162_10491180 | Ga0163162_104911802 | 211 |
| 410 | 3300048909 | Ga0496106_0101315 | Ga0496106_0101315_105_773 | 211 |
| 411 | 3300048913 | Ga0496110_0026250 | Ga0496110_0026250_3176_3844 | 211 |
| 412 | 3300048918 | Ga0496115_0020878 | Ga0496115_0020878_1484_2152 | 211 |
| 413 | 3300049588 | Ga0501072_0017442 | Ga0501072_0017442_1498_2151 | 211 |
| 414 | 3300050495 | nmdc:mga04h51_100923_c1 | nmdc:mga04h51_100923_c1_290_964 | 211 |
| 415 | 3300050512 | nmdc:mga0n895_588117_c1 | nmdc:mga0n895_588117_c1_261_935 | 211 |
| 416 | 3300054114 | Ga0501084_0137295 | Ga0501084_0137295_1312_1962 | 211 |
| 417 | 3300002075 | JGI24738J21930_10013519 | JGI24738J21930_100135191 | 212 |
| 418 | 3300002244 | JGI24742J22300_10002527 | JGI24742J22300_100025273 | 212 |
| 419 | 3300002459 | JGI24751J29686_10012785 | JGI24751J29686_100127852 | 212 |
| 420 | 3300005329 | Ga0070683_100005456 | Ga0070683_1000054568 | 212 |
| 421 | 3300005329 | Ga0070683_100325727 | Ga0070683_1003257272 | 212 |
| 422 | 3300005330 | Ga0070690_100050904 | Ga0070690_1000509041 | 212 |
| 423 | 3300005331 | Ga0070670_100059809 | Ga0070670_1000598092 | 212 |
| 424 | 3300005335 | Ga0070666_10014598 | Ga0070666_100145982 | 212 |
| 425 | 3300005339 | Ga0070660_100101243 | Ga0070660_1001012432 | 212 |
| 426 | 3300005340 | Ga0070689_100019528 | Ga0070689_1000195281 | 212 |
| 427 | 3300005340 | Ga0070689_100209815 | Ga0070689_1002098152 | 212 |
| 428 | 3300005343 | Ga0070687_100001575 | Ga0070687_1000015756 | 212 |
| 429 | 3300005353 | Ga0070669_100205900 | Ga0070669_1002059002 | 212 |
| 430 | 3300005367 | Ga0070667_100104363 | Ga0070667_1001043632 | 212 |
| 431 | 3300005406 | Ga0070703_10021001 | Ga0070703_100210012 | 212 |
| 432 | 3300005436 | Ga0070713_100069688 | Ga0070713_1000696882 | 212 |
| 433 | 3300005436 | Ga0070713_100513604 | Ga0070713_1005136042 | 212 |
| 434 | 3300005438 | Ga0070701_10001746 | Ga0070701_100017467 | 212 |
| 435 | 3300005439 | Ga0070711_100049397 | Ga0070711_1000493973 | 212 |
| 436 | 3300005441 | Ga0070700_100191742 | Ga0070700_1001917422 | 212 |
| 437 | 3300005445 | Ga0070708_100049539 | Ga0070708_1000495392 | 212 |
| 438 | 3300005455 | Ga0070663_100040341 | Ga0070663_1000403412 | 212 |
| 439 | 3300005456 | Ga0070678_100124732 | Ga0070678_1001247321 | 212 |
| 440 | 3300005457 | Ga0070662_100635597 | Ga0070662_1006355971 | 212 |
| 441 | 3300005466 | Ga0070685_10009109 | Ga0070685_100091097 | 212 |
| 442 | 3300005467 | Ga0070706_100819125 | Ga0070706_1008191252 | 212 |
| 443 | 3300005468 | Ga0070707_100237479 | Ga0070707_1002374792 | 212 |
| 444 | 3300005518 | Ga0070699_100000717 | Ga0070699_1000007174 | 212 |
| 445 | 3300005518 | Ga0070699_100036672 | Ga0070699_1000366722 | 212 |
| 446 | 3300005535 | Ga0070684_100234321 | Ga0070684_1002343212 | 212 |
| 447 | 3300005539 | Ga0068853_100084749 | Ga0068853_1000847492 | 212 |
| 448 | 3300005543 | Ga0070672_100002423 | Ga0070672_1000024237 | 212 |
| 449 | 3300005544 | Ga0070686_100051639 | Ga0070686_1000516392 | 212 |
| 450 | 3300005548 | Ga0070665_100179628 | Ga0070665_1001796282 | 212 |
| 451 | 3300005548 | Ga0070665_100628769 | Ga0070665_1006287692 | 212 |
| 452 | 3300005549 | Ga0070704_100099533 | Ga0070704_1000995332 | 212 |
| 453 | 3300005563 | Ga0068855_100284905 | Ga0068855_1002849053 | 212 |
| 454 | 3300005564 | Ga0070664_100180645 | Ga0070664_1001806452 | 212 |
| 455 | 3300005577 | Ga0068857_100071066 | Ga0068857_1000710662 | 212 |
| 456 | 3300005578 | Ga0068854_100094741 | Ga0068854_1000947412 | 212 |
| 457 | 3300005614 | Ga0068856_100201123 | Ga0068856_1002011232 | 212 |
| 458 | 3300005617 | Ga0068859_100059542 | Ga0068859_1000595422 | 212 |
| 459 | 3300005618 | Ga0068864_100146926 | Ga0068864_1001469262 | 212 |
| 460 | 3300005618 | Ga0068864_100722170 | Ga0068864_1007221701 | 212 |
| 461 | 3300005719 | Ga0068861_100123913 | Ga0068861_1001239132 | 212 |
| 462 | 3300005834 | Ga0068851_10059535 | Ga0068851_100595352 | 212 |
| 463 | 3300005840 | Ga0068870_10013821 | Ga0068870_100138211 | 212 |
| 464 | 3300005842 | Ga0068858_100190548 | Ga0068858_1001905482 | 212 |
| 465 | 3300005843 | Ga0068860_100008518 | Ga0068860_1000085183 | 212 |
| 466 | 3300005937 | Ga0081455_10016316 | Ga0081455_100163164 | 212 |
| 467 | 3300006028 | Ga0070717_10400721 | Ga0070717_104007212 | 212 |
| 468 | 3300006038 | Ga0075365_10027361 | Ga0075365_100273612 | 212 |
| 469 | 3300006048 | Ga0075363_100317717 | Ga0075363_1003177172 | 212 |
| 470 | 3300006173 | Ga0070716_100234783 | Ga0070716_1002347831 | 212 |
| 471 | 3300006175 | Ga0070712_100001343 | Ga0070712_1000013438 | 212 |
| 472 | 3300006175 | Ga0070712_100014615 | Ga0070712_1000146154 | 212 |
| 473 | 3300006175 | Ga0070712_100259710 | Ga0070712_1002597102 | 212 |
| 474 | 3300006175 | Ga0070712_100308161 | Ga0070712_1003081612 | 212 |
| 475 | 3300006237 | Ga0097621_100008043 | Ga0097621_1000080435 | 212 |
| 476 | 3300006353 | Ga0075370_10025723 | Ga0075370_100257233 | 212 |
| 477 | 3300006844 | Ga0075428_100028529 | Ga0075428_1000285293 | 212 |
| 478 | 3300006844 | Ga0075428_100825653 | Ga0075428_1008256532 | 212 |
| 479 | 3300006847 | Ga0075431_100026428 | Ga0075431_1000264285 | 212 |
| 480 | 3300006871 | Ga0075434_100203965 | Ga0075434_1002039652 | 212 |
| 481 | 3300006871 | Ga0075434_100230744 | Ga0075434_1002307442 | 212 |
| 482 | 3300006880 | Ga0075429_100255844 | Ga0075429_1002558442 | 212 |
| 483 | 3300006881 | Ga0068865_100100265 | Ga0068865_1001002653 | 212 |
| 484 | 3300006914 | Ga0075436_100053515 | Ga0075436_1000535151 | 212 |
| 485 | 3300006914 | Ga0075436_100466644 | Ga0075436_1004666441 | 212 |
| 486 | 3300006931 | Ga0097620_100059542 | Ga0097620_1000595423 | 212 |
| 487 | 3300007076 | Ga0075435_100411046 | Ga0075435_1004110462 | 212 |
| 488 | 3300007265 | Ga0099794_10088432 | Ga0099794_100884322 | 212 |
| 489 | 3300007265 | Ga0099794_10104583 | Ga0099794_101045833 | 212 |
| 490 | 3300007788 | Ga0099795_10092521 | Ga0099795_100925212 | 212 |
| 491 | 3300009011 | Ga0105251_10081356 | Ga0105251_100813562 | 212 |
| 492 | 3300009093 | Ga0105240_10601656 | Ga0105240_106016561 | 212 |
| 493 | 3300009093 | Ga0105240_10729270 | Ga0105240_107292702 | 212 |
| 494 | 3300009094 | Ga0111539_10644208 | Ga0111539_106442082 | 212 |
| 495 | 3300009101 | Ga0105247_10160061 | Ga0105247_101600612 | 212 |
| 496 | 3300009147 | Ga0114129_10001660 | Ga0114129_100016609 | 212 |
| 497 | 3300009147 | Ga0114129_10006951 | Ga0114129_100069517 | 212 |
| 498 | 3300009147 | Ga0114129_10079963 | Ga0114129_100799634 | 212 |
| 499 | 3300009176 | Ga0105242_10333190 | Ga0105242_103331902 | 212 |
| 500 | 3300009177 | Ga0105248_10054219 | Ga0105248_100542192 | 212 |
| 501 | 3300009551 | Ga0105238_10016713 | Ga0105238_100167136 | 212 |
| 502 | 3300009551 | Ga0105238_10063079 | Ga0105238_100630793 | 212 |
| 503 | 3300009551 | Ga0105238_11395569 | Ga0105238_113955691 | 212 |
| 504 | 3300009553 | Ga0105249_10014702 | Ga0105249_100147025 | 212 |
| 505 | 3300010375 | Ga0105239_10083591 | Ga0105239_100835913 | 212 |
| 506 | 3300013296 | Ga0157374_10021511 | Ga0157374_100215113 | 212 |
| 507 | 3300013306 | Ga0163162_10340694 | Ga0163162_103406942 | 212 |
| 508 | 3300013306 | Ga0163162_10441334 | Ga0163162_104413342 | 212 |
| 509 | 3300013307 | Ga0157372_10510489 | Ga0157372_105104891 | 212 |
| 510 | 3300014325 | Ga0163163_10060794 | Ga0163163_100607942 | 212 |
| 511 | 3300014745 | Ga0157377_10008253 | Ga0157377_100082537 | 212 |
| 512 | 3300017792 | Ga0163161_10176237 | Ga0163161_101762372 | 212 |
| 513 | 3300021361 | Ga0213872_10047326 | Ga0213872_100473262 | 212 |
| 514 | 3300025315 | Ga0207697_10065121 | Ga0207697_100651212 | 212 |
| 515 | 3300025899 | Ga0207642_10024956 | Ga0207642_100249563 | 212 |
| 516 | 3300025900 | Ga0207710_10002725 | Ga0207710_100027254 | 212 |
| 517 | 3300025901 | Ga0207688_10002899 | Ga0207688_100028992 | 212 |
| 518 | 3300025905 | Ga0207685_10179596 | Ga0207685_101795961 | 212 |
| 519 | 3300025907 | Ga0207645_10078327 | Ga0207645_100783273 | 212 |
| 520 | 3300025908 | Ga0207643_10010894 | Ga0207643_100108944 | 212 |
| 521 | 3300025915 | Ga0207693_10003110 | Ga0207693_100031106 | 212 |
| 522 | 3300025915 | Ga0207693_10003660 | Ga0207693_100036607 | 212 |
| 523 | 3300025915 | Ga0207693_10069552 | Ga0207693_100695522 | 212 |
| 524 | 3300025915 | Ga0207693_10118075 | Ga0207693_101180752 | 212 |
| 525 | 3300025916 | Ga0207663_10024028 | Ga0207663_100240284 | 212 |
| 526 | 3300025918 | Ga0207662_10012930 | Ga0207662_100129304 | 212 |
| 527 | 3300025919 | Ga0207657_10023776 | Ga0207657_100237765 | 212 |
| 528 | 3300025923 | Ga0207681_10396750 | Ga0207681_103967501 | 212 |
| 529 | 3300025924 | Ga0207694_10080844 | Ga0207694_100808443 | 212 |
| 530 | 3300025928 | Ga0207700_10066662 | Ga0207700_100666623 | 212 |
| 531 | 3300025928 | Ga0207700_10374834 | Ga0207700_103748342 | 212 |
| 532 | 3300025931 | Ga0207644_10366151 | Ga0207644_103661512 | 212 |
| 533 | 3300025933 | Ga0207706_10006548 | Ga0207706_100065489 | 212 |
| 534 | 3300025934 | Ga0207686_10052111 | Ga0207686_100521112 | 212 |
| 535 | 3300025937 | Ga0207669_10103541 | Ga0207669_101035412 | 212 |
| 536 | 3300025938 | Ga0207704_10012670 | Ga0207704_100126703 | 212 |
| 537 | 3300025938 | Ga0207704_10275206 | Ga0207704_102752062 | 212 |
| 538 | 3300025938 | Ga0207704_10552667 | Ga0207704_105526671 | 212 |
| 539 | 3300025939 | Ga0207665_10090679 | Ga0207665_100906792 | 212 |
| 540 | 3300025940 | Ga0207691_10003357 | Ga0207691_100033579 | 212 |
| 541 | 3300025941 | Ga0207711_10021216 | Ga0207711_100212162 | 212 |
| 542 | 3300025941 | Ga0207711_10028224 | Ga0207711_100282242 | 212 |
| 543 | 3300025942 | Ga0207689_10006940 | Ga0207689_100069402 | 212 |
| 544 | 3300025944 | Ga0207661_10075743 | Ga0207661_100757433 | 212 |
| 545 | 3300025960 | Ga0207651_10049729 | Ga0207651_100497293 | 212 |
| 546 | 3300026023 | Ga0207677_10190094 | Ga0207677_101900942 | 212 |
| 547 | 3300026067 | Ga0207678_10020239 | Ga0207678_100202393 | 212 |
| 548 | 3300026075 | Ga0207708_10020532 | Ga0207708_100205323 | 212 |
| 549 | 3300026089 | Ga0207648_10009789 | Ga0207648_100097898 | 212 |
| 550 | 3300026116 | Ga0207674_10016631 | Ga0207674_100166316 | 212 |
| 551 | 3300026118 | Ga0207675_100035708 | Ga0207675_1000357084 | 212 |
| 552 | 3300026121 | Ga0207683_10004116 | Ga0207683_100041166 | 212 |
| 553 | 3300026121 | Ga0207683_10377477 | Ga0207683_103774772 | 212 |
| 554 | 3300027512 | Ga0209179_1016447 | Ga0209179_10164472 | 212 |
| 555 | 3300027512 | Ga0209179_1042443 | Ga0209179_10424431 | 212 |
| 556 | 3300027671 | Ga0209588_1081018 | Ga0209588_10810182 | 212 |
| 557 | 3300027907 | Ga0207428_10038770 | Ga0207428_100387704 | 212 |
| 558 | 3300028381 | Ga0268264_11071567 | Ga0268264_110715671 | 212 |
| 559 | 3300035111 | Ga0373923_0060006 | Ga0373923_0060006_75_716 | 212 |
| 560 | 3300035111 | Ga0373923_0179373 | Ga0373923_0179373_137_787 | 212 |
| 561 | 3300035113 | Ga0373936_0069859 | Ga0373936_0069859_465_1106 | 212 |
| 562 | 3300035113 | Ga0373936_0226874 | Ga0373936_0226874_41_694 | 212 |
| 563 | 3300035117 | Ga0373953_0076702 | Ga0373953_0076702_656_1306 | 212 |
| 564 | 3300035170 | Ga0373943_0006818 | Ga0373943_0006818_35_676 | 212 |
| 565 | 3300035170 | Ga0373943_0260670 | Ga0373943_0260670_254_895 | 212 |
| 566 | 3300035171 | Ga0373946_0041774 | Ga0373946_0041774_867_1520 | 212 |
| 567 | 3300035171 | Ga0373946_0046375 | Ga0373946_0046375_723_1364 | 212 |
| 568 | 3300035171 | Ga0373946_0216268 | Ga0373946_0216268_181_831 | 212 |
| 569 | 3300035241 | Ga0373961_0054874 | Ga0373961_0054874_391_1032 | 212 |
| 570 | 3300035691 | Ga0373931_0003811 | Ga0373931_0003811_3415_4056 | 212 |
| 571 | 3300035691 | Ga0373931_0041850 | Ga0373931_0041850_1490_2137 | 212 |
| 572 | 3300035692 | Ga0373935_0111923 | Ga0373935_0111923_781_1431 | 212 |
| 573 | 3300035695 | Ga0373927_0023442 | Ga0373927_0023442_964_1605 | 212 |
| 574 | 3300035695 | Ga0373927_0262302 | Ga0373927_0262302_285_956 | 212 |
| 575 | 3300035724 | Ga0373933_0038660 | Ga0373933_0038660_143_793 | 212 |
| 576 | 3300035725 | Ga0373947_0055198 | Ga0373947_0055198_1652_2293 | 212 |
| 577 | 3300035725 | Ga0373947_0337935 | Ga0373947_0337935_326_976 | 212 |
| 578 | 3300036401 | Ga0373937_0029738 | Ga0373937_0029738_4067_4717 | 212 |
| 579 | 3300036401 | Ga0373937_0094017 | Ga0373937_0094017_423_1064 | 212 |
| 580 | 3300037068 | Ga0373925_0135223 | Ga0373925_0135223_232_873 | 212 |
| 581 | 3300037418 | Ga0395900_0306356 | Ga0395900_0306356_658_1305 | 212 |
| 582 | 3300037853 | Ga0436364_0858723 | Ga0436364_0858723_56_697 | 212 |
| 583 | 3300038443 | Ga0395901_0145072 | Ga0395901_0145072_1435_2082 | 212 |
| 584 | 3300039447 | Ga0436361_0210879 | Ga0436361_0210879_4943_5590 | 212 |
| 585 | 3300041512 | Ga0451853_0775028 | Ga0451853_0775028_975_1613 | 212 |
| 586 | 3300046455 | Ga0495603_0271087 | Ga0495603_0271087_239_880 | 212 |
| 587 | 3300046457 | Ga0495590_0035320 | Ga0495590_0035320_397_1149 | 212 |
| 588 | 3300046459 | Ga0495629_0092226 | Ga0495629_0092226_1392_2039 | 212 |
| 589 | 3300046463 | Ga0495653_0012660 | Ga0495653_0012660_4367_5020 | 212 |
| 590 | 3300046472 | Ga0495580_0462668 | Ga0495580_0462668_176_817 | 212 |
| 591 | 3300046475 | Ga0495639_0030518 | Ga0495639_0030518_1385_2038 | 212 |
| 592 | 3300046476 | Ga0495662_0003605 | Ga0495662_0003605_3777_4430 | 212 |
| 593 | 3300046477 | Ga0495664_0000470 | Ga0495664_0000470_12002_12655 | 212 |
| 594 | 3300046513 | Ga0495616_0185918 | Ga0495616_0185918_184_831 | 212 |
| 595 | 3300046514 | Ga0495618_0002529 | Ga0495618_0002529_5688_6341 | 212 |
| 596 | 3300046514 | Ga0495618_0045054 | Ga0495618_0045054_1587_2237 | 212 |
| 597 | 3300046516 | Ga0495628_0266660 | Ga0495628_0266660_369_1010 | 212 |
| 598 | 3300046517 | Ga0495630_0012167 | Ga0495630_0012167_379_1032 | 212 |
| 599 | 3300046525 | Ga0495663_0105543 | Ga0495663_0105543_64_711 | 212 |
| 600 | 3300046529 | Ga0495652_0040999 | Ga0495652_0040999_957_1610 | 212 |
| 601 | 3300046531 | Ga0495665_0170716 | Ga0495665_0170716_322_975 | 212 |
| 602 | 3300046533 | Ga0495640_0063900 | Ga0495640_0063900_92_745 | 212 |
| 603 | 3300046536 | Ga0495587_0022150 | Ga0495587_0022150_814_1464 | 212 |
| 604 | 3300046537 | Ga0495598_0001623 | Ga0495598_0001623_3477_4118 | 212 |
| 605 | 3300046537 | Ga0495598_0037712 | Ga0495598_0037712_62_709 | 212 |
| 606 | 3300046542 | Ga0495597_0189544 | Ga0495597_0189544_121_768 | 212 |
| 607 | 3300046543 | Ga0495645_0024307 | Ga0495645_0024307_2202_2855 | 212 |
| 608 | 3300046543 | Ga0495645_0278167 | Ga0495645_0278167_330_980 | 212 |
| 609 | 3300046557 | Ga0495622_0069274 | Ga0495622_0069274_449_1090 | 212 |
| 610 | 3300046559 | Ga0495667_0029980 | Ga0495667_0029980_2571_3221 | 212 |
| 611 | 3300046559 | Ga0495667_0200899 | Ga0495667_0200899_462_1115 | 212 |
| 612 | 3300046615 | Ga0495656_0090592 | Ga0495656_0090592_100_741 | 212 |
| 613 | 3300046642 | Ga0495634_0004229 | Ga0495634_0004229_8841_9494 | 212 |
| 614 | 3300046642 | Ga0495634_0017525 | Ga0495634_0017525_2620_3273 | 212 |
| 615 | 3300046663 | Ga0495635_0000867 | Ga0495635_0000867_11463_12116 | 212 |
| 616 | 3300046664 | Ga0495659_0094622 | Ga0495659_0094622_312_953 | 212 |
| 617 | 3300046674 | Ga0495588_0277551 | Ga0495588_0277551_82_834 | 212 |
| 618 | 3300046678 | Ga0495599_0039406 | Ga0495599_0039406_1703_2353 | 212 |
| 619 | 3300046679 | Ga0495623_0097719 | Ga0495623_0097719_1131_1781 | 212 |
| 620 | 3300046680 | Ga0495646_0083260 | Ga0495646_0083260_31_681 | 212 |
| 621 | 3300046689 | Ga0495613_0076922 | Ga0495613_0076922_1574_2221 | 212 |
| 622 | 3300046691 | Ga0495670_0255100 | Ga0495670_0255100_207_848 | 212 |
| 623 | 3300046694 | Ga0495649_0104271 | Ga0495649_0104271_783_1421 | 212 |
| 624 | 3300046809 | Ga0495600_0339950 | Ga0495600_0339950_119_769 | 212 |
| 625 | 3300047315 | Ga0495581_0051698 | Ga0495581_0051698_354_1007 | 212 |
| 626 | 3300047317 | Ga0495604_0155548 | Ga0495604_0155548_622_1275 | 212 |
| 627 | 3300047317 | Ga0495604_0256999 | Ga0495604_0256999_268_918 | 212 |
| 628 | 3300047319 | Ga0495674_0014795 | Ga0495674_0014795_4078_4731 | 212 |
| 629 | 3300047321 | Ga0495676_0027638 | Ga0495676_0027638_2546_3187 | 212 |
| 630 | 3300047471 | Ga0495684_0042111 | Ga0495684_0042111_362_1015 | 212 |
| 631 | 3300047471 | Ga0495684_0091366 | Ga0495684_0091366_519_1166 | 212 |
| 632 | 3300047673 | Ga0495593_0051386 | Ga0495593_0051386_404_1057 | 212 |
| 633 | 3300047673 | Ga0495593_0085345 | Ga0495593_0085345_148_795 | 212 |
| 634 | 3300048088 | Ga0495602_0402147 | Ga0495602_0402147_10_660 | 212 |
| 635 | 3300048903 | Ga0496100_0000732 | Ga0496100_0000732_8460_9098 | 212 |
| 636 | 3300048904 | Ga0496101_0043904 | Ga0496101_0043904_1697_2344 | 212 |
| 637 | 3300048905 | Ga0496102_0012404 | Ga0496102_0012404_1337_1984 | 212 |
| 638 | 3300048905 | Ga0496102_0014870 | Ga0496102_0014870_5393_6031 | 212 |
| 639 | 3300048905 | Ga0496102_0062343 | Ga0496102_0062343_1851_2492 | 212 |
| 640 | 3300048906 | Ga0496103_0033054 | Ga0496103_0033054_1223_1870 | 212 |
| 641 | 3300048907 | Ga0496104_0021277 | Ga0496104_0021277_1542_2189 | 212 |
| 642 | 3300048907 | Ga0496104_0076846 | Ga0496104_0076846_1466_2104 | 212 |
| 643 | 3300048908 | Ga0496105_0016883 | Ga0496105_0016883_3704_4351 | 212 |
| 644 | 3300048909 | Ga0496106_0014703 | Ga0496106_0014703_4536_5174 | 212 |
| 645 | 3300048910 | Ga0496107_0006176 | Ga0496107_0006176_1205_1843 | 212 |
| 646 | 3300048910 | Ga0496107_0285951 | Ga0496107_0285951_536_1177 | 212 |
| 647 | 3300048911 | Ga0496108_0000822 | Ga0496108_0000822_19648_20295 | 212 |
| 648 | 3300048911 | Ga0496108_0043926 | Ga0496108_0043926_1042_1680 | 212 |
| 649 | 3300048912 | Ga0496109_0001115 | Ga0496109_0001115_15515_16162 | 212 |
| 650 | 3300048913 | Ga0496110_0021839 | Ga0496110_0021839_3533_4174 | 212 |
| 651 | 3300048913 | Ga0496110_0032798 | Ga0496110_0032798_997_1644 | 212 |
| 652 | 3300048913 | Ga0496110_0150019 | Ga0496110_0150019_930_1577 | 212 |
| 653 | 3300048913 | Ga0496110_0196993 | Ga0496110_0196993_277_915 | 212 |
| 654 | 3300048914 | Ga0496111_0003041 | Ga0496111_0003041_2613_3251 | 212 |
| 655 | 3300048914 | Ga0496111_0035832 | Ga0496111_0035832_1526_2173 | 212 |
| 656 | 3300048914 | Ga0496111_0138244 | Ga0496111_0138244_706_1353 | 212 |
| 657 | 3300048915 | Ga0496112_0001495 | Ga0496112_0001495_5695_6342 | 212 |
| 658 | 3300048915 | Ga0496112_0018494 | Ga0496112_0018494_4572_5210 | 212 |
| 659 | 3300048915 | Ga0496112_0664350 | Ga0496112_0664350_222_863 | 212 |
| 660 | 3300048916 | Ga0496113_0003524 | Ga0496113_0003524_7204_7851 | 212 |
| 661 | 3300048916 | Ga0496113_0041380 | Ga0496113_0041380_277_915 | 212 |
| 662 | 3300048917 | Ga0496114_0015030 | Ga0496114_0015030_4395_5033 | 212 |
| 663 | 3300048917 | Ga0496114_0020954 | Ga0496114_0020954_2674_3315 | 212 |
| 664 | 3300048918 | Ga0496115_0061380 | Ga0496115_0061380_1847_2494 | 212 |
| 665 | 3300048918 | Ga0496115_0067660 | Ga0496115_0067660_1066_1704 | 212 |
| 666 | 3300049743 | Ga0501081_0502410 | Ga0501081_0502410_248_892 | 212 |
| 667 | 3300050492 | nmdc:mga0yw44_98448_c1 | nmdc:mga0yw44_98448_c1_168_815 | 212 |
| 668 | 3300050494 | nmdc:mga06z11_214082_c1 | nmdc:mga06z11_214082_c1_248_889 | 212 |
| 669 | 3300050494 | nmdc:mga06z11_27431_c1 | nmdc:mga06z11_27431_c1_654_1295 | 212 |
| 670 | 3300050495 | nmdc:mga04h51_213639_c1 | nmdc:mga04h51_213639_c1_104_745 | 212 |
| 671 | 3300050496 | nmdc:mga07m45_30738_c1 | nmdc:mga07m45_30738_c1_1065_1706 | 212 |
| 672 | 3300050507 | nmdc:mga05p37_18171_c1 | nmdc:mga05p37_18171_c1_5750_6397 | 212 |
| 673 | 3300050507 | nmdc:mga05p37_4399_c1 | nmdc:mga05p37_4399_c1_11040_11687 | 212 |
| 674 | 3300050507 | nmdc:mga05p37_467604_c1 | nmdc:mga05p37_467604_c1_360_1007 | 212 |
| 675 | 3300050508 | nmdc:mga09592_146073_c1 | nmdc:mga09592_146073_c1_762_1409 | 212 |
| 676 | 3300050510 | nmdc:mga06r32_20124_c1 | nmdc:mga06r32_20124_c1_1288_1935 | 212 |
| 677 | 3300050512 | nmdc:mga0n895_1118069_c1 | nmdc:mga0n895_1118069_c1_19_666 | 212 |
| 678 | 3300050512 | nmdc:mga0n895_32503_c1 | nmdc:mga0n895_32503_c1_3878_4525 | 212 |
| 679 | 3300050513 | nmdc:mga0rr50_243265_c1 | nmdc:mga0rr50_243265_c1_461_1111 | 212 |
| 680 | 3300050516 | nmdc:mga0sz30_164682_c1 | nmdc:mga0sz30_164682_c1_51_692 | 212 |
| 681 | 3300053077 | Ga0495601_0045232 | Ga0495601_0045232_1868_2518 | 212 |
| 682 | 3300053077 | Ga0495601_0103176 | Ga0495601_0103176_844_1485 | 212 |
| 683 | 3300053077 | Ga0495601_0242278 | Ga0495601_0242278_47_688 | 212 |
| 684 | 3300053078 | Ga0495612_0011958 | Ga0495612_0011958_362_1015 | 212 |
| 685 | 3300053078 | Ga0495612_0122871 | Ga0495612_0122871_154_792 | 212 |
| 686 | 3300053084 | Ga0495595_0177475 | Ga0495595_0177475_295_945 | 212 |
| 687 | 3300053085 | Ga0495619_0031257 | Ga0495619_0031257_2697_3350 | 212 |
| 688 | 3300053085 | Ga0495619_0223507 | Ga0495619_0223507_185_832 | 212 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1x0t-assembly1.cif.gz_A | crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3 | 0.7738 | 25 | 76 |
| 1x0t-assembly1.cif.gz_A | crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3 | 0.3749 | 25 | 76 |
| 7wic-assembly1.cif.gz_R | cryo-em structure of the ss-14-bound human sstr2-gi1 complex | 0.3527 | 32 | 163 |
| 4reu-assembly1.cif.gz_B | revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli | 0.3311 | 23 | 182 |
| 4reu-assembly1.cif.gz_A-2 | revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli | 0.325 | 10 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9DC37_260_445_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3591 | 25 | 145 | 1.20.1250.20 |
| af_A4IDE9_223_375_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.3447 | 24 | 212 | 1.25.40.10 |
| af_A0A1D8PM72_154_256_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.3433 | 32 | 149 | 1.20.1280.290 |
| af_B6T9A5_232_433_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3431 | 24 | 183 | 1.20.1250.20 |
| af_P70600_859_1009_1.20.120.330 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases | 0.3352 | 24 | 167 | 1.20.120.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A554X8U7-F1-model_v4 | Prokaryotic cytochrome b561 | 0.9656 | 2 | 195 |
GO:0016020
|
| AF-A0A1S9CXQ3-F1-model_v4 | DUF962 domain-containing protein | 0.9638 | 1 | 195 |
GO:0016020
|
| AF-A0A5E7ZP03-F1-model_v4 | Membrane protein | 0.9627 | 2 | 190 |
GO:0016020
|
| AF-A0A221KAC2-F1-model_v4 | Membrane protein | 0.9572 | 3 | 196 |
GO:0016020
|
| AF-A0A2W4TTE2-F1-model_v4 | DUF962 domain-containing protein | 0.9569 | 1 | 197 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar