F475342

General Info

Members Datasets Scaffolds Average Seq Length
688 370 662 213

Family's Representative Sequence

Representative Sequence 3300046457|Ga0495590_0035320|Ga0495590_0035320_397_1149
Length 250
Sequence VSAAAAIQRRARGACSELSHRIHRIDITLTNAKGWNIMDRFLEALRVQRWDDHRYYHHSRINQSLHLLSAISFLFAYVMMFTDPALAALAGWLVAMTSRQIGHFFFEPKDYDVVNQASHEYKEEIKVGYNLQRKVVLMTIWALSPLPLYFDPTLFGIFTPHTGSLEFVRHVGLIWLVVGLGGLLFRTIQLFFTKDVQTGLVWATKILTDPFHDIKLYHKAPLYLMRGELIDPRLHADWIDEDAEEAPRAG

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
5 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
6 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
7 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
8 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
9 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
10 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
11 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
12 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
13 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
14 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
15 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
16 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
17 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
18 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
19 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
20 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
97 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
105 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
106 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
107 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
108 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
110 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
129 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
142 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
196 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
197 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
205 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
221 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
222 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
226 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
227 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
228 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
229 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
245 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
246 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
247 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
251 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
254 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
293 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
325 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
326 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
327 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
345 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
346 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
347 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
348 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
349 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
352 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
356 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
357 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
358 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
359 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
360 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
361 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
362 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
363 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
367 641522639 Methylobacterium sp. 4-46 Isolate Nodule
368 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
369 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
370 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.5
Metatranscriptomes 0
Isolates 3.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.69
Nodule 3.78
Rhizoplane 7.56
Rhizosphere 75.58
Stem 0
Stem Tuber 0
Unclassified 6.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10013519 3300002075 Bacteria 1763
2 JGI24742J22300_10002527 3300002244 Bacteria 2919
3 JGI24751J29686_10012785 3300002459 Bacteria 1732
4 JGI25406J46586_10083757 3300003203 Bacteria 973
5 Ga0065707_10082160 3300005295 Bacteria 20515
6 Ga0065707_10086978 3300005295 Bacteria 5211
7 Ga0065707_10243856 3300005295 Bacteria 1147
8 Ga0070683_100005456 3300005329 Bacteria 10626
9 Ga0070683_100325727 3300005329 Bacteria 1463
10 Ga0070690_100050904 3300005330 Bacteria 2642
11 Ga0070670_100029346 3300005331 Bacteria 4734
12 Ga0070670_100059809 3300005331 Bacteria 3271
13 Ga0070670_100341469 3300005331 Bacteria 1314
14 Ga0070666_10007822 3300005335 Bacteria 6601
15 Ga0070666_10014598 3300005335 Bacteria 5001
16 Ga0070666_10135376 3300005335 Bacteria 1714
17 Ga0068868_100212153 3300005338 Bacteria 1618
18 Ga0070660_100101243 3300005339 Bacteria 2283
19 Ga0070689_100019528 3300005340 Bacteria 5012
20 Ga0070689_100070646 3300005340 Bacteria 2726
21 Ga0070689_100209815 3300005340 Bacteria 1594
22 Ga0070687_100001575 3300005343 Bacteria 8111
23 Ga0070668_100008384 3300005347 Bacteria 7675
24 Ga0070668_100599329 3300005347 Bacteria 964
25 Ga0070668_100904596 3300005347 Bacteria 789
26 Ga0070669_100001489 3300005353 Bacteria 16923
27 Ga0070669_100205900 3300005353 Bacteria 1550
28 Ga0070675_100291323 3300005354 Bacteria 1437
29 Ga0070671_100001709 3300005355 Bacteria 16660
30 Ga0070671_100054688 3300005355 Bacteria 3319
31 Ga0070671_100722399 3300005355 Bacteria 865
32 Ga0070674_100355375 3300005356 Bacteria 1185
33 Ga0070688_100470697 3300005365 Bacteria 943
34 Ga0070667_100019202 3300005367 Bacteria 5668
35 Ga0070667_100024186 3300005367 Bacteria 5045
36 Ga0070667_100104363 3300005367 Bacteria 2452
37 Ga0070703_10021001 3300005406 Bacteria 1905
38 Ga0070709_10008191 3300005434 Bacteria 5739
39 Ga0070709_10142422 3300005434 Bacteria 1648
40 Ga0070714_100027888 3300005435 Bacteria 4679
41 Ga0070714_100102705 3300005435 Bacteria 2521
42 Ga0070713_100003459 3300005436 Bacteria 10428
43 Ga0070713_100069688 3300005436 Bacteria 2966
44 Ga0070713_100444985 3300005436 Bacteria 1216
45 Ga0070713_100513604 3300005436 Bacteria 1132
46 Ga0070710_10015742 3300005437 Bacteria 3834
47 Ga0070710_10069799 3300005437 Bacteria 2022
48 Ga0070701_10001746 3300005438 Bacteria 8180
49 Ga0070711_100042369 3300005439 Bacteria 3077
50 Ga0070711_100049397 3300005439 Bacteria 2881
51 Ga0070705_100303501 3300005440 Bacteria 1145
52 Ga0070700_100191742 3300005441 Bacteria 1429
53 Ga0070708_100028912 3300005445 Bacteria 4774
54 Ga0070708_100049539 3300005445 Bacteria 3716
55 Ga0070663_100040341 3300005455 Bacteria 3267
56 Ga0070678_100124732 3300005456 Bacteria 2036
57 Ga0070662_100203744 3300005457 Bacteria 1571
58 Ga0070662_100635597 3300005457 Bacteria 900
59 Ga0070681_10087284 3300005458 Bacteria 3073
60 Ga0070685_10009109 3300005466 Bacteria 5121
61 Ga0070706_100110008 3300005467 Bacteria 2564
62 Ga0070706_100819125 3300005467 Bacteria 861
63 Ga0070707_100237479 3300005468 Bacteria 1774
64 Ga0070699_100000717 3300005518 Bacteria 30798
65 Ga0070699_100036672 3300005518 Bacteria 4241
66 Ga0070679_100011913 3300005530 Bacteria 8300
67 Ga0070684_100094649 3300005535 Bacteria 2661
68 Ga0070684_100234321 3300005535 Bacteria 1677
69 Ga0070697_100156271 3300005536 Bacteria 1925
70 Ga0070697_100250049 3300005536 Bacteria 1516
71 Ga0070697_100677961 3300005536 Bacteria 909
72 Ga0068853_100084749 3300005539 Bacteria 2777
73 Ga0068853_100576132 3300005539 Bacteria 1068
74 Ga0070672_100002423 3300005543 Bacteria 11819
75 Ga0070672_100288078 3300005543 Bacteria 1390
76 Ga0070686_100015395 3300005544 Bacteria 4430
77 Ga0070686_100051639 3300005544 Bacteria 2618
78 Ga0070696_100432946 3300005546 Bacteria 1035
79 Ga0070665_100000878 3300005548 Bacteria 38691
80 Ga0070665_100179628 3300005548 Bacteria 2117
81 Ga0070665_100296757 3300005548 Bacteria 1619
82 Ga0070665_100486803 3300005548 Bacteria 1244
83 Ga0070665_100552463 3300005548 Bacteria 1164
84 Ga0070665_100628769 3300005548 Bacteria 1086
85 Ga0070704_100099533 3300005549 Bacteria 2187
86 Ga0068855_100158370 3300005563 Bacteria 2571
87 Ga0068855_100161916 3300005563 Bacteria 2539
88 Ga0068855_100165476 3300005563 Bacteria 2507
89 Ga0068855_100284905 3300005563 Bacteria 1833
90 Ga0070664_100029016 3300005564 Bacteria 4609
91 Ga0070664_100180645 3300005564 Bacteria 1875
92 Ga0068857_100071066 3300005577 Bacteria 3101
93 Ga0068854_100094741 3300005578 Bacteria 2227
94 Ga0068856_100024659 3300005614 Bacteria 5856
95 Ga0068856_100201123 3300005614 Bacteria 2007
96 Ga0068859_100059542 3300005617 Bacteria 3847
97 Ga0068864_100017927 3300005618 Bacteria 5906
98 Ga0068864_100146926 3300005618 Bacteria 2132
99 Ga0068864_100722170 3300005618 Bacteria 975
100 Ga0068866_10249146 3300005718 Bacteria 1086
101 Ga0068861_100020438 3300005719 Bacteria 4743
102 Ga0068861_100123913 3300005719 Bacteria 2088
103 Ga0068861_100493072 3300005719 Bacteria 1106
104 Ga0068851_10059535 3300005834 Bacteria 1954
105 Ga0068851_10235888 3300005834 Bacteria 1033
106 Ga0068870_10013821 3300005840 Bacteria 3801
107 Ga0068863_100005190 3300005841 Bacteria 12849
108 Ga0068858_100098872 3300005842 Bacteria 2720
109 Ga0068858_100190548 3300005842 Bacteria 1938
110 Ga0068860_100008518 3300005843 Bacteria 10217
111 Ga0068860_100034327 3300005843 Bacteria 4864
112 Ga0068860_100396868 3300005843 Bacteria 1364
113 Ga0068862_100038784 3300005844 Bacteria 4042
114 Ga0081455_10004816 3300005937 Bacteria 14997
115 Ga0081455_10016316 3300005937 Bacteria 7176
116 Ga0081455_10047841 3300005937 Bacteria 3700
117 Ga0081538_10119520 3300005981 Bacteria 1270
118 Ga0081540_1006146 3300005983 Bacteria 8814
119 Ga0081540_1026123 3300005983 Bacteria 3341
120 Ga0081540_1027834 3300005983 Bacteria 3191
121 Ga0081540_1044506 3300005983 Bacteria 2265
122 Ga0081540_1093159 3300005983 Bacteria 1320
123 Ga0081539_10003518 3300005985 Bacteria 19096
124 Ga0081539_10036773 3300005985 Bacteria 2924
125 Ga0070717_10048895 3300006028 Bacteria 3470
126 Ga0070717_10400721 3300006028 Bacteria 1233
127 Ga0070717_10690714 3300006028 Bacteria 927
128 Ga0075365_10020959 3300006038 Bacteria 4067
129 Ga0075365_10027361 3300006038 Bacteria 3628
130 Ga0075365_10110049 3300006038 Bacteria 1893
131 Ga0075368_10040532 3300006042 Bacteria 1829
132 Ga0075368_10096447 3300006042 Bacteria 1212
133 Ga0075363_100317717 3300006048 Bacteria 906
134 Ga0075364_10049166 3300006051 Bacteria 2750
135 Ga0075364_10139548 3300006051 Bacteria 1629
136 Ga0075364_10318966 3300006051 Bacteria 1058
137 Ga0070715_10352543 3300006163 Bacteria 804
138 Ga0070716_100161921 3300006173 Bacteria 1451
139 Ga0070716_100234783 3300006173 Bacteria 1240
140 Ga0070712_100001343 3300006175 Bacteria 14919
141 Ga0070712_100014615 3300006175 Bacteria 5038
142 Ga0070712_100165235 3300006175 Bacteria 1712
143 Ga0070712_100196549 3300006175 Bacteria 1581
144 Ga0070712_100245625 3300006175 Bacteria 1428
145 Ga0070712_100259710 3300006175 Bacteria 1391
146 Ga0070712_100308161 3300006175 Bacteria 1284
147 Ga0075362_10209003 3300006177 Bacteria 952
148 Ga0075369_10065649 3300006186 Bacteria 1591
149 Ga0075366_10006588 3300006195 Bacteria 6373
150 Ga0097621_100008043 3300006237 Bacteria 7571
151 Ga0097621_100384174 3300006237 Bacteria 1255
152 Ga0075370_10025723 3300006353 Bacteria 3256
153 Ga0075370_10350461 3300006353 Bacteria 882
154 Ga0068871_100317150 3300006358 Bacteria 1372
155 Ga0075428_100009253 3300006844 Bacteria 10926
156 Ga0075428_100028270 3300006844 Bacteria 6201
157 Ga0075428_100028529 3300006844 Bacteria 6175
158 Ga0075428_100825653 3300006844 Bacteria 985
159 Ga0075430_100012173 3300006846 Bacteria 7324
160 Ga0075430_100062697 3300006846 Bacteria 3122
161 Ga0075430_100157895 3300006846 Bacteria 1888
162 Ga0075431_100001953 3300006847 Bacteria 19671
163 Ga0075431_100026428 3300006847 Bacteria 5955
164 Ga0075431_100780565 3300006847 Bacteria 929
165 Ga0075434_100041554 3300006871 Bacteria 4555
166 Ga0075434_100126898 3300006871 Bacteria 2568
167 Ga0075434_100203965 3300006871 Bacteria 1998
168 Ga0075434_100230744 3300006871 Bacteria 1870
169 Ga0075429_100189038 3300006880 Bacteria 1805
170 Ga0075429_100255844 3300006880 Bacteria 1533
171 Ga0068865_100100265 3300006881 Bacteria 2119
172 Ga0075436_100053515 3300006914 Bacteria 2787
173 Ga0075436_100466644 3300006914 Bacteria 921
174 Ga0075436_100513875 3300006914 Bacteria 877
175 Ga0097620_100059542 3300006931 Bacteria 3847
176 Ga0099824_1005291 3300006942 Bacteria 18236
177 Ga0099822_1009136 3300006943 Bacteria 12548
178 Ga0075435_100411046 3300007076 Bacteria 1165
179 Ga0099794_10088432 3300007265 Bacteria 1535
180 Ga0099794_10104583 3300007265 Bacteria 1415
181 Ga0099795_10030859 3300007788 Bacteria 1842
182 Ga0099795_10066638 3300007788 Bacteria 1349
183 Ga0099795_10092521 3300007788 Bacteria 1174
184 Ga0105251_10001607 3300009011 Bacteria 19211
185 Ga0105251_10081356 3300009011 Bacteria 1496
186 Ga0105240_10463334 3300009093 Bacteria 1416
187 Ga0105240_10601656 3300009093 Bacteria 1210
188 Ga0105240_10729270 3300009093 Bacteria 1079
189 Ga0111539_10000738 3300009094 Bacteria 42458
190 Ga0111539_10011258 3300009094 Bacteria 11240
191 Ga0111539_10320595 3300009094 Bacteria 1803
192 Ga0111539_10370171 3300009094 Bacteria 1668
193 Ga0111539_10644208 3300009094 Bacteria 1234
194 Ga0105245_10056795 3300009098 Bacteria 3519
195 Ga0105245_10620426 3300009098 Bacteria 1109
196 Ga0105247_10154430 3300009101 Bacteria 1515
197 Ga0105247_10160061 3300009101 Bacteria 1490
198 Ga0105247_10282670 3300009101 Bacteria 1145
199 Ga0114129_10000066 3300009147 Bacteria 93802
200 Ga0114129_10001660 3300009147 Bacteria 30291
201 Ga0114129_10006951 3300009147 Bacteria 16099
202 Ga0114129_10079963 3300009147 Bacteria 4545
203 Ga0105242_10333190 3300009176 Bacteria 1396
204 Ga0105242_10744350 3300009176 Bacteria 964
205 Ga0105248_10003673 3300009177 Bacteria 16996
206 Ga0105248_10054219 3300009177 Bacteria 4496
207 Ga0105248_11075705 3300009177 Bacteria 909
208 Ga0105238_10016713 3300009551 Bacteria 7435
209 Ga0105238_10063079 3300009551 Bacteria 3706
210 Ga0105238_10128894 3300009551 Bacteria 2508
211 Ga0105238_10278341 3300009551 Bacteria 1654
212 Ga0105238_11395569 3300009551 Bacteria 728
213 Ga0105249_10014702 3300009553 Bacteria 6919
214 Ga0105249_10242254 3300009553 Bacteria 1783
215 Ga0099796_10052025 3300010159 Bacteria 1425
216 Ga0105239_10083591 3300010375 Bacteria 3516
217 Ga0105239_10417386 3300010375 Bacteria 1520
218 Ga0105239_10521684 3300010375 Bacteria 1351
219 Ga0105246_10002911 3300011119 Bacteria 10360
220 Ga0157370_10019448 3300013104 Bacteria 6812
221 Ga0157374_10021511 3300013296 Bacteria 5742
222 Ga0157374_10023190 3300013296 Bacteria 5545
223 Ga0157374_11152836 3300013296 Bacteria 796
224 Ga0157378_10731701 3300013297 Bacteria 1011
225 Ga0163162_10254662 3300013306 Bacteria 1887
226 Ga0163162_10340694 3300013306 Bacteria 1632
227 Ga0163162_10441334 3300013306 Bacteria 1434
228 Ga0163162_10491180 3300013306 Bacteria 1359
229 Ga0163162_10735479 3300013306 Bacteria 1106
230 Ga0157372_10510489 3300013307 Bacteria 1402
231 Ga0157375_10004170 3300013308 Bacteria 12545
232 Ga0163163_10054759 3300014325 Bacteria 3942
233 Ga0163163_10060794 3300014325 Bacteria 3742
234 Ga0163163_10130068 3300014325 Bacteria 2557
235 Ga0157380_10914808 3300014326 Bacteria 904
236 Ga0157377_10008253 3300014745 Bacteria 5071
237 Ga0157379_10000337 3300014968 Bacteria 37644
238 Ga0157379_10201161 3300014968 Bacteria 1801
239 Ga0157379_10472790 3300014968 Bacteria 1159
240 Ga0157376_10253271 3300014969 Bacteria 1646
241 Ga0163161_10176237 3300017792 Bacteria 1637
242 Ga0213872_10047326 3300021361 Bacteria 1956
243 Ga0213876_10255639 3300021384 Bacteria 931
244 Ga0213875_10000003 3300021388 Bacteria 719367
245 Ga0213875_10014516 3300021388 Bacteria 3842
246 Ga0209233_1001106 3300025261 Bacteria 11025
247 Ga0207697_10065121 3300025315 Bacteria 1520
248 Ga0207696_1000069 3300025711 Bacteria 227744
249 Ga0207713_1024593 3300025735 Bacteria 2804
250 Ga0207692_10012729 3300025898 Bacteria 3622
251 Ga0207692_10056398 3300025898 Bacteria 2015
252 Ga0207642_10024956 3300025899 Bacteria 2411
253 Ga0207642_10259968 3300025899 Bacteria 989
254 Ga0207710_10002725 3300025900 Bacteria 8091
255 Ga0207710_10068985 3300025900 Bacteria 1618
256 Ga0207688_10002899 3300025901 Bacteria 9323
257 Ga0207680_10143822 3300025903 Bacteria 1583
258 Ga0207647_10264749 3300025904 Bacteria 984
259 Ga0207685_10044480 3300025905 Bacteria 1679
260 Ga0207685_10179596 3300025905 Bacteria 980
261 Ga0207699_10002630 3300025906 Bacteria 8485
262 Ga0207699_10061074 3300025906 Bacteria 2266
263 Ga0207645_10078327 3300025907 Bacteria 2118
264 Ga0207643_10010894 3300025908 Bacteria 4904
265 Ga0207684_10060869 3300025910 Bacteria 3207
266 Ga0207684_10300491 3300025910 Bacteria 1384
267 Ga0207684_10371854 3300025910 Bacteria 1230
268 Ga0207707_10209679 3300025912 Bacteria 1697
269 Ga0207695_10254109 3300025913 Bacteria 1656
270 Ga0207695_10400739 3300025913 Bacteria 1256
271 Ga0207693_10003110 3300025915 Bacteria 14279
272 Ga0207693_10003660 3300025915 Bacteria 13116
273 Ga0207693_10009510 3300025915 Bacteria 7919
274 Ga0207693_10010641 3300025915 Bacteria 7464
275 Ga0207693_10069552 3300025915 Bacteria 2755
276 Ga0207693_10118075 3300025915 Bacteria 2083
277 Ga0207693_10179919 3300025915 Bacteria 1664
278 Ga0207693_10325227 3300025915 Bacteria 1204
279 Ga0207663_10024028 3300025916 Bacteria 3506
280 Ga0207663_10039429 3300025916 Bacteria 2862
281 Ga0207663_10839291 3300025916 Bacteria 733
282 Ga0207662_10012930 3300025918 Bacteria 4659
283 Ga0207662_10133272 3300025918 Bacteria 1568
284 Ga0207662_10227613 3300025918 Bacteria 1216
285 Ga0207657_10023776 3300025919 Bacteria 5698
286 Ga0207652_10236858 3300025921 Bacteria 1645
287 Ga0207681_10004621 3300025923 Bacteria 8464
288 Ga0207681_10396750 3300025923 Bacteria 1113
289 Ga0207694_10080844 3300025924 Bacteria 2551
290 Ga0207694_10228986 3300025924 Bacteria 1517
291 Ga0207694_10796247 3300025924 Bacteria 798
292 Ga0207650_10566048 3300025925 Bacteria 953
293 Ga0207659_10177489 3300025926 Bacteria 1685
294 Ga0207700_10007283 3300025928 Bacteria 6751
295 Ga0207700_10014254 3300025928 Bacteria 5202
296 Ga0207700_10066662 3300025928 Bacteria 2752
297 Ga0207700_10082668 3300025928 Bacteria 2511
298 Ga0207700_10361957 3300025928 Bacteria 1265
299 Ga0207700_10374834 3300025928 Bacteria 1243
300 Ga0207664_10015284 3300025929 Bacteria 5565
301 Ga0207664_10261761 3300025929 Bacteria 1513
302 Ga0207644_10000766 3300025931 Bacteria 20334
303 Ga0207644_10366151 3300025931 Bacteria 1173
304 Ga0207706_10006548 3300025933 Bacteria 10789
305 Ga0207686_10052111 3300025934 Bacteria 2552
306 Ga0207686_10622156 3300025934 Bacteria 852
307 Ga0207670_10117060 3300025936 Bacteria 1930
308 Ga0207669_10103541 3300025937 Bacteria 1888
309 Ga0207704_10012670 3300025938 Bacteria 4189
310 Ga0207704_10275206 3300025938 Bacteria 1277
311 Ga0207704_10552667 3300025938 Bacteria 936
312 Ga0207665_10009844 3300025939 Bacteria 6274
313 Ga0207665_10090679 3300025939 Bacteria 2119
314 Ga0207665_10164180 3300025939 Bacteria 1600
315 Ga0207691_10003357 3300025940 Bacteria 15574
316 Ga0207691_10357093 3300025940 Bacteria 1250
317 Ga0207691_10539881 3300025940 Bacteria 989
318 Ga0207711_10021216 3300025941 Bacteria 5425
319 Ga0207711_10028224 3300025941 Bacteria 4721
320 Ga0207711_10055922 3300025941 Bacteria 3389
321 Ga0207689_10006940 3300025942 Bacteria 9955
322 Ga0207661_10075743 3300025944 Bacteria 2762
323 Ga0207667_10235367 3300025949 Bacteria 1875
324 Ga0207667_10263950 3300025949 Bacteria 1761
325 Ga0207651_10049729 3300025960 Bacteria 2842
326 Ga0207668_10003508 3300025972 Bacteria 9212
327 Ga0207658_10121106 3300025986 Bacteria 2086
328 Ga0207677_10108897 3300026023 Bacteria 2058
329 Ga0207677_10190094 3300026023 Bacteria 1623
330 Ga0207703_10393635 3300026035 Bacteria 1284
331 Ga0207703_10496398 3300026035 Bacteria 1145
332 Ga0207678_10020239 3300026067 Bacteria 5841
333 Ga0207708_10020532 3300026075 Bacteria 4982
334 Ga0207702_10680116 3300026078 Bacteria 1013
335 Ga0207641_10002368 3300026088 Bacteria 17394
336 Ga0207641_10168052 3300026088 Bacteria 1999
337 Ga0207648_10009789 3300026089 Bacteria 9159
338 Ga0207674_10016631 3300026116 Bacteria 8043
339 Ga0207675_100027113 3300026118 Bacteria 5335
340 Ga0207675_100035708 3300026118 Bacteria 4636
341 Ga0207675_100297291 3300026118 Bacteria 1572
342 Ga0207683_10004116 3300026121 Bacteria 12575
343 Ga0207683_10377477 3300026121 Bacteria 1303
344 Ga0209589_1000169 3300027357 Bacteria 74106
345 Ga0209489_100493 3300027361 Bacteria 74106
346 Ga0209700_100497 3300027363 Bacteria 74106
347 Ga0209179_1016447 3300027512 Bacteria 1388
348 Ga0209179_1042443 3300027512 Bacteria 961
349 Ga0209588_1081018 3300027671 Bacteria 1048
350 Ga0207428_10009685 3300027907 Bacteria 8632
351 Ga0207428_10038770 3300027907 Bacteria 3871
352 Ga0207428_10264532 3300027907 Bacteria 1280
353 Ga0268266_10001045 3300028379 Bacteria 34723
354 Ga0268266_10439028 3300028379 Bacteria 1239
355 Ga0268265_10248672 3300028380 Bacteria 1573
356 Ga0268264_10027604 3300028381 Bacteria 4640
357 Ga0268264_10431014 3300028381 Bacteria 1273
358 Ga0268264_11071567 3300028381 Bacteria 814
359 Ga0265337_1033729 3300028556 Bacteria 1509
360 Ga0265318_10002991 3300028577 Bacteria 8732
361 Ga0265338_10040511 3300028800 Bacteria 4375
362 Ga0265332_10004192 3300031238 Bacteria 6824
363 Ga0265328_10002177 3300031239 Bacteria 8837
364 Ga0265329_10004078 3300031242 Bacteria 6203
365 Ga0265340_10018198 3300031247 Bacteria 3626
366 Ga0265339_10000560 3300031249 Bacteria 29070
367 Ga0265339_10089663 3300031249 Bacteria 1614
368 Ga0265331_10007385 3300031250 Bacteria 6363
369 Ga0265331_10088808 3300031250 Bacteria 1430
370 Ga0265316_10010754 3300031344 Bacteria 8313
371 Ga0265316_10450598 3300031344 Bacteria 923
372 Ga0307513_10318621 3300031456 Bacteria 1314
373 Ga0265313_10056460 3300031595 Bacteria 1857
374 Ga0265313_10113189 3300031595 Bacteria 1191
375 Ga0265314_10021351 3300031711 Bacteria 4979
376 Ga0265342_10024786 3300031712 Bacteria 3782
377 Ga0265342_10221330 3300031712 Bacteria 1020
378 Ga0307516_10001689 3300031730 Bacteria 30398
379 Ga0307412_10687239 3300031911 Bacteria 877
380 Ga0315911_1000010 3300033442 Bacteria 322197
381 Ga0373959_0033404 3300034820 Bacteria 1050
382 Ga0373923_0060006 3300035111 Bacteria 1614
383 Ga0373923_0080451 3300035111 Bacteria 1413
384 Ga0373923_0179373 3300035111 Bacteria 973
385 Ga0373936_0069859 3300035113 Bacteria 1446
386 Ga0373936_0226874 3300035113 Bacteria 830
387 Ga0373939_0084490 3300035114 Bacteria 1061
388 Ga0373953_0009911 3300035117 Bacteria 3300
389 Ga0373953_0076702 3300035117 Bacteria 1385
390 Ga0373954_0083020 3300035118 Bacteria 1533
391 Ga0373943_0006818 3300035170 Bacteria 5124
392 Ga0373943_0260670 3300035170 Bacteria 976
393 Ga0373946_0027806 3300035171 Bacteria 2240
394 Ga0373946_0041774 3300035171 Bacteria 1882
395 Ga0373946_0046375 3300035171 Bacteria 1801
396 Ga0373946_0216268 3300035171 Bacteria 924
397 Ga0373955_0131500 3300035172 Bacteria 1461
398 Ga0373961_0036898 3300035241 Bacteria 1394
399 Ga0373961_0054874 3300035241 Bacteria 1192
400 Ga0373924_0016771 3300035410 Bacteria 2801
401 Ga0373931_0003811 3300035691 Bacteria 6813
402 Ga0373931_0041850 3300035691 Bacteria 2408
403 Ga0373935_0111923 3300035692 Bacteria 1813
404 Ga0373927_0001542 3300035695 Bacteria 17306
405 Ga0373927_0023442 3300035695 Bacteria 4042
406 Ga0373927_0262302 3300035695 Bacteria 1136
407 Ga0373933_0000241 3300035724 Bacteria 35958
408 Ga0373933_0038660 3300035724 Bacteria 2804
409 Ga0373933_0088942 3300035724 Bacteria 1903
410 Ga0373947_0055198 3300035725 Bacteria 2398
411 Ga0373947_0337935 3300035725 Bacteria 1009
412 Ga0373937_0000443 3300036401 Bacteria 38365
413 Ga0373937_0004815 3300036401 Bacteria 11472
414 Ga0373937_0029738 3300036401 Bacteria 4949
415 Ga0373937_0094017 3300036401 Bacteria 2780
416 Ga0373925_0135223 3300037068 Bacteria 1926
417 Ga0395900_0306356 3300037418 Bacteria 1573
418 Ga0395905_0189760 3300037471 Bacteria 1928
419 Ga0436364_0010210 3300037853 Bacteria 5361
420 Ga0436364_0645586 3300037853 Bacteria 957
421 Ga0436364_0693200 3300037853 Bacteria 3616
422 Ga0436364_0858723 3300037853 Bacteria 883
423 Ga0436364_0875435 3300037853 Bacteria 49936
424 Ga0395901_0145072 3300038443 Bacteria 2495
425 Ga0436365_0464318 3300039437 Bacteria 4661
426 Ga0436365_0650883 3300039437 Bacteria 1467
427 Ga0436365_1522619 3300039437 Bacteria 2033
428 Ga0436365_1878830 3300039437 Bacteria 1402
429 Ga0436360_0364414 3300039438 Bacteria 19147
430 Ga0436360_0651179 3300039438 Bacteria 810
431 Ga0436361_0210879 3300039447 Bacteria 17162
432 Ga0436361_0213695 3300039447 Bacteria 9267
433 Ga0436363_1328344 3300039450 Bacteria 1394
434 Ga0436363_1586335 3300039450 Bacteria 1078
435 Ga0439453_0002403 3300041408 Bacteria 2581
436 Ga0451853_0208434 3300041512 Bacteria 1846
437 Ga0451853_0775028 3300041512 Bacteria 1814
438 Ga0451853_2874200 3300041512 Bacteria 2182
439 Ga0439445_0078464 3300042004 Bacteria 921
440 Ga0439435_0071635 3300042436 Bacteria 1027
441 Ga0439464_0089113 3300042439 Bacteria 928
442 Ga0439464_0153295 3300042439 Bacteria 722
443 Ga0466969_0133123 3300044656 Bacteria 1152
444 Ga0495603_0003868 3300046455 Bacteria 8914
445 Ga0495603_0271087 3300046455 Bacteria 976
446 Ga0495590_0035320 3300046457 Bacteria 1746
447 Ga0495629_0092226 3300046459 Bacteria 2114
448 Ga0495638_0001008 3300046460 Bacteria 28102
449 Ga0495638_0143486 3300046460 Bacteria 1391
450 Ga0495653_0012660 3300046463 Bacteria 6890
451 Ga0495650_0039296 3300046471 Bacteria 2043
452 Ga0495580_0462668 3300046472 Bacteria 850
453 Ga0495639_0030518 3300046475 Bacteria 2396
454 Ga0495662_0003605 3300046476 Bacteria 7810
455 Ga0495664_0000470 3300046477 Bacteria 19968
456 Ga0495583_0000030 3300046506 Bacteria 254970
457 Ga0495616_0185918 3300046513 Bacteria 921
458 Ga0495618_0002529 3300046514 Bacteria 11712
459 Ga0495618_0045054 3300046514 Bacteria 2782
460 Ga0495628_0266660 3300046516 Bacteria 1275
461 Ga0495630_0012167 3300046517 Bacteria 6241
462 Ga0495630_0131397 3300046517 Bacteria 1901
463 Ga0495663_0105543 3300046525 Bacteria 932
464 Ga0495652_0040999 3300046529 Bacteria 3999
465 Ga0495665_0170716 3300046531 Bacteria 1132
466 Ga0495640_0063900 3300046533 Bacteria 2490
467 Ga0495587_0022150 3300046536 Bacteria 3914
468 Ga0495598_0001623 3300046537 Bacteria 4507
469 Ga0495598_0037712 3300046537 Bacteria 1395
470 Ga0495597_0189544 3300046542 Bacteria 828
471 Ga0495645_0024307 3300046543 Bacteria 4395
472 Ga0495645_0278167 3300046543 Bacteria 1102
473 Ga0495622_0069274 3300046557 Bacteria 1629
474 Ga0495667_0029980 3300046559 Bacteria 3658
475 Ga0495667_0200899 3300046559 Bacteria 1276
476 Ga0495656_0090592 3300046615 Bacteria 1398
477 Ga0495634_0004229 3300046642 Bacteria 11333
478 Ga0495634_0017525 3300046642 Bacteria 5107
479 Ga0495625_0005241 3300046660 Bacteria 11930
480 Ga0495635_0000867 3300046663 Bacteria 19857
481 Ga0495659_0094622 3300046664 Bacteria 1151
482 Ga0495661_0045282 3300046665 Bacteria 2692
483 Ga0495588_0277551 3300046674 Bacteria 883
484 Ga0495599_0039406 3300046678 Bacteria 2969
485 Ga0495623_0097719 3300046679 Bacteria 1793
486 Ga0495646_0083260 3300046680 Bacteria 1860
487 Ga0495647_0243790 3300046681 Bacteria 799
488 Ga0495613_0076922 3300046689 Bacteria 2428
489 Ga0495670_0007381 3300046691 Bacteria 5404
490 Ga0495670_0255100 3300046691 Bacteria 935
491 Ga0495649_0104271 3300046694 Bacteria 1506
492 Ga0495600_0339950 3300046809 Bacteria 941
493 Ga0495581_0051698 3300047315 Bacteria 2373
494 Ga0495604_0155548 3300047317 Bacteria 1620
495 Ga0495604_0256999 3300047317 Bacteria 1189
496 Ga0495674_0014795 3300047319 Bacteria 7299
497 Ga0495672_0024237 3300047320 Bacteria 3913
498 Ga0495672_0070699 3300047320 Bacteria 1977
499 Ga0495676_0027638 3300047321 Bacteria 4861
500 Ga0495675_0038586 3300047444 Bacteria 3041
501 Ga0495684_0042111 3300047471 Bacteria 3498
502 Ga0495684_0091366 3300047471 Bacteria 2306
503 Ga0495684_0175165 3300047471 Bacteria 1593
504 Ga0495686_0000811 3300047472 Bacteria 40468
505 Ga0495686_0007753 3300047472 Bacteria 7997
506 Ga0495593_0051386 3300047673 Bacteria 2181
507 Ga0495593_0085345 3300047673 Bacteria 1629
508 Ga0495602_0402147 3300048088 Bacteria 976
509 Ga0496100_0000732 3300048903 Bacteria 15681
510 Ga0496100_0292383 3300048903 Bacteria 1217
511 Ga0496101_0043904 3300048904 Bacteria 3196
512 Ga0496101_0366390 3300048904 Bacteria 1133
513 Ga0496102_0012404 3300048905 Bacteria 7374
514 Ga0496102_0014870 3300048905 Bacteria 6770
515 Ga0496102_0062343 3300048905 Bacteria 3414
516 Ga0496102_0235571 3300048905 Bacteria 1726
517 Ga0496103_0033054 3300048906 Bacteria 3159
518 Ga0496104_0000206 3300048907 Bacteria 52627
519 Ga0496104_0005540 3300048907 Bacteria 11059
520 Ga0496104_0021277 3300048907 Bacteria 5952
521 Ga0496104_0076846 3300048907 Bacteria 3180
522 Ga0496105_0016883 3300048908 Bacteria 5840
523 Ga0496106_0014703 3300048909 Bacteria 5785
524 Ga0496106_0101315 3300048909 Bacteria 2234
525 Ga0496107_0006176 3300048910 Bacteria 8229
526 Ga0496107_0222909 3300048910 Bacteria 1403
527 Ga0496107_0285951 3300048910 Bacteria 1227
528 Ga0496108_0000822 3300048911 Bacteria 24137
529 Ga0496108_0043926 3300048911 Bacteria 3732
530 Ga0496108_0293393 3300048911 Bacteria 1416
531 Ga0496108_0795824 3300048911 Bacteria 816
532 Ga0496109_0001115 3300048912 Bacteria 22294
533 Ga0496109_0045438 3300048912 Bacteria 3986
534 Ga0496109_0875009 3300048912 Bacteria 836
535 Ga0496110_0021839 3300048913 Bacteria 5427
536 Ga0496110_0026250 3300048913 Bacteria 4982
537 Ga0496110_0032798 3300048913 Bacteria 4489
538 Ga0496110_0150019 3300048913 Bacteria 2110
539 Ga0496110_0196993 3300048913 Bacteria 1829
540 Ga0496110_0438800 3300048913 Bacteria 1190
541 Ga0496111_0003041 3300048914 Bacteria 10287
542 Ga0496111_0035832 3300048914 Bacteria 3547
543 Ga0496111_0138244 3300048914 Bacteria 1805
544 Ga0496112_0001495 3300048915 Bacteria 18003
545 Ga0496112_0004396 3300048915 Bacteria 11925
546 Ga0496112_0018494 3300048915 Bacteria 6561
547 Ga0496112_0664350 3300048915 Bacteria 971
548 Ga0496113_0003524 3300048916 Bacteria 9393
549 Ga0496113_0041380 3300048916 Bacteria 3400
550 Ga0496113_0499072 3300048916 Bacteria 977
551 Ga0496114_0015030 3300048917 Bacteria 6223
552 Ga0496114_0020954 3300048917 Bacteria 5310
553 Ga0496115_0010899 3300048918 Bacteria 6805
554 Ga0496115_0020878 3300048918 Bacteria 5055
555 Ga0496115_0061380 3300048918 Bacteria 3030
556 Ga0496115_0067660 3300048918 Bacteria 2889
557 Ga0496115_0164267 3300048918 Bacteria 1836
558 Ga0496115_0175129 3300048918 Bacteria 1774
559 Ga0496115_0207488 3300048918 Bacteria 1618
560 Ga0496116_0269129 3300048919 Bacteria 834
561 Ga0496118_0027055 3300048921 Bacteria 4864
562 Ga0496118_0041510 3300048921 Bacteria 3641
563 Ga0496119_0008671 3300048922 Bacteria 8891
564 Ga0496119_0140041 3300048922 Bacteria 1307
565 Ga0496120_0069541 3300048923 Bacteria 1939
566 Ga0496121_0000923 3300048924 Bacteria 53102
567 Ga0496121_0008770 3300048924 Bacteria 11796
568 Ga0496121_0183637 3300048924 Bacteria 1507
569 Ga0496123_0137237 3300048926 Bacteria 1344
570 Ga0496123_0222752 3300048926 Bacteria 950
571 Ga0496124_0089663 3300048927 Bacteria 2510
572 Ga0496124_0224791 3300048927 Bacteria 1409
573 Ga0496125_0055387 3300048928 Bacteria 3231
574 Ga0496125_0065358 3300048928 Bacteria 2882
575 Ga0496126_0002227 3300048929 Bacteria 26819
576 Ga0496126_0069530 3300048929 Bacteria 3140
577 Ga0496126_0101280 3300048929 Bacteria 2520
578 Ga0496126_0368407 3300048929 Bacteria 1172
579 Ga0496126_0450369 3300048929 Bacteria 1036
580 Ga0501031_0421220 3300049568 Bacteria 863
581 Ga0501036_0480833 3300049572 Bacteria 1034
582 Ga0501046_0164933 3300049580 Bacteria 1664
583 Ga0501046_0205092 3300049580 Bacteria 1466
584 Ga0501047_0222923 3300049581 Bacteria 1741
585 Ga0501072_0017442 3300049588 Bacteria 5516
586 Ga0501072_0206770 3300049588 Bacteria 1565
587 Ga0501076_0108736 3300049592 Bacteria 2240
588 Ga0501077_0074876 3300049593 Bacteria 2144
589 Ga0501079_0380106 3300049741 Bacteria 1107
590 Ga0501080_0878199 3300049742 Bacteria 783
591 Ga0501081_0054244 3300049743 Bacteria 2770
592 Ga0501081_0233668 3300049743 Bacteria 1340
593 Ga0501081_0269933 3300049743 Bacteria 1244
594 Ga0501081_0502410 3300049743 Bacteria 904
595 Ga0501083_0015836 3300049744 Bacteria 5278
596 Ga0501083_0381416 3300049744 Bacteria 917
597 Ga0501045_0014870 3300049824 Bacteria 5520
598 nmdc:mga03683_11845_c2 3300050489 Bacteria 2660
599 nmdc:mga03683_69359_c1 3300050489 Bacteria 1504
600 nmdc:mga03683_8694_c1 3300050489 Bacteria 3579
601 nmdc:mga03n38_149464_c1 3300050490 Bacteria 1174
602 nmdc:mga0yw44_1495_c1 3300050492 Bacteria 6905
603 nmdc:mga0yw44_9814_c1 3300050492 Bacteria 4861
604 nmdc:mga0yw44_98448_c1 3300050492 Bacteria 1859
605 nmdc:mga0k408_11727_c1 3300050493 Bacteria 4780
606 nmdc:mga0k408_371521_c1 3300050493 Bacteria 852
607 nmdc:mga0k408_5327_c1 3300050493 Bacteria 6832
608 nmdc:mga06z11_14848_c1 3300050494 Bacteria 3461
609 nmdc:mga06z11_214082_c1 3300050494 Bacteria 1124
610 nmdc:mga06z11_27431_c1 3300050494 Bacteria 2722
611 nmdc:mga06z11_32286_c1 3300050494 Bacteria 2552
612 nmdc:mga06z11_89510_c1 3300050494 Bacteria 1668
613 nmdc:mga04h51_100923_c1 3300050495 Bacteria 1051
614 nmdc:mga04h51_213639_c1 3300050495 Bacteria 762
615 nmdc:mga07m45_180557_c1 3300050496 Bacteria 1227
616 nmdc:mga07m45_30738_c1 3300050496 Bacteria 2975
617 nmdc:mga07m45_324956_c1 3300050496 Bacteria 894
618 nmdc:mga07m45_83547_c1 3300050496 Bacteria 1825
619 nmdc:mga05p37_1072_c1 3300050507 Bacteria 31317
620 nmdc:mga05p37_18171_c1 3300050507 Bacteria 8496
621 nmdc:mga05p37_4399_c1 3300050507 Bacteria 16466
622 nmdc:mga05p37_467604_c1 3300050507 Bacteria 1456
623 nmdc:mga09592_146073_c1 3300050508 Bacteria 2039
624 nmdc:mga0qj67_170347_c1 3300050509 Bacteria 1768
625 nmdc:mga0qj67_229523_c1 3300050509 Bacteria 1506
626 nmdc:mga0qj67_91553_c1 3300050509 Bacteria 2444
627 nmdc:mga0qj67_98121_c1 3300050509 Bacteria 2360
628 nmdc:mga06r32_20124_c1 3300050510 Bacteria 6139
629 nmdc:mga06r32_458_c1 3300050510 Bacteria 34859
630 nmdc:mga08y16_24138_c1 3300050511 Bacteria 6420
631 nmdc:mga08y16_3771_c1 3300050511 Bacteria 15779
632 nmdc:mga0n895_1118069_c1 3300050512 Bacteria 765
633 nmdc:mga0n895_188745_c1 3300050512 Bacteria 2092
634 nmdc:mga0n895_32503_c1 3300050512 Bacteria 5008
635 nmdc:mga0n895_588117_c1 3300050512 Bacteria 1116
636 nmdc:mga0rr50_174553_c1 3300050513 Bacteria 1753
637 nmdc:mga0rr50_243265_c1 3300050513 Bacteria 1492
638 nmdc:mga0sz30_1382_c2 3300050516 Bacteria 8451
639 nmdc:mga0sz30_164682_c1 3300050516 Bacteria 982
640 nmdc:mga0sz30_56311_c1 3300050516 Bacteria 1674
641 nmdc:mga0sz30_85955_c1 3300050516 Bacteria 1365
642 Ga0495601_0045232 3300053077 Bacteria 2767
643 Ga0495601_0103176 3300053077 Bacteria 1843
644 Ga0495601_0242278 3300053077 Bacteria 1177
645 Ga0495612_0011958 3300053078 Bacteria 3498
646 Ga0495612_0036385 3300053078 Bacteria 1998
647 Ga0495612_0122871 3300053078 Bacteria 1118
648 Ga0495595_0177475 3300053084 Bacteria 1055
649 Ga0495619_0031257 3300053085 Bacteria 3449
650 Ga0495619_0223507 3300053085 Bacteria 1304
651 Ga0500555_000310 3300053103 Bacteria 20978
652 Ga0500559_0014141 3300053136 Bacteria 3374
653 Ga0500568_0028671 3300053139 Bacteria 2319
654 Ga0500636_0009768 3300053177 Bacteria 5589
655 Ga0500636_0245015 3300053177 Bacteria 918
656 Ga0500552_000141 3300053733 Bacteria 6206
657 Ga0501084_0137295 3300054114 Bacteria 2058
658 Ga0501082_0000038 3300060353 Bacteria 94168
659 Ga0501082_0220648 3300060353 Bacteria 1650
660 Ga0501082_0421149 3300060353 Bacteria 1166
661 Ga0530510_0246063 3300061734 Bacteria 1332
662 Ga0530510_0570622 3300061734 Bacteria 860

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10110049 Ga0075365_101100493 193
2 3300006353 Ga0075370_10350461 Ga0075370_103504611 193
3 3300050496 nmdc:mga07m45_324956_c1 nmdc:mga07m45_324956_c1_23_679 193
4 3300005331 Ga0070670_100029346 Ga0070670_1000293462 194
5 3300005335 Ga0070666_10135376 Ga0070666_101353762 194
6 3300005347 Ga0070668_100008384 Ga0070668_1000083845 194
7 3300005353 Ga0070669_100001489 Ga0070669_10000148916 194
8 3300005355 Ga0070671_100001709 Ga0070671_1000017097 194
9 3300005367 Ga0070667_100024186 Ga0070667_1000241864 194
10 3300005548 Ga0070665_100000878 Ga0070665_10000087817 194
11 3300005841 Ga0068863_100005190 Ga0068863_1000051904 194
12 3300005842 Ga0068858_100098872 Ga0068858_1000988724 194
13 3300005843 Ga0068860_100034327 Ga0068860_1000343276 194
14 3300005844 Ga0068862_100038784 Ga0068862_1000387845 194
15 3300006871 Ga0075434_100041554 Ga0075434_1000415542 194
16 3300009011 Ga0105251_10001607 Ga0105251_100016071 194
17 3300009177 Ga0105248_10003673 Ga0105248_1000367313 194
18 3300009553 Ga0105249_10242254 Ga0105249_102422542 194
19 3300025735 Ga0207713_1024593 Ga0207713_10245933 194
20 3300025923 Ga0207681_10004621 Ga0207681_100046212 194
21 3300025931 Ga0207644_10000766 Ga0207644_1000076614 194
22 3300025972 Ga0207668_10003508 Ga0207668_100035086 194
23 3300026035 Ga0207703_10393635 Ga0207703_103936352 194
24 3300026088 Ga0207641_10002368 Ga0207641_100023689 194
25 3300028379 Ga0268266_10001045 Ga0268266_1000104514 194
26 3300028380 Ga0268265_10248672 Ga0268265_102486722 194
27 3300028381 Ga0268264_10027604 Ga0268264_100276042 194
28 3300048905 Ga0496102_0235571 Ga0496102_0235571_129_764 194
29 3300048919 Ga0496116_0269129 Ga0496116_0269129_175_810 194
30 3300048921 Ga0496118_0041510 Ga0496118_0041510_334_969 194
31 3300048922 Ga0496119_0140041 Ga0496119_0140041_553_1188 194
32 3300048924 Ga0496121_0008770 Ga0496121_0008770_947_1582 194
33 3300048926 Ga0496123_0137237 Ga0496123_0137237_604_1239 194
34 3300048927 Ga0496124_0224791 Ga0496124_0224791_158_793 194
35 3300048928 Ga0496125_0065358 Ga0496125_0065358_1759_2394 194
36 3300046506 Ga0495583_0000030 Ga0495583_0000030_218984_219616 195
37 3300046665 Ga0495661_0045282 Ga0495661_0045282_85_717 195
38 3300046691 Ga0495670_0007381 Ga0495670_0007381_1417_2049 195
39 3300048926 Ga0496123_0222752 Ga0496123_0222752_152_784 195
40 3300053103 Ga0500555_000310 Ga0500555_000310_15524_16156 195
41 3300005937 Ga0081455_10047841 Ga0081455_100478414 196
42 3300047472 Ga0495686_0000811 Ga0495686_0000811_5603_6238 196
43 iso_pu_bacteria 2513237096 2513655074 196
44 iso_pu_bacteria 2513237137 2513861094 196
45 iso_pu_bacteria 2513237145 2513915903 196
46 iso_pu_bacteria 2517572143 2517894792 196
47 iso_pu_bacteria 2667528175 2671119208 196
48 iso_pu_bacteria 2728368998 2728747555 196
49 iso_pu_bacteria 2791355197 2793071262 196
50 iso_pu_bacteria 2885374607 2885376944 196
51 iso_pu_bacteria 2903748898 2903753003 196
52 iso_pu_bacteria 2904690495 2904697776 196
53 iso_pu_bacteria 2906610324 2906611513 196
54 iso_pu_bacteria 2906635258 2906642445 196
55 iso_pu_bacteria 2906660503 2906660752 196
56 iso_pu_bacteria 2908739725 2908745097 196
57 iso_pu_bacteria 2908756301 2908757127 196
58 iso_pu_bacteria 2922425934 2922427843 196
59 iso_pu_bacteria 2935630451 2935632222 196
60 iso_pu_bacteria 2941507105 2941508170 196
61 iso_pu_bacteria 2941515067 2941515325 196
62 iso_pu_bacteria 2941523033 2941524100 196
63 iso_pu_bacteria 3005474847 3005477554 196
64 iso_pu_bacteria 8019555841 8019559611 196
65 iso_pu_bacteria 8019565922 8019569714 196
66 iso_pu_bacteria 8056689827 8056695208 196
67 3300005434 Ga0070709_10008191 Ga0070709_100081914 197
68 3300005436 Ga0070713_100003459 Ga0070713_10000345910 197
69 3300006163 Ga0070715_10352543 Ga0070715_103525432 197
70 3300025906 Ga0207699_10002630 Ga0207699_100026306 197
71 3300025916 Ga0207663_10839291 Ga0207663_108392911 197
72 3300025928 Ga0207700_10014254 Ga0207700_100142541 197
73 3300028577 Ga0265318_10002991 Ga0265318_100029913 197
74 3300031238 Ga0265332_10004192 Ga0265332_100041927 197
75 3300031239 Ga0265328_10002177 Ga0265328_100021775 197
76 3300031242 Ga0265329_10004078 Ga0265329_100040783 197
77 3300031250 Ga0265331_10007385 Ga0265331_100073856 197
78 3300031344 Ga0265316_10010754 Ga0265316_100107547 197
79 3300031595 Ga0265313_10113189 Ga0265313_101131892 197
80 3300031711 Ga0265314_10021351 Ga0265314_100213513 197
81 3300031712 Ga0265342_10024786 Ga0265342_100247863 197
82 3300046460 Ga0495638_0143486 Ga0495638_0143486_103_738 197
83 3300047472 Ga0495686_0007753 Ga0495686_0007753_137_772 197
84 3300053136 Ga0500559_0014141 Ga0500559_0014141_1908_2543 197
85 iso_pu_bacteria 2545555834 2545676769 197
86 iso_pu_bacteria 641522639 641642900 197
87 3300005295 Ga0065707_10082160 Ga0065707_100821604 198
88 3300005434 Ga0070709_10142422 Ga0070709_101424222 198
89 3300005437 Ga0070710_10015742 Ga0070710_100157422 198
90 3300005439 Ga0070711_100042369 Ga0070711_1000423692 198
91 3300005445 Ga0070708_100028912 Ga0070708_1000289125 198
92 3300005467 Ga0070706_100110008 Ga0070706_1001100082 198
93 3300005536 Ga0070697_100250049 Ga0070697_1002500492 198
94 3300005536 Ga0070697_100677961 Ga0070697_1006779611 198
95 3300005539 Ga0068853_100576132 Ga0068853_1005761322 198
96 3300005548 Ga0070665_100552463 Ga0070665_1005524632 198
97 3300005563 Ga0068855_100158370 Ga0068855_1001583703 198
98 3300005614 Ga0068856_100024659 Ga0068856_1000246591 198
99 3300005719 Ga0068861_100020438 Ga0068861_1000204382 198
100 3300005937 Ga0081455_10004816 Ga0081455_100048168 198
101 3300006028 Ga0070717_10690714 Ga0070717_106907141 198
102 3300006042 Ga0075368_10040532 Ga0075368_100405323 198
103 3300006051 Ga0075364_10318966 Ga0075364_103189662 198
104 3300006173 Ga0070716_100161921 Ga0070716_1001619211 198
105 3300006175 Ga0070712_100165235 Ga0070712_1001652352 198
106 3300006175 Ga0070712_100245625 Ga0070712_1002456252 198
107 3300006846 Ga0075430_100062697 Ga0075430_1000626972 198
108 3300007788 Ga0099795_10030859 Ga0099795_100308592 198
109 3300009101 Ga0105247_10282670 Ga0105247_102826701 198
110 3300009551 Ga0105238_10278341 Ga0105238_102783412 198
111 3300010375 Ga0105239_10417386 Ga0105239_104173861 198
112 3300013296 Ga0157374_10023190 Ga0157374_100231904 198
113 3300013306 Ga0163162_10735479 Ga0163162_107354792 198
114 3300014325 Ga0163163_10054759 Ga0163163_100547591 198
115 3300014326 Ga0157380_10914808 Ga0157380_109148081 198
116 3300025910 Ga0207684_10060869 Ga0207684_100608694 198
117 3300025915 Ga0207693_10009510 Ga0207693_100095102 198
118 3300025915 Ga0207693_10179919 Ga0207693_101799192 198
119 3300025924 Ga0207694_10796247 Ga0207694_107962471 198
120 3300025939 Ga0207665_10164180 Ga0207665_101641801 198
121 3300025949 Ga0207667_10235367 Ga0207667_102353672 198
122 3300026078 Ga0207702_10680116 Ga0207702_106801161 198
123 3300026118 Ga0207675_100027113 Ga0207675_1000271137 198
124 3300031247 Ga0265340_10018198 Ga0265340_100181983 198
125 3300031249 Ga0265339_10000560 Ga0265339_1000056019 198
126 3300031249 Ga0265339_10089663 Ga0265339_100896632 198
127 3300031250 Ga0265331_10088808 Ga0265331_100888082 198
128 3300031456 Ga0307513_10318621 Ga0307513_103186211 198
129 3300031712 Ga0265342_10221330 Ga0265342_102213301 198
130 3300031911 Ga0307412_10687239 Ga0307412_106872392 198
131 3300034820 Ga0373959_0033404 Ga0373959_0033404_47_655 198
132 3300035114 Ga0373939_0084490 Ga0373939_0084490_128_757 198
133 3300035695 Ga0373927_0001542 Ga0373927_0001542_4589_5221 198
134 3300035724 Ga0373933_0000241 Ga0373933_0000241_26634_27266 198
135 3300037853 Ga0436364_0693200 Ga0436364_0693200_1220_1828 198
136 3300042004 Ga0439445_0078464 Ga0439445_0078464_249_881 198
137 3300042439 Ga0439464_0153295 Ga0439464_0153295_78_686 198
138 3300044656 Ga0466969_0133123 Ga0466969_0133123_80_721 198
139 3300046455 Ga0495603_0003868 Ga0495603_0003868_4523_5155 198
140 3300046460 Ga0495638_0001008 Ga0495638_0001008_2541_3149 198
141 3300046471 Ga0495650_0039296 Ga0495650_0039296_132_761 198
142 3300046660 Ga0495625_0005241 Ga0495625_0005241_4981_5589 198
143 3300048911 Ga0496108_0795824 Ga0496108_0795824_151_783 198
144 3300048918 Ga0496115_0164267 Ga0496115_0164267_1056_1688 198
145 3300048918 Ga0496115_0175129 Ga0496115_0175129_700_1335 198
146 3300048921 Ga0496118_0027055 Ga0496118_0027055_951_1559 198
147 3300048927 Ga0496124_0089663 Ga0496124_0089663_1403_2035 198
148 3300048928 Ga0496125_0055387 Ga0496125_0055387_2190_2822 198
149 3300048929 Ga0496126_0069530 Ga0496126_0069530_98_733 198
150 3300048929 Ga0496126_0450369 Ga0496126_0450369_81_713 198
151 3300050490 nmdc:mga03n38_149464_c1 nmdc:mga03n38_149464_c1_277_906 198
152 3300050494 nmdc:mga06z11_32286_c1 nmdc:mga06z11_32286_c1_287_916 198
153 3300050496 nmdc:mga07m45_83547_c1 nmdc:mga07m45_83547_c1_709_1338 198
154 3300050509 nmdc:mga0qj67_170347_c1 nmdc:mga0qj67_170347_c1_867_1475 198
155 3300050513 nmdc:mga0rr50_174553_c1 nmdc:mga0rr50_174553_c1_143_778 198
156 3300050516 nmdc:mga0sz30_85955_c1 nmdc:mga0sz30_85955_c1_693_1298 198
157 3300005347 Ga0070668_100599329 Ga0070668_1005993291 199
158 3300005356 Ga0070674_100355375 Ga0070674_1003553752 199
159 3300005458 Ga0070681_10087284 Ga0070681_100872844 199
160 3300005530 Ga0070679_100011913 Ga0070679_1000119133 199
161 3300005546 Ga0070696_100432946 Ga0070696_1004329462 199
162 3300005563 Ga0068855_100165476 Ga0068855_1001654763 199
163 3300005718 Ga0068866_10249146 Ga0068866_102491462 199
164 3300005834 Ga0068851_10235888 Ga0068851_102358881 199
165 3300006175 Ga0070712_100196549 Ga0070712_1001965491 199
166 3300006942 Ga0099824_1005291 Ga0099824_100529110 199
167 3300006943 Ga0099822_1009136 Ga0099822_10091362 199
168 3300007788 Ga0099795_10066638 Ga0099795_100666382 199
169 3300009098 Ga0105245_10620426 Ga0105245_106204261 199
170 3300009176 Ga0105242_10744350 Ga0105242_107443501 199
171 3300009177 Ga0105248_11075705 Ga0105248_110757051 199
172 3300013104 Ga0157370_10019448 Ga0157370_100194484 199
173 3300025261 Ga0209233_1001106 Ga0209233_100110611 199
174 3300025898 Ga0207692_10056398 Ga0207692_100563983 199
175 3300025899 Ga0207642_10259968 Ga0207642_102599681 199
176 3300025904 Ga0207647_10264749 Ga0207647_102647491 199
177 3300025910 Ga0207684_10300491 Ga0207684_103004912 199
178 3300025912 Ga0207707_10209679 Ga0207707_102096792 199
179 3300025913 Ga0207695_10254109 Ga0207695_102541092 199
180 3300025918 Ga0207662_10133272 Ga0207662_101332722 199
181 3300025921 Ga0207652_10236858 Ga0207652_102368582 199
182 3300025926 Ga0207659_10177489 Ga0207659_101774893 199
183 3300025934 Ga0207686_10622156 Ga0207686_106221561 199
184 3300027357 Ga0209589_1000169 Ga0209589_100016912 199
185 3300027361 Ga0209489_100493 Ga0209489_10049312 199
186 3300027363 Ga0209700_100497 Ga0209700_10049712 199
187 3300033442 Ga0315911_1000010 Ga0315911_1000010105 199
188 3300035117 Ga0373953_0009911 Ga0373953_0009911_2389_2991 199
189 3300035171 Ga0373946_0027806 Ga0373946_0027806_710_1327 199
190 3300035172 Ga0373955_0131500 Ga0373955_0131500_801_1403 199
191 3300035410 Ga0373924_0016771 Ga0373924_0016771_1132_1734 199
192 3300035724 Ga0373933_0088942 Ga0373933_0088942_836_1438 199
193 3300036401 Ga0373937_0004815 Ga0373937_0004815_2615_3217 199
194 3300037471 Ga0395905_0189760 Ga0395905_0189760_104_721 199
195 3300041512 Ga0451853_0208434 Ga0451853_0208434_65_670 199
196 3300046681 Ga0495647_0243790 Ga0495647_0243790_108_725 199
197 3300047320 Ga0495672_0024237 Ga0495672_0024237_2308_2925 199
198 3300047320 Ga0495672_0070699 Ga0495672_0070699_164_778 199
199 3300047471 Ga0495684_0175165 Ga0495684_0175165_256_864 199
200 3300048903 Ga0496100_0292383 Ga0496100_0292383_490_1107 199
201 3300048924 Ga0496121_0000923 Ga0496121_0000923_9679_10296 199
202 3300048924 Ga0496121_0183637 Ga0496121_0183637_848_1465 199
203 3300050493 nmdc:mga0k408_5327_c1 nmdc:mga0k408_5327_c1_5077_5685 199
204 3300053078 Ga0495612_0036385 Ga0495612_0036385_561_1178 199
205 3300053139 Ga0500568_0028671 Ga0500568_0028671_1499_2116 199
206 3300021388 Ga0213875_10014516 Ga0213875_100145163 200
207 3300035118 Ga0373954_0083020 Ga0373954_0083020_108_716 200
208 3300036401 Ga0373937_0000443 Ga0373937_0000443_37687_38295 200
209 3300037853 Ga0436364_0010210 Ga0436364_0010210_1738_2367 200
210 3300039438 Ga0436360_0651179 Ga0436360_0651179_92_712 200
211 3300039450 Ga0436363_1328344 Ga0436363_1328344_689_1309 200
212 3300048922 Ga0496119_0008671 Ga0496119_0008671_1998_2615 200
213 3300048923 Ga0496120_0069541 Ga0496120_0069541_1093_1710 200
214 3300049568 Ga0501031_0421220 Ga0501031_0421220_222_845 200
215 3300049580 Ga0501046_0164933 Ga0501046_0164933_254_877 200
216 3300049741 Ga0501079_0380106 Ga0501079_0380106_98_721 200
217 3300049743 Ga0501081_0054244 Ga0501081_0054244_1254_1877 200
218 3300049824 Ga0501045_0014870 Ga0501045_0014870_2036_2659 200
219 3300003203 JGI25406J46586_10083757 JGI25406J46586_100837571 201
220 3300005440 Ga0070705_100303501 Ga0070705_1003035012 201
221 3300005983 Ga0081540_1093159 Ga0081540_10931591 201
222 3300005985 Ga0081539_10036773 Ga0081539_100367732 201
223 3300021384 Ga0213876_10255639 Ga0213876_102556392 201
224 3300021388 Ga0213875_10000003 Ga0213875_1000000385 201
225 3300037853 Ga0436364_0875435 Ga0436364_0875435_31180_31881 201
226 3300039437 Ga0436365_0464318 Ga0436365_0464318_348_998 201
227 3300039437 Ga0436365_0650883 Ga0436365_0650883_179_865 201
228 3300039450 Ga0436363_1586335 Ga0436363_1586335_190_876 201
229 3300041512 Ga0451853_2874200 Ga0451853_2874200_1557_2171 201
230 3300046517 Ga0495630_0131397 Ga0495630_0131397_1106_1720 201
231 3300047444 Ga0495675_0038586 Ga0495675_0038586_1545_2153 201
232 3300005983 Ga0081540_1027834 Ga0081540_10278343 202
233 3300006177 Ga0075362_10209003 Ga0075362_102090032 202
234 3300028556 Ga0265337_1033729 Ga0265337_10337291 202
235 3300028800 Ga0265338_10040511 Ga0265338_100405112 202
236 3300035241 Ga0373961_0036898 Ga0373961_0036898_363_983 202
237 3300039437 Ga0436365_1878830 Ga0436365_1878830_598_1293 202
238 3300048907 Ga0496104_0000206 Ga0496104_0000206_21730_22368 202
239 3300050494 nmdc:mga06z11_89510_c1 nmdc:mga06z11_89510_c1_17_700 202
240 3300053733 Ga0500552_000141 Ga0500552_000141_4958_5635 202
241 3300006186 Ga0075369_10065649 Ga0075369_100656492 203
242 3300031344 Ga0265316_10450598 Ga0265316_104505981 203
243 3300037853 Ga0436364_0645586 Ga0436364_0645586_185_835 203
244 3300048912 Ga0496109_0045438 Ga0496109_0045438_1629_2267 203
245 3300048918 Ga0496115_0010899 Ga0496115_0010899_1053_1691 203
246 3300048918 Ga0496115_0207488 Ga0496115_0207488_528_1142 203
247 3300050489 nmdc:mga03683_11845_c2 nmdc:mga03683_11845_c2_929_1585 203
248 3300050492 nmdc:mga0yw44_9814_c1 nmdc:mga0yw44_9814_c1_835_1491 203
249 3300050494 nmdc:mga06z11_14848_c1 nmdc:mga06z11_14848_c1_1053_1709 203
250 3300050516 nmdc:mga0sz30_56311_c1 nmdc:mga0sz30_56311_c1_547_1203 203
251 3300005295 Ga0065707_10086978 Ga0065707_100869783 204
252 3300005536 Ga0070697_100156271 Ga0070697_1001562712 204
253 3300009551 Ga0105238_10128894 Ga0105238_101288943 204
254 3300010159 Ga0099796_10052025 Ga0099796_100520252 204
255 3300014968 Ga0157379_10000337 Ga0157379_1000033728 204
256 3300025711 Ga0207696_1000069 Ga0207696_1000069191 204
257 3300025910 Ga0207684_10371854 Ga0207684_103718542 204
258 3300025915 Ga0207693_10325227 Ga0207693_103252272 204
259 3300048929 Ga0496126_0368407 Ga0496126_0368407_221_889 204
260 3300049580 Ga0501046_0205092 Ga0501046_0205092_790_1440 204
261 3300049581 Ga0501047_0222923 Ga0501047_0222923_125_775 204
262 3300028379 Ga0268266_10439028 Ga0268266_104390281 205
263 3300035111 Ga0373923_0080451 Ga0373923_0080451_94_726 205
264 3300039438 Ga0436360_0364414 Ga0436360_0364414_1799_2470 205
265 3300039447 Ga0436361_0213695 Ga0436361_0213695_2442_3113 205
266 3300048929 Ga0496126_0002227 Ga0496126_0002227_13340_13975 205
267 3300053177 Ga0500636_0009768 Ga0500636_0009768_2951_3613 205
268 3300053177 Ga0500636_0245015 Ga0500636_0245015_133_777 205
269 3300005355 Ga0070671_100722399 Ga0070671_1007223992 206
270 3300005548 Ga0070665_100486803 Ga0070665_1004868031 206
271 3300025940 Ga0207691_10539881 Ga0207691_105398811 206
272 3300039437 Ga0436365_1522619 Ga0436365_1522619_833_1483 206
273 3300049742 Ga0501080_0878199 Ga0501080_0878199_91_717 206
274 3300049744 Ga0501083_0381416 Ga0501083_0381416_124_750 206
275 3300005295 Ga0065707_10243856 Ga0065707_102438561 207
276 3300005354 Ga0070675_100291323 Ga0070675_1002913232 207
277 3300005543 Ga0070672_100288078 Ga0070672_1002880782 207
278 3300006051 Ga0075364_10139548 Ga0075364_101395482 207
279 3300006195 Ga0075366_10006588 Ga0075366_100065884 207
280 3300006844 Ga0075428_100009253 Ga0075428_1000092531 207
281 3300006846 Ga0075430_100012173 Ga0075430_1000121739 207
282 3300006847 Ga0075431_100001953 Ga0075431_1000019532 207
283 3300009094 Ga0111539_10000738 Ga0111539_1000073840 207
284 3300009094 Ga0111539_10320595 Ga0111539_103205952 207
285 3300009147 Ga0114129_10000066 Ga0114129_1000006671 207
286 3300014968 Ga0157379_10201161 Ga0157379_102011612 207
287 3300025940 Ga0207691_10357093 Ga0207691_103570932 207
288 3300027907 Ga0207428_10009685 Ga0207428_100096858 207
289 3300027907 Ga0207428_10264532 Ga0207428_102645322 207
290 3300041408 Ga0439453_0002403 Ga0439453_0002403_1158_1793 207
291 3300042436 Ga0439435_0071635 Ga0439435_0071635_235_870 207
292 3300042439 Ga0439464_0089113 Ga0439464_0089113_154_789 207
293 3300048907 Ga0496104_0005540 Ga0496104_0005540_10117_10773 207
294 3300049572 Ga0501036_0480833 Ga0501036_0480833_62_745 207
295 3300050493 nmdc:mga0k408_11727_c1 nmdc:mga0k408_11727_c1_1862_2497 207
296 3300050496 nmdc:mga07m45_180557_c1 nmdc:mga07m45_180557_c1_119_754 207
297 3300050507 nmdc:mga05p37_1072_c1 nmdc:mga05p37_1072_c1_29776_30411 207
298 3300050509 nmdc:mga0qj67_98121_c1 nmdc:mga0qj67_98121_c1_247_882 207
299 3300050510 nmdc:mga06r32_458_c1 nmdc:mga06r32_458_c1_21741_22376 207
300 3300050511 nmdc:mga08y16_3771_c1 nmdc:mga08y16_3771_c1_12320_12955 207
301 3300005347 Ga0070668_100904596 Ga0070668_1009045961 208
302 3300005435 Ga0070714_100027888 Ga0070714_1000278883 208
303 3300005435 Ga0070714_100102705 Ga0070714_1001027053 208
304 3300005437 Ga0070710_10069799 Ga0070710_100697992 208
305 3300005981 Ga0081538_10119520 Ga0081538_101195202 208
306 3300005985 Ga0081539_10003518 Ga0081539_100035189 208
307 3300006028 Ga0070717_10048895 Ga0070717_100488953 208
308 3300006871 Ga0075434_100126898 Ga0075434_1001268983 208
309 3300006914 Ga0075436_100513875 Ga0075436_1005138751 208
310 3300009094 Ga0111539_10370171 Ga0111539_103701712 208
311 3300010375 Ga0105239_10521684 Ga0105239_105216842 208
312 3300013297 Ga0157378_10731701 Ga0157378_107317011 208
313 3300025898 Ga0207692_10012729 Ga0207692_100127292 208
314 3300025905 Ga0207685_10044480 Ga0207685_100444801 208
315 3300025906 Ga0207699_10061074 Ga0207699_100610742 208
316 3300025915 Ga0207693_10010641 Ga0207693_100106414 208
317 3300025916 Ga0207663_10039429 Ga0207663_100394292 208
318 3300025928 Ga0207700_10007283 Ga0207700_100072832 208
319 3300025928 Ga0207700_10082668 Ga0207700_100826682 208
320 3300025929 Ga0207664_10015284 Ga0207664_100152843 208
321 3300025929 Ga0207664_10261761 Ga0207664_102617612 208
322 3300025939 Ga0207665_10009844 Ga0207665_100098444 208
323 3300048904 Ga0496101_0366390 Ga0496101_0366390_156_827 208
324 3300048910 Ga0496107_0222909 Ga0496107_0222909_522_1193 208
325 3300048913 Ga0496110_0438800 Ga0496110_0438800_309_980 208
326 3300048929 Ga0496126_0101280 Ga0496126_0101280_1350_2006 208
327 3300049588 Ga0501072_0206770 Ga0501072_0206770_864_1547 208
328 3300049743 Ga0501081_0233668 Ga0501081_0233668_187_867 208
329 3300050489 nmdc:mga03683_69359_c1 nmdc:mga03683_69359_c1_221_916 208
330 3300050489 nmdc:mga03683_8694_c1 nmdc:mga03683_8694_c1_1849_2541 208
331 3300050493 nmdc:mga0k408_371521_c1 nmdc:mga0k408_371521_c1_144_836 208
332 3300050512 nmdc:mga0n895_188745_c1 nmdc:mga0n895_188745_c1_662_1333 208
333 3300050516 nmdc:mga0sz30_1382_c2 nmdc:mga0sz30_1382_c2_3400_4092 208
334 3300060353 Ga0501082_0000038 Ga0501082_0000038_70302_70943 208
335 3300061734 Ga0530510_0246063 Ga0530510_0246063_73_753 208
336 3300005331 Ga0070670_100341469 Ga0070670_1003414692 209
337 3300005335 Ga0070666_10007822 Ga0070666_100078225 209
338 3300005338 Ga0068868_100212153 Ga0068868_1002121532 209
339 3300005340 Ga0070689_100070646 Ga0070689_1000706462 209
340 3300005355 Ga0070671_100054688 Ga0070671_1000546882 209
341 3300005367 Ga0070667_100019202 Ga0070667_1000192026 209
342 3300005457 Ga0070662_100203744 Ga0070662_1002037442 209
343 3300005535 Ga0070684_100094649 Ga0070684_1000946492 209
344 3300005544 Ga0070686_100015395 Ga0070686_1000153952 209
345 3300005548 Ga0070665_100296757 Ga0070665_1002967572 209
346 3300005563 Ga0068855_100161916 Ga0068855_1001619162 209
347 3300005564 Ga0070664_100029016 Ga0070664_1000290162 209
348 3300005618 Ga0068864_100017927 Ga0068864_1000179277 209
349 3300005719 Ga0068861_100493072 Ga0068861_1004930722 209
350 3300005983 Ga0081540_1006146 Ga0081540_10061464 209
351 3300006237 Ga0097621_100384174 Ga0097621_1003841742 209
352 3300006358 Ga0068871_100317150 Ga0068871_1003171501 209
353 3300006846 Ga0075430_100157895 Ga0075430_1001578952 209
354 3300006880 Ga0075429_100189038 Ga0075429_1001890382 209
355 3300009093 Ga0105240_10463334 Ga0105240_104633341 209
356 3300009094 Ga0111539_10011258 Ga0111539_100112583 209
357 3300009098 Ga0105245_10056795 Ga0105245_100567952 209
358 3300009101 Ga0105247_10154430 Ga0105247_101544302 209
359 3300011119 Ga0105246_10002911 Ga0105246_100029112 209
360 3300013306 Ga0163162_10254662 Ga0163162_102546622 209
361 3300013308 Ga0157375_10004170 Ga0157375_100041704 209
362 3300014325 Ga0163163_10130068 Ga0163163_101300682 209
363 3300014968 Ga0157379_10472790 Ga0157379_104727902 209
364 3300014969 Ga0157376_10253271 Ga0157376_102532712 209
365 3300025900 Ga0207710_10068985 Ga0207710_100689852 209
366 3300025903 Ga0207680_10143822 Ga0207680_101438222 209
367 3300025913 Ga0207695_10400739 Ga0207695_104007392 209
368 3300025918 Ga0207662_10227613 Ga0207662_102276132 209
369 3300025924 Ga0207694_10228986 Ga0207694_102289862 209
370 3300025925 Ga0207650_10566048 Ga0207650_105660481 209
371 3300025936 Ga0207670_10117060 Ga0207670_101170602 209
372 3300025941 Ga0207711_10055922 Ga0207711_100559224 209
373 3300025949 Ga0207667_10263950 Ga0207667_102639502 209
374 3300025986 Ga0207658_10121106 Ga0207658_101211062 209
375 3300026023 Ga0207677_10108897 Ga0207677_101088972 209
376 3300026035 Ga0207703_10496398 Ga0207703_104963981 209
377 3300026088 Ga0207641_10168052 Ga0207641_101680522 209
378 3300026118 Ga0207675_100297291 Ga0207675_1002972912 209
379 3300028381 Ga0268264_10431014 Ga0268264_104310142 209
380 3300031730 Ga0307516_10001689 Ga0307516_1000168910 209
381 3300048911 Ga0496108_0293393 Ga0496108_0293393_402_1100 209
382 3300048912 Ga0496109_0875009 Ga0496109_0875009_72_770 209
383 3300048915 Ga0496112_0004396 Ga0496112_0004396_10791_11489 209
384 3300048916 Ga0496113_0499072 Ga0496113_0499072_201_899 209
385 3300049592 Ga0501076_0108736 Ga0501076_0108736_296_979 209
386 3300049593 Ga0501077_0074876 Ga0501077_0074876_419_1102 209
387 3300049743 Ga0501081_0269933 Ga0501081_0269933_47_730 209
388 3300049744 Ga0501083_0015836 Ga0501083_0015836_390_1043 209
389 3300050509 nmdc:mga0qj67_91553_c1 nmdc:mga0qj67_91553_c1_64_774 209
390 3300050511 nmdc:mga08y16_24138_c1 nmdc:mga08y16_24138_c1_938_1648 209
391 3300061734 Ga0530510_0570622 Ga0530510_0570622_95_778 209
392 3300005436 Ga0070713_100444985 Ga0070713_1004449852 210
393 3300005983 Ga0081540_1044506 Ga0081540_10445062 210
394 3300006038 Ga0075365_10020959 Ga0075365_100209594 210
395 3300006051 Ga0075364_10049166 Ga0075364_100491662 210
396 3300006844 Ga0075428_100028270 Ga0075428_1000282706 210
397 3300006847 Ga0075431_100780565 Ga0075431_1007805652 210
398 3300025928 Ga0207700_10361957 Ga0207700_103619572 210
399 3300031595 Ga0265313_10056460 Ga0265313_100564602 210
400 3300050492 nmdc:mga0yw44_1495_c1 nmdc:mga0yw44_1495_c1_3361_3993 210
401 3300050509 nmdc:mga0qj67_229523_c1 nmdc:mga0qj67_229523_c1_83_778 210
402 3300060353 Ga0501082_0220648 Ga0501082_0220648_958_1599 210
403 3300060353 Ga0501082_0421149 Ga0501082_0421149_356_1012 210
404 3300005365 Ga0070688_100470697 Ga0070688_1004706971 211
405 3300005843 Ga0068860_100396868 Ga0068860_1003968681 211
406 3300005983 Ga0081540_1026123 Ga0081540_10261232 211
407 3300006042 Ga0075368_10096447 Ga0075368_100964471 211
408 3300013296 Ga0157374_11152836 Ga0157374_111528362 211
409 3300013306 Ga0163162_10491180 Ga0163162_104911802 211
410 3300048909 Ga0496106_0101315 Ga0496106_0101315_105_773 211
411 3300048913 Ga0496110_0026250 Ga0496110_0026250_3176_3844 211
412 3300048918 Ga0496115_0020878 Ga0496115_0020878_1484_2152 211
413 3300049588 Ga0501072_0017442 Ga0501072_0017442_1498_2151 211
414 3300050495 nmdc:mga04h51_100923_c1 nmdc:mga04h51_100923_c1_290_964 211
415 3300050512 nmdc:mga0n895_588117_c1 nmdc:mga0n895_588117_c1_261_935 211
416 3300054114 Ga0501084_0137295 Ga0501084_0137295_1312_1962 211
417 3300002075 JGI24738J21930_10013519 JGI24738J21930_100135191 212
418 3300002244 JGI24742J22300_10002527 JGI24742J22300_100025273 212
419 3300002459 JGI24751J29686_10012785 JGI24751J29686_100127852 212
420 3300005329 Ga0070683_100005456 Ga0070683_1000054568 212
421 3300005329 Ga0070683_100325727 Ga0070683_1003257272 212
422 3300005330 Ga0070690_100050904 Ga0070690_1000509041 212
423 3300005331 Ga0070670_100059809 Ga0070670_1000598092 212
424 3300005335 Ga0070666_10014598 Ga0070666_100145982 212
425 3300005339 Ga0070660_100101243 Ga0070660_1001012432 212
426 3300005340 Ga0070689_100019528 Ga0070689_1000195281 212
427 3300005340 Ga0070689_100209815 Ga0070689_1002098152 212
428 3300005343 Ga0070687_100001575 Ga0070687_1000015756 212
429 3300005353 Ga0070669_100205900 Ga0070669_1002059002 212
430 3300005367 Ga0070667_100104363 Ga0070667_1001043632 212
431 3300005406 Ga0070703_10021001 Ga0070703_100210012 212
432 3300005436 Ga0070713_100069688 Ga0070713_1000696882 212
433 3300005436 Ga0070713_100513604 Ga0070713_1005136042 212
434 3300005438 Ga0070701_10001746 Ga0070701_100017467 212
435 3300005439 Ga0070711_100049397 Ga0070711_1000493973 212
436 3300005441 Ga0070700_100191742 Ga0070700_1001917422 212
437 3300005445 Ga0070708_100049539 Ga0070708_1000495392 212
438 3300005455 Ga0070663_100040341 Ga0070663_1000403412 212
439 3300005456 Ga0070678_100124732 Ga0070678_1001247321 212
440 3300005457 Ga0070662_100635597 Ga0070662_1006355971 212
441 3300005466 Ga0070685_10009109 Ga0070685_100091097 212
442 3300005467 Ga0070706_100819125 Ga0070706_1008191252 212
443 3300005468 Ga0070707_100237479 Ga0070707_1002374792 212
444 3300005518 Ga0070699_100000717 Ga0070699_1000007174 212
445 3300005518 Ga0070699_100036672 Ga0070699_1000366722 212
446 3300005535 Ga0070684_100234321 Ga0070684_1002343212 212
447 3300005539 Ga0068853_100084749 Ga0068853_1000847492 212
448 3300005543 Ga0070672_100002423 Ga0070672_1000024237 212
449 3300005544 Ga0070686_100051639 Ga0070686_1000516392 212
450 3300005548 Ga0070665_100179628 Ga0070665_1001796282 212
451 3300005548 Ga0070665_100628769 Ga0070665_1006287692 212
452 3300005549 Ga0070704_100099533 Ga0070704_1000995332 212
453 3300005563 Ga0068855_100284905 Ga0068855_1002849053 212
454 3300005564 Ga0070664_100180645 Ga0070664_1001806452 212
455 3300005577 Ga0068857_100071066 Ga0068857_1000710662 212
456 3300005578 Ga0068854_100094741 Ga0068854_1000947412 212
457 3300005614 Ga0068856_100201123 Ga0068856_1002011232 212
458 3300005617 Ga0068859_100059542 Ga0068859_1000595422 212
459 3300005618 Ga0068864_100146926 Ga0068864_1001469262 212
460 3300005618 Ga0068864_100722170 Ga0068864_1007221701 212
461 3300005719 Ga0068861_100123913 Ga0068861_1001239132 212
462 3300005834 Ga0068851_10059535 Ga0068851_100595352 212
463 3300005840 Ga0068870_10013821 Ga0068870_100138211 212
464 3300005842 Ga0068858_100190548 Ga0068858_1001905482 212
465 3300005843 Ga0068860_100008518 Ga0068860_1000085183 212
466 3300005937 Ga0081455_10016316 Ga0081455_100163164 212
467 3300006028 Ga0070717_10400721 Ga0070717_104007212 212
468 3300006038 Ga0075365_10027361 Ga0075365_100273612 212
469 3300006048 Ga0075363_100317717 Ga0075363_1003177172 212
470 3300006173 Ga0070716_100234783 Ga0070716_1002347831 212
471 3300006175 Ga0070712_100001343 Ga0070712_1000013438 212
472 3300006175 Ga0070712_100014615 Ga0070712_1000146154 212
473 3300006175 Ga0070712_100259710 Ga0070712_1002597102 212
474 3300006175 Ga0070712_100308161 Ga0070712_1003081612 212
475 3300006237 Ga0097621_100008043 Ga0097621_1000080435 212
476 3300006353 Ga0075370_10025723 Ga0075370_100257233 212
477 3300006844 Ga0075428_100028529 Ga0075428_1000285293 212
478 3300006844 Ga0075428_100825653 Ga0075428_1008256532 212
479 3300006847 Ga0075431_100026428 Ga0075431_1000264285 212
480 3300006871 Ga0075434_100203965 Ga0075434_1002039652 212
481 3300006871 Ga0075434_100230744 Ga0075434_1002307442 212
482 3300006880 Ga0075429_100255844 Ga0075429_1002558442 212
483 3300006881 Ga0068865_100100265 Ga0068865_1001002653 212
484 3300006914 Ga0075436_100053515 Ga0075436_1000535151 212
485 3300006914 Ga0075436_100466644 Ga0075436_1004666441 212
486 3300006931 Ga0097620_100059542 Ga0097620_1000595423 212
487 3300007076 Ga0075435_100411046 Ga0075435_1004110462 212
488 3300007265 Ga0099794_10088432 Ga0099794_100884322 212
489 3300007265 Ga0099794_10104583 Ga0099794_101045833 212
490 3300007788 Ga0099795_10092521 Ga0099795_100925212 212
491 3300009011 Ga0105251_10081356 Ga0105251_100813562 212
492 3300009093 Ga0105240_10601656 Ga0105240_106016561 212
493 3300009093 Ga0105240_10729270 Ga0105240_107292702 212
494 3300009094 Ga0111539_10644208 Ga0111539_106442082 212
495 3300009101 Ga0105247_10160061 Ga0105247_101600612 212
496 3300009147 Ga0114129_10001660 Ga0114129_100016609 212
497 3300009147 Ga0114129_10006951 Ga0114129_100069517 212
498 3300009147 Ga0114129_10079963 Ga0114129_100799634 212
499 3300009176 Ga0105242_10333190 Ga0105242_103331902 212
500 3300009177 Ga0105248_10054219 Ga0105248_100542192 212
501 3300009551 Ga0105238_10016713 Ga0105238_100167136 212
502 3300009551 Ga0105238_10063079 Ga0105238_100630793 212
503 3300009551 Ga0105238_11395569 Ga0105238_113955691 212
504 3300009553 Ga0105249_10014702 Ga0105249_100147025 212
505 3300010375 Ga0105239_10083591 Ga0105239_100835913 212
506 3300013296 Ga0157374_10021511 Ga0157374_100215113 212
507 3300013306 Ga0163162_10340694 Ga0163162_103406942 212
508 3300013306 Ga0163162_10441334 Ga0163162_104413342 212
509 3300013307 Ga0157372_10510489 Ga0157372_105104891 212
510 3300014325 Ga0163163_10060794 Ga0163163_100607942 212
511 3300014745 Ga0157377_10008253 Ga0157377_100082537 212
512 3300017792 Ga0163161_10176237 Ga0163161_101762372 212
513 3300021361 Ga0213872_10047326 Ga0213872_100473262 212
514 3300025315 Ga0207697_10065121 Ga0207697_100651212 212
515 3300025899 Ga0207642_10024956 Ga0207642_100249563 212
516 3300025900 Ga0207710_10002725 Ga0207710_100027254 212
517 3300025901 Ga0207688_10002899 Ga0207688_100028992 212
518 3300025905 Ga0207685_10179596 Ga0207685_101795961 212
519 3300025907 Ga0207645_10078327 Ga0207645_100783273 212
520 3300025908 Ga0207643_10010894 Ga0207643_100108944 212
521 3300025915 Ga0207693_10003110 Ga0207693_100031106 212
522 3300025915 Ga0207693_10003660 Ga0207693_100036607 212
523 3300025915 Ga0207693_10069552 Ga0207693_100695522 212
524 3300025915 Ga0207693_10118075 Ga0207693_101180752 212
525 3300025916 Ga0207663_10024028 Ga0207663_100240284 212
526 3300025918 Ga0207662_10012930 Ga0207662_100129304 212
527 3300025919 Ga0207657_10023776 Ga0207657_100237765 212
528 3300025923 Ga0207681_10396750 Ga0207681_103967501 212
529 3300025924 Ga0207694_10080844 Ga0207694_100808443 212
530 3300025928 Ga0207700_10066662 Ga0207700_100666623 212
531 3300025928 Ga0207700_10374834 Ga0207700_103748342 212
532 3300025931 Ga0207644_10366151 Ga0207644_103661512 212
533 3300025933 Ga0207706_10006548 Ga0207706_100065489 212
534 3300025934 Ga0207686_10052111 Ga0207686_100521112 212
535 3300025937 Ga0207669_10103541 Ga0207669_101035412 212
536 3300025938 Ga0207704_10012670 Ga0207704_100126703 212
537 3300025938 Ga0207704_10275206 Ga0207704_102752062 212
538 3300025938 Ga0207704_10552667 Ga0207704_105526671 212
539 3300025939 Ga0207665_10090679 Ga0207665_100906792 212
540 3300025940 Ga0207691_10003357 Ga0207691_100033579 212
541 3300025941 Ga0207711_10021216 Ga0207711_100212162 212
542 3300025941 Ga0207711_10028224 Ga0207711_100282242 212
543 3300025942 Ga0207689_10006940 Ga0207689_100069402 212
544 3300025944 Ga0207661_10075743 Ga0207661_100757433 212
545 3300025960 Ga0207651_10049729 Ga0207651_100497293 212
546 3300026023 Ga0207677_10190094 Ga0207677_101900942 212
547 3300026067 Ga0207678_10020239 Ga0207678_100202393 212
548 3300026075 Ga0207708_10020532 Ga0207708_100205323 212
549 3300026089 Ga0207648_10009789 Ga0207648_100097898 212
550 3300026116 Ga0207674_10016631 Ga0207674_100166316 212
551 3300026118 Ga0207675_100035708 Ga0207675_1000357084 212
552 3300026121 Ga0207683_10004116 Ga0207683_100041166 212
553 3300026121 Ga0207683_10377477 Ga0207683_103774772 212
554 3300027512 Ga0209179_1016447 Ga0209179_10164472 212
555 3300027512 Ga0209179_1042443 Ga0209179_10424431 212
556 3300027671 Ga0209588_1081018 Ga0209588_10810182 212
557 3300027907 Ga0207428_10038770 Ga0207428_100387704 212
558 3300028381 Ga0268264_11071567 Ga0268264_110715671 212
559 3300035111 Ga0373923_0060006 Ga0373923_0060006_75_716 212
560 3300035111 Ga0373923_0179373 Ga0373923_0179373_137_787 212
561 3300035113 Ga0373936_0069859 Ga0373936_0069859_465_1106 212
562 3300035113 Ga0373936_0226874 Ga0373936_0226874_41_694 212
563 3300035117 Ga0373953_0076702 Ga0373953_0076702_656_1306 212
564 3300035170 Ga0373943_0006818 Ga0373943_0006818_35_676 212
565 3300035170 Ga0373943_0260670 Ga0373943_0260670_254_895 212
566 3300035171 Ga0373946_0041774 Ga0373946_0041774_867_1520 212
567 3300035171 Ga0373946_0046375 Ga0373946_0046375_723_1364 212
568 3300035171 Ga0373946_0216268 Ga0373946_0216268_181_831 212
569 3300035241 Ga0373961_0054874 Ga0373961_0054874_391_1032 212
570 3300035691 Ga0373931_0003811 Ga0373931_0003811_3415_4056 212
571 3300035691 Ga0373931_0041850 Ga0373931_0041850_1490_2137 212
572 3300035692 Ga0373935_0111923 Ga0373935_0111923_781_1431 212
573 3300035695 Ga0373927_0023442 Ga0373927_0023442_964_1605 212
574 3300035695 Ga0373927_0262302 Ga0373927_0262302_285_956 212
575 3300035724 Ga0373933_0038660 Ga0373933_0038660_143_793 212
576 3300035725 Ga0373947_0055198 Ga0373947_0055198_1652_2293 212
577 3300035725 Ga0373947_0337935 Ga0373947_0337935_326_976 212
578 3300036401 Ga0373937_0029738 Ga0373937_0029738_4067_4717 212
579 3300036401 Ga0373937_0094017 Ga0373937_0094017_423_1064 212
580 3300037068 Ga0373925_0135223 Ga0373925_0135223_232_873 212
581 3300037418 Ga0395900_0306356 Ga0395900_0306356_658_1305 212
582 3300037853 Ga0436364_0858723 Ga0436364_0858723_56_697 212
583 3300038443 Ga0395901_0145072 Ga0395901_0145072_1435_2082 212
584 3300039447 Ga0436361_0210879 Ga0436361_0210879_4943_5590 212
585 3300041512 Ga0451853_0775028 Ga0451853_0775028_975_1613 212
586 3300046455 Ga0495603_0271087 Ga0495603_0271087_239_880 212
587 3300046457 Ga0495590_0035320 Ga0495590_0035320_397_1149 212
588 3300046459 Ga0495629_0092226 Ga0495629_0092226_1392_2039 212
589 3300046463 Ga0495653_0012660 Ga0495653_0012660_4367_5020 212
590 3300046472 Ga0495580_0462668 Ga0495580_0462668_176_817 212
591 3300046475 Ga0495639_0030518 Ga0495639_0030518_1385_2038 212
592 3300046476 Ga0495662_0003605 Ga0495662_0003605_3777_4430 212
593 3300046477 Ga0495664_0000470 Ga0495664_0000470_12002_12655 212
594 3300046513 Ga0495616_0185918 Ga0495616_0185918_184_831 212
595 3300046514 Ga0495618_0002529 Ga0495618_0002529_5688_6341 212
596 3300046514 Ga0495618_0045054 Ga0495618_0045054_1587_2237 212
597 3300046516 Ga0495628_0266660 Ga0495628_0266660_369_1010 212
598 3300046517 Ga0495630_0012167 Ga0495630_0012167_379_1032 212
599 3300046525 Ga0495663_0105543 Ga0495663_0105543_64_711 212
600 3300046529 Ga0495652_0040999 Ga0495652_0040999_957_1610 212
601 3300046531 Ga0495665_0170716 Ga0495665_0170716_322_975 212
602 3300046533 Ga0495640_0063900 Ga0495640_0063900_92_745 212
603 3300046536 Ga0495587_0022150 Ga0495587_0022150_814_1464 212
604 3300046537 Ga0495598_0001623 Ga0495598_0001623_3477_4118 212
605 3300046537 Ga0495598_0037712 Ga0495598_0037712_62_709 212
606 3300046542 Ga0495597_0189544 Ga0495597_0189544_121_768 212
607 3300046543 Ga0495645_0024307 Ga0495645_0024307_2202_2855 212
608 3300046543 Ga0495645_0278167 Ga0495645_0278167_330_980 212
609 3300046557 Ga0495622_0069274 Ga0495622_0069274_449_1090 212
610 3300046559 Ga0495667_0029980 Ga0495667_0029980_2571_3221 212
611 3300046559 Ga0495667_0200899 Ga0495667_0200899_462_1115 212
612 3300046615 Ga0495656_0090592 Ga0495656_0090592_100_741 212
613 3300046642 Ga0495634_0004229 Ga0495634_0004229_8841_9494 212
614 3300046642 Ga0495634_0017525 Ga0495634_0017525_2620_3273 212
615 3300046663 Ga0495635_0000867 Ga0495635_0000867_11463_12116 212
616 3300046664 Ga0495659_0094622 Ga0495659_0094622_312_953 212
617 3300046674 Ga0495588_0277551 Ga0495588_0277551_82_834 212
618 3300046678 Ga0495599_0039406 Ga0495599_0039406_1703_2353 212
619 3300046679 Ga0495623_0097719 Ga0495623_0097719_1131_1781 212
620 3300046680 Ga0495646_0083260 Ga0495646_0083260_31_681 212
621 3300046689 Ga0495613_0076922 Ga0495613_0076922_1574_2221 212
622 3300046691 Ga0495670_0255100 Ga0495670_0255100_207_848 212
623 3300046694 Ga0495649_0104271 Ga0495649_0104271_783_1421 212
624 3300046809 Ga0495600_0339950 Ga0495600_0339950_119_769 212
625 3300047315 Ga0495581_0051698 Ga0495581_0051698_354_1007 212
626 3300047317 Ga0495604_0155548 Ga0495604_0155548_622_1275 212
627 3300047317 Ga0495604_0256999 Ga0495604_0256999_268_918 212
628 3300047319 Ga0495674_0014795 Ga0495674_0014795_4078_4731 212
629 3300047321 Ga0495676_0027638 Ga0495676_0027638_2546_3187 212
630 3300047471 Ga0495684_0042111 Ga0495684_0042111_362_1015 212
631 3300047471 Ga0495684_0091366 Ga0495684_0091366_519_1166 212
632 3300047673 Ga0495593_0051386 Ga0495593_0051386_404_1057 212
633 3300047673 Ga0495593_0085345 Ga0495593_0085345_148_795 212
634 3300048088 Ga0495602_0402147 Ga0495602_0402147_10_660 212
635 3300048903 Ga0496100_0000732 Ga0496100_0000732_8460_9098 212
636 3300048904 Ga0496101_0043904 Ga0496101_0043904_1697_2344 212
637 3300048905 Ga0496102_0012404 Ga0496102_0012404_1337_1984 212
638 3300048905 Ga0496102_0014870 Ga0496102_0014870_5393_6031 212
639 3300048905 Ga0496102_0062343 Ga0496102_0062343_1851_2492 212
640 3300048906 Ga0496103_0033054 Ga0496103_0033054_1223_1870 212
641 3300048907 Ga0496104_0021277 Ga0496104_0021277_1542_2189 212
642 3300048907 Ga0496104_0076846 Ga0496104_0076846_1466_2104 212
643 3300048908 Ga0496105_0016883 Ga0496105_0016883_3704_4351 212
644 3300048909 Ga0496106_0014703 Ga0496106_0014703_4536_5174 212
645 3300048910 Ga0496107_0006176 Ga0496107_0006176_1205_1843 212
646 3300048910 Ga0496107_0285951 Ga0496107_0285951_536_1177 212
647 3300048911 Ga0496108_0000822 Ga0496108_0000822_19648_20295 212
648 3300048911 Ga0496108_0043926 Ga0496108_0043926_1042_1680 212
649 3300048912 Ga0496109_0001115 Ga0496109_0001115_15515_16162 212
650 3300048913 Ga0496110_0021839 Ga0496110_0021839_3533_4174 212
651 3300048913 Ga0496110_0032798 Ga0496110_0032798_997_1644 212
652 3300048913 Ga0496110_0150019 Ga0496110_0150019_930_1577 212
653 3300048913 Ga0496110_0196993 Ga0496110_0196993_277_915 212
654 3300048914 Ga0496111_0003041 Ga0496111_0003041_2613_3251 212
655 3300048914 Ga0496111_0035832 Ga0496111_0035832_1526_2173 212
656 3300048914 Ga0496111_0138244 Ga0496111_0138244_706_1353 212
657 3300048915 Ga0496112_0001495 Ga0496112_0001495_5695_6342 212
658 3300048915 Ga0496112_0018494 Ga0496112_0018494_4572_5210 212
659 3300048915 Ga0496112_0664350 Ga0496112_0664350_222_863 212
660 3300048916 Ga0496113_0003524 Ga0496113_0003524_7204_7851 212
661 3300048916 Ga0496113_0041380 Ga0496113_0041380_277_915 212
662 3300048917 Ga0496114_0015030 Ga0496114_0015030_4395_5033 212
663 3300048917 Ga0496114_0020954 Ga0496114_0020954_2674_3315 212
664 3300048918 Ga0496115_0061380 Ga0496115_0061380_1847_2494 212
665 3300048918 Ga0496115_0067660 Ga0496115_0067660_1066_1704 212
666 3300049743 Ga0501081_0502410 Ga0501081_0502410_248_892 212
667 3300050492 nmdc:mga0yw44_98448_c1 nmdc:mga0yw44_98448_c1_168_815 212
668 3300050494 nmdc:mga06z11_214082_c1 nmdc:mga06z11_214082_c1_248_889 212
669 3300050494 nmdc:mga06z11_27431_c1 nmdc:mga06z11_27431_c1_654_1295 212
670 3300050495 nmdc:mga04h51_213639_c1 nmdc:mga04h51_213639_c1_104_745 212
671 3300050496 nmdc:mga07m45_30738_c1 nmdc:mga07m45_30738_c1_1065_1706 212
672 3300050507 nmdc:mga05p37_18171_c1 nmdc:mga05p37_18171_c1_5750_6397 212
673 3300050507 nmdc:mga05p37_4399_c1 nmdc:mga05p37_4399_c1_11040_11687 212
674 3300050507 nmdc:mga05p37_467604_c1 nmdc:mga05p37_467604_c1_360_1007 212
675 3300050508 nmdc:mga09592_146073_c1 nmdc:mga09592_146073_c1_762_1409 212
676 3300050510 nmdc:mga06r32_20124_c1 nmdc:mga06r32_20124_c1_1288_1935 212
677 3300050512 nmdc:mga0n895_1118069_c1 nmdc:mga0n895_1118069_c1_19_666 212
678 3300050512 nmdc:mga0n895_32503_c1 nmdc:mga0n895_32503_c1_3878_4525 212
679 3300050513 nmdc:mga0rr50_243265_c1 nmdc:mga0rr50_243265_c1_461_1111 212
680 3300050516 nmdc:mga0sz30_164682_c1 nmdc:mga0sz30_164682_c1_51_692 212
681 3300053077 Ga0495601_0045232 Ga0495601_0045232_1868_2518 212
682 3300053077 Ga0495601_0103176 Ga0495601_0103176_844_1485 212
683 3300053077 Ga0495601_0242278 Ga0495601_0242278_47_688 212
684 3300053078 Ga0495612_0011958 Ga0495612_0011958_362_1015 212
685 3300053078 Ga0495612_0122871 Ga0495612_0122871_154_792 212
686 3300053084 Ga0495595_0177475 Ga0495595_0177475_295_945 212
687 3300053085 Ga0495619_0031257 Ga0495619_0031257_2697_3350 212
688 3300053085 Ga0495619_0223507 Ga0495619_0223507_185_832 212

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x0t-assembly1.cif.gz_A crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3 0.7738 25 76
1x0t-assembly1.cif.gz_A crystal structure of ribonuclease p protein ph1601p from pyrococcus horikoshii ot3 0.3749 25 76
7wic-assembly1.cif.gz_R cryo-em structure of the ss-14-bound human sstr2-gi1 complex 0.3527 32 163
4reu-assembly1.cif.gz_B revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli 0.3311 23 182
4reu-assembly1.cif.gz_A-2 revelation of endogenously bound fe2+ ions in the crystal structure of ferritin from escherichia coli 0.325 10 182
ID Description Score Start End Superfamily
af_Q9DC37_260_445_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3591 25 145 1.20.1250.20
af_A4IDE9_223_375_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3447 24 212 1.25.40.10
af_A0A1D8PM72_154_256_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.3433 32 149 1.20.1280.290
af_B6T9A5_232_433_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3431 24 183 1.20.1250.20
af_P70600_859_1009_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.3352 24 167 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A554X8U7-F1-model_v4 Prokaryotic cytochrome b561 0.9656 2 195 GO:0016020
AF-A0A1S9CXQ3-F1-model_v4 DUF962 domain-containing protein 0.9638 1 195 GO:0016020
AF-A0A5E7ZP03-F1-model_v4 Membrane protein 0.9627 2 190 GO:0016020
AF-A0A221KAC2-F1-model_v4 Membrane protein 0.9572 3 196 GO:0016020
AF-A0A2W4TTE2-F1-model_v4 DUF962 domain-containing protein 0.9569 1 197 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.93 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map