F475340

General Info

Members Datasets Scaffolds Average Seq Length
688 413 638 256

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0032508|Ga0395905_0032508_3948_4844
Length 298
Sequence MSIATRLAWSIFGFVLGVLAAPCLELIILYNNNPPIRQPGDMNTPDIHFELQGAVAIVRLARPAKRNAISDELILGIRSTFESMPEGVGAIVLDGQGDHFCAGLDLSELKERDAGAGMHHSRMWHAALETVQFGPAPVIAALHGAVVGGGLELAAACHIRVADETAFYSLPEGSRGIFVGGGGAVRIPRLIGEARMADMMFTGRVYDAKEGERIGLSQYIVPAGTAFAKAMELAERVAKNAPLTNYALMHALPRISEQPADQGFLTEALMAAIAQSAPEAKTRVREFLEGRGPKVKKG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221596 Acidovorax sp. Root70 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221652 Acidovorax sp. Root402 Isolate Unclassified
13 2643221658 Variovorax sp. Root411 Isolate Unclassified
14 2643221672 Variovorax sp. Root434 Isolate Unclassified
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2643221717 Acidovorax sp. Root267 Isolate Unclassified
17 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
18 2738541277 Variovorax sp. GV051 Isolate Unclassified
19 2738541307 Variovorax sp. GV008 Isolate Unclassified
20 2738543012 Acidovorax sp. CF301 Isolate Unclassified
21 2738543013 Variovorax sp. BT01 Isolate Unclassified
22 2738543019 Variovorax sp. GV040 Isolate Unclassified
23 2816332133 Acidovorax radicis 2721A Isolate Unclassified
24 2818991446 Variovorax sp. 1180 Isolate Unclassified
25 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
26 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
27 2842677519 Variovorax sp. R-72495 Isolate Unclassified
28 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
29 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
30 2885198086 Variovorax sp. 679 Isolate Unclassified
31 2885211737 Variovorax sp. 553 Isolate Unclassified
32 2899924645 Variovorax sp. 369 Isolate Unclassified
33 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
34 2904456579 Variovorax sp. 2002 Isolate Unclassified
35 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
36 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
37 2928037797 Variovorax sp. 1126 Isolate Unclassified
38 2928044640 Variovorax sp. 1128 Isolate Unclassified
39 2928051484 Variovorax sp. 1133 Isolate Unclassified
40 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
41 2928070936 Variovorax gossypii 1167 Isolate Unclassified
42 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
43 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
44 2929520902 Variovorax beijingensis 502 Isolate Unclassified
45 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
46 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
47 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
48 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
49 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
50 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
51 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
52 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
53 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
57 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
58 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
59 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
62 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
63 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
66 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
69 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
70 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
71 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
72 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
73 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
74 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
75 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
76 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
79 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
80 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
81 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
82 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
83 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
84 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
85 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
88 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
89 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
95 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
100 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
101 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
121 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
122 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
125 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
143 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
144 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
145 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
146 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
152 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
157 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
158 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
163 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
164 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
169 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
172 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
206 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
208 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
217 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
218 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
219 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
220 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
221 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
222 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
223 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
224 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
230 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
231 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
232 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
233 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
234 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
242 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
243 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
244 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
253 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
254 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
262 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
263 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
264 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
265 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
266 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
267 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
268 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
269 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
270 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
271 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
272 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
273 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
274 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
275 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
276 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
277 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
278 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
279 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
280 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
281 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
282 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
283 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
284 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
285 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
286 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
287 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
288 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
289 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
290 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
291 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
292 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
295 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
296 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
297 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
298 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
299 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
300 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
301 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
304 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
312 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
313 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
314 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
318 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
319 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
320 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
321 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
322 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
323 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
324 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
325 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
326 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
331 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
334 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
335 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
336 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
337 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
338 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
339 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
340 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
341 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
344 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
345 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
346 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
347 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
348 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
349 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
350 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
354 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
355 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
356 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
357 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
358 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
359 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
360 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
361 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
362 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
363 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
364 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
365 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
366 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
367 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
368 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
369 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
370 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
371 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
372 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
373 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
374 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
375 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
382 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
383 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
384 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
385 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
388 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
391 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
392 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
393 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
394 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
395 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
396 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
400 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
403 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
404 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
405 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
406 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
407 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
408 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
409 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
410 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
411 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
412 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
413 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.3
Metatranscriptomes 0.44
Isolates 7.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.47
Nodule 1.16
Rhizoplane 6.25
Rhizosphere 54.65
Stem 0
Stem Tuber 0
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10034117 3300001989 Bacteria 1736
2 JGI25155J39150_1000009 3300002704 Bacteria 224358
3 JGI25156J39149_1000009 3300002705 Bacteria 224379
4 JGI25154J39366_1000024 3300002738 Bacteria 211372
5 JGI25157J39369_1000007 3300002741 Bacteria 224377
6 JGI25152J39213_1010759 3300002773 Bacteria 2068
7 JGI25150J39212_1005464 3300002774 Bacteria 2709
8 JGI25159J45721_1000286 3300002987 Bacteria 23822
9 JGI25151J46595_10010871 3300003187 Bacteria 4211
10 JGI25151J46595_10013564 3300003187 Bacteria 3663
11 JGI25151J46595_10028708 3300003187 Bacteria 2212
12 JGI25153J46596_10026233 3300003215 Bacteria 2067
13 JGI25153J46596_10036612 3300003215 Bacteria 1570
14 rootH1_10010835 3300003316 Bacteria 3326
15 rootH2_10131427 3300003320 Bacteria 2314
16 rootH1_10398388 3300003323 Bacteria 1153
17 JGI25160J50197_1000242 3300003354 Bacteria 42399
18 JGI25161J50226_1000009 3300003374 Bacteria 224699
19 Ga0006562J51391_1032156 3300003578 Bacteria 1910
20 Ga0006562J51391_1050707 3300003578 Bacteria 1180
21 Ga0055535_1000422 3300003761 Bacteria 39771
22 Ga0055542_1000074 3300003762 Bacteria 141185
23 Ga0055526_1000764 3300003771 Bacteria 24002
24 Ga0055526_1002603 3300003771 Bacteria 12065
25 Ga0055537_1000235 3300003773 Bacteria 40558
26 Ga0055537_1001179 3300003773 Bacteria 11166
27 Ga0055537_1004150 3300003773 Bacteria 4225
28 Ga0055537_1005789 3300003773 Bacteria 3247
29 Ga0055537_1008729 3300003773 Bacteria 2307
30 Ga0055524_1000143 3300003775 Bacteria 84686
31 Ga0055536_1001550 3300003781 Bacteria 13780
32 Ga0055536_1002402 3300003781 Bacteria 10534
33 Ga0055534_1000612 3300003784 Bacteria 18479
34 Ga0055534_1001150 3300003784 Bacteria 11173
35 Ga0055534_1007325 3300003784 Bacteria 2643
36 Ga0055534_1009176 3300003784 Bacteria 2169
37 Ga0055534_1009747 3300003784 Bacteria 2061
38 Ga0055528_1001546 3300003790 Bacteria 13849
39 Ga0055528_1003188 3300003790 Bacteria 8390
40 Ga0055528_1007187 3300003790 Bacteria 4953
41 Ga0055528_1012716 3300003790 Bacteria 3247
42 Ga0055528_1022021 3300003790 Bacteria 1998
43 Ga0055530_10000474 3300003791 Bacteria 34978
44 Ga0055530_10001693 3300003791 Bacteria 15609
45 Ga0055530_10012948 3300003791 Bacteria 2877
46 Ga0055530_10053448 3300003791 Bacteria 927
47 Ga0055540_1000027 3300003792 Bacteria 187454
48 Ga0055540_1001360 3300003792 Bacteria 14663
49 Ga0055540_1004336 3300003792 Bacteria 6448
50 Ga0055531_10000465 3300003794 Bacteria 37499
51 Ga0055531_10001603 3300003794 Bacteria 16421
52 Ga0055531_10001892 3300003794 Bacteria 14663
53 Ga0055543_1001141 3300004625 Bacteria 11343
54 Ga0055543_1001635 3300004625 Bacteria 8548
55 Ga0065165_1004502 3300005262 Bacteria 8567
56 Ga0065165_1005558 3300005262 Bacteria 7011
57 Ga0065165_1006879 3300005262 Bacteria 5781
58 Ga0065714_10105539 3300005288 Bacteria 1536
59 Ga0070658_10034550 3300005327 Bacteria 4068
60 Ga0070658_10108697 3300005327 Bacteria 2296
61 Ga0070683_100056060 3300005329 Bacteria 3659
62 Ga0070666_10106400 3300005335 Bacteria 1938
63 Ga0070680_100136961 3300005336 Bacteria 2051
64 Ga0068868_100056705 3300005338 Bacteria 3094
65 Ga0068868_100114392 3300005338 Bacteria 2195
66 Ga0070660_100029168 3300005339 Bacteria 4133
67 Ga0070689_100005913 3300005340 Bacteria 8413
68 Ga0070673_100331359 3300005364 Bacteria 1347
69 Ga0070659_100293976 3300005366 Bacteria 1353
70 Ga0070667_100017811 3300005367 Bacteria 5886
71 Ga0070667_100629041 3300005367 Bacteria 990
72 Ga0070663_100107872 3300005455 Bacteria 2088
73 Ga0070678_100210272 3300005456 Bacteria 1611
74 Ga0070662_100009652 3300005457 Bacteria 6313
75 Ga0070662_100309717 3300005457 Bacteria 1285
76 Ga0068867_100030840 3300005459 Bacteria 3867
77 Ga0070707_100184730 3300005468 Bacteria 2033
78 Ga0070679_100206942 3300005530 Bacteria 1926
79 Ga0068853_100059027 3300005539 Bacteria 3313
80 Ga0068853_100074017 3300005539 Bacteria 2971
81 Ga0068853_100255784 3300005539 Bacteria 1608
82 Ga0070665_100011220 3300005548 Bacteria 9060
83 Ga0068855_100605676 3300005563 Bacteria 1181
84 Ga0070664_100006223 3300005564 Bacteria 9642
85 Ga0070664_100053777 3300005564 Bacteria 3414
86 Ga0070664_100121530 3300005564 Bacteria 2287
87 Ga0068857_100042748 3300005577 Bacteria 4020
88 Ga0068854_100155187 3300005578 Bacteria 1768
89 Ga0068852_100018914 3300005616 Bacteria 5440
90 Ga0068852_100411181 3300005616 Bacteria 1333
91 Ga0068864_100093567 3300005618 Bacteria 2655
92 Ga0068864_100161123 3300005618 Bacteria 2039
93 Ga0068864_100452994 3300005618 Bacteria 1227
94 Ga0068866_10263672 3300005718 Bacteria 1060
95 Ga0068866_10267595 3300005718 Bacteria 1053
96 Ga0068861_100043266 3300005719 Bacteria 3379
97 Ga0068851_10004316 3300005834 Bacteria 6400
98 Ga0068870_10019601 3300005840 Bacteria 3282
99 Ga0068863_100181602 3300005841 Unclassified 2020
100 Ga0068862_100120510 3300005844 Bacteria 2312
101 Ga0075365_10007399 3300006038 Bacteria 6144
102 Ga0075365_10041110 3300006038 Bacteria 3018
103 Ga0075365_10046436 3300006038 Bacteria 2852
104 Ga0075363_100054659 3300006048 Bacteria 2137
105 Ga0075363_100056327 3300006048 Bacteria 2107
106 Ga0075363_100065449 3300006048 Bacteria 1965
107 Ga0075363_100112523 3300006048 Bacteria 1514
108 Ga0075363_100150362 3300006048 Bacteria 1314
109 Ga0075363_100165829 3300006048 Bacteria 1252
110 Ga0075432_10010858 3300006058 Bacteria 3095
111 Ga0075362_10029242 3300006177 Bacteria 2373
112 Ga0075362_10071658 3300006177 Bacteria 1583
113 Ga0075362_10099937 3300006177 Bacteria 1355
114 Ga0075362_10119556 3300006177 Bacteria 1246
115 Ga0075362_10184126 3300006177 Bacteria 1013
116 Ga0075367_10140358 3300006178 Bacteria 1496
117 Ga0075366_10002402 3300006195 Bacteria 9611
118 Ga0075366_10010869 3300006195 Bacteria 5122
119 Ga0075366_10061274 3300006195 Bacteria 2236
120 Ga0075366_10160694 3300006195 Bacteria 1361
121 Ga0097621_100014841 3300006237 Bacteria 5843
122 Ga0075370_10000174 3300006353 Bacteria 22330
123 Ga0075370_10009118 3300006353 Bacteria 5134
124 Ga0075370_10024397 3300006353 Bacteria 3339
125 Ga0075370_10063897 3300006353 Bacteria 2099
126 Ga0075370_10250572 3300006353 Bacteria 1049
127 Ga0068871_100820359 3300006358 Bacteria 858
128 Ga0075430_100050168 3300006846 Bacteria 3521
129 Ga0079104_1022241 3300006946 Bacteria 1710
130 Ga0079104_1042794 3300006946 Bacteria 1047
131 Ga0099826_10003378 3300006948 Bacteria 10802
132 Ga0105244_10001684 3300009036 Bacteria 17460
133 Ga0105240_10075554 3300009093 Bacteria 4156
134 Ga0111539_10043864 3300009094 Bacteria 5360
135 Ga0105245_10103501 3300009098 Bacteria 2638
136 Ga0105245_10112726 3300009098 Bacteria 2531
137 Ga0105243_10000651 3300009148 Bacteria 34393
138 Ga0105243_10022415 3300009148 Bacteria 4800
139 Ga0105241_10035536 3300009174 Bacteria 3747
140 Ga0105241_10056041 3300009174 Bacteria 3021
141 Ga0105241_10660247 3300009174 Bacteria 951
142 Ga0105248_10079427 3300009177 Bacteria 3687
143 Ga0105237_10010332 3300009545 Bacteria 9943
144 Ga0105237_10195666 3300009545 Bacteria 2022
145 Ga0105237_10339405 3300009545 Bacteria 1507
146 Ga0105238_10061871 3300009551 Bacteria 3745
147 Ga0105238_10394048 3300009551 Bacteria 1377
148 Ga0105249_10086461 3300009553 Bacteria 2924
149 Ga0105239_10052265 3300010375 Bacteria 4480
150 Ga0105239_10422318 3300010375 Bacteria 1511
151 Ga0105246_10244001 3300011119 Bacteria 1422
152 Ga0157326_1002040 3300012513 Bacteria 2190
153 Ga0157373_10097251 3300013100 Bacteria 2072
154 Ga0157373_10101670 3300013100 Bacteria 2022
155 Ga0157371_10011999 3300013102 Bacteria 6641
156 Ga0157370_10010090 3300013104 Bacteria 9977
157 Ga0157369_10104078 3300013105 Bacteria 3023
158 Ga0157378_10113331 3300013297 Bacteria 2489
159 Ga0157378_10214115 3300013297 Bacteria 1828
160 Ga0163162_10004457 3300013306 Bacteria 13490
161 Ga0163162_10141172 3300013306 Bacteria 2522
162 Ga0163162_10290805 3300013306 Bacteria 1766
163 Ga0163162_10603683 3300013306 Bacteria 1223
164 Ga0163162_10701174 3300013306 Bacteria 1134
165 Ga0163163_10032774 3300014325 Bacteria 5020
166 Ga0163163_10151219 3300014325 Bacteria 2365
167 Ga0157380_10102885 3300014326 Bacteria 2382
168 Ga0182008_10002904 3300014497 Bacteria 10607
169 Ga0182008_10003704 3300014497 Bacteria 9120
170 Ga0182008_10049983 3300014497 Bacteria 2075
171 Ga0157379_10030520 3300014968 Bacteria 4798
172 Ga0157376_10001487 3300014969 Bacteria 15450
173 Ga0157376_10315775 3300014969 Bacteria 1484
174 Ga0157376_10458427 3300014969 Bacteria 1245
175 Ga0182006_1001051 3300015261 Bacteria 17843
176 Ga0182007_10001491 3300015262 Bacteria 12532
177 Ga0182007_10006789 3300015262 Bacteria 4875
178 Ga0183362_10005 3300015683 Bacteria 437616
179 Ga0163161_10010507 3300017792 Bacteria 6411
180 Ga0163161_10080406 3300017792 Bacteria 2398
181 Ga0163161_10100266 3300017792 Bacteria 2155
182 Ga0209435_100051 3300025206 Bacteria 90866
183 Ga0209672_100519 3300025228 Bacteria 21142
184 Ga0209147_100419 3300025229 Bacteria 27989
185 Ga0209258_100176 3300025242 Bacteria 141261
186 Ga0207425_1000873 3300025245 Bacteria 14742
187 Ga0207425_1001688 3300025245 Bacteria 8790
188 Ga0207425_1001776 3300025245 Bacteria 8382
189 Ga0209646_1000029 3300025246 Bacteria 386414
190 Ga0209026_1000016 3300025250 Bacteria 386457
191 Ga0209148_1000033 3300025254 Bacteria 555508
192 Ga0209759_1000016 3300025256 Bacteria 386414
193 Ga0209129_1000270 3300025258 Bacteria 50956
194 Ga0209129_1003689 3300025258 Bacteria 6499
195 Ga0209129_1008653 3300025258 Bacteria 2799
196 Ga0209129_1008732 3300025258 Bacteria 2776
197 Ga0209129_1010651 3300025258 Bacteria 2274
198 Ga0209565_1000020 3300025263 Bacteria 432627
199 Ga0209565_1000122 3300025263 Bacteria 111132
200 Ga0209565_1000373 3300025263 Bacteria 38291
201 Ga0209565_1001818 3300025263 Bacteria 8564
202 Ga0209565_1003152 3300025263 Bacteria 5498
203 Ga0209673_1000209 3300025273 Bacteria 117670
204 Ga0209673_1000302 3300025273 Bacteria 91221
205 Ga0209673_1001386 3300025273 Bacteria 23772
206 Ga0209673_1003803 3300025273 Bacteria 8564
207 Ga0209130_1000014 3300025284 Bacteria 412039
208 Ga0209130_1000335 3300025284 Bacteria 53993
209 Ga0209130_1000487 3300025284 Bacteria 40823
210 Ga0209130_1000495 3300025284 Bacteria 40276
211 Ga0209130_1001175 3300025284 Bacteria 18766
212 Ga0209130_1007904 3300025284 Bacteria 3211
213 Ga0209130_1013513 3300025284 Bacteria 2087
214 Ga0209675_1000014 3300025291 Bacteria 421902
215 Ga0209675_1000098 3300025291 Bacteria 130512
216 Ga0209675_1001308 3300025291 Bacteria 14763
217 Ga0209675_1003982 3300025291 Bacteria 6748
218 Ga0209675_1005447 3300025291 Bacteria 5326
219 Ga0209675_1014889 3300025291 Bacteria 2341
220 Ga0209676_1000013 3300025292 Bacteria 816080
221 Ga0209676_1000048 3300025292 Bacteria 403716
222 Ga0209676_1000124 3300025292 Bacteria 194206
223 Ga0209676_1000604 3300025292 Bacteria 52933
224 Ga0209676_1003874 3300025292 Bacteria 8733
225 Ga0209676_1006692 3300025292 Bacteria 5613
226 Ga0209025_1000324 3300025294 Bacteria 106257
227 Ga0209025_1000597 3300025294 Bacteria 65153
228 Ga0209025_1000733 3300025294 Bacteria 55578
229 Ga0209025_1004202 3300025294 Bacteria 12704
230 Ga0209025_1005897 3300025294 Bacteria 9789
231 Ga0209025_1005974 3300025294 Bacteria 9674
232 Ga0209025_1010658 3300025294 Bacteria 6191
233 Ga0209025_1016839 3300025294 Bacteria 4271
234 Ga0209564_1000423 3300025295 Bacteria 74528
235 Ga0209564_1001169 3300025295 Bacteria 30538
236 Ga0209564_1001202 3300025295 Bacteria 29560
237 Ga0209564_1003808 3300025295 Bacteria 9782
238 Ga0209564_1004130 3300025295 Bacteria 9113
239 Ga0209758_1000833 3300025297 Bacteria 43061
240 Ga0209758_1003579 3300025297 Bacteria 13912
241 Ga0209758_1025763 3300025297 Bacteria 2569
242 Ga0209050_1000008 3300025298 Bacteria 1144179
243 Ga0209050_1000012 3300025298 Bacteria 813717
244 Ga0209050_1001045 3300025298 Bacteria 34179
245 Ga0209050_1002039 3300025298 Bacteria 18656
246 Ga0209050_1006385 3300025298 Bacteria 6995
247 Ga0209256_1000039 3300025299 Bacteria 372337
248 Ga0209256_1000095 3300025299 Bacteria 206120
249 Ga0209256_1000527 3300025299 Bacteria 55578
250 Ga0207426_1000161 3300025302 Bacteria 172765
251 Ga0207426_1000224 3300025302 Bacteria 130233
252 Ga0207426_1000955 3300025302 Bacteria 28485
253 Ga0207426_1001771 3300025302 Bacteria 16279
254 Ga0209051_1000005 3300025303 Bacteria 1142353
255 Ga0209051_1000019 3300025303 Bacteria 511268
256 Ga0209051_1000099 3300025303 Bacteria 165161
257 Ga0209051_1000117 3300025303 Bacteria 150156
258 Ga0209051_1000207 3300025303 Bacteria 103683
259 Ga0209051_1000833 3300025303 Bacteria 31762
260 Ga0209051_1011109 3300025303 Bacteria 4474
261 Ga0209051_1078175 3300025303 Bacteria 965
262 Ga0209257_1000024 3300025304 Bacteria 726068
263 Ga0209257_1000031 3300025304 Bacteria 688770
264 Ga0209257_1000161 3300025304 Bacteria 176089
265 Ga0209257_1000258 3300025304 Bacteria 122220
266 Ga0209257_1004843 3300025304 Bacteria 9963
267 Ga0209257_1009295 3300025304 Bacteria 5309
268 Ga0209257_1011333 3300025304 Bacteria 4311
269 Ga0209257_1061272 3300025304 Bacteria 1021
270 Ga0207656_10007159 3300025321 Bacteria 4055
271 Ga0207656_10036545 3300025321 Bacteria 2062
272 Ga0207655_1001510 3300025728 Bacteria 21219
273 Ga0207655_1079886 3300025728 Bacteria 1184
274 Ga0207680_10272860 3300025903 Bacteria 1173
275 Ga0207645_10005156 3300025907 Bacteria 9549
276 Ga0207645_10008002 3300025907 Bacteria 7415
277 Ga0207695_10133853 3300025913 Bacteria 2434
278 Ga0207657_10026290 3300025919 Bacteria 5351
279 Ga0207657_10041810 3300025919 Bacteria 4049
280 Ga0207652_10178927 3300025921 Bacteria 1905
281 Ga0207694_10319898 3300025924 Bacteria 1280
282 Ga0207650_10001983 3300025925 Bacteria 14357
283 Ga0207650_10253994 3300025925 Bacteria 1424
284 Ga0207687_10034205 3300025927 Bacteria 3450
285 Ga0207687_10046561 3300025927 Bacteria 3003
286 Ga0207644_10030857 3300025931 Bacteria 3731
287 Ga0207706_10001771 3300025933 Bacteria 21193
288 Ga0207706_10008031 3300025933 Bacteria 9739
289 Ga0207706_10142747 3300025933 Bacteria 2106
290 Ga0207709_10000313 3300025935 Bacteria 52906
291 Ga0207709_10000669 3300025935 Bacteria 27749
292 Ga0207670_10043362 3300025936 Bacteria 2970
293 Ga0207669_10422166 3300025937 Bacteria 1050
294 Ga0207691_10003250 3300025940 Bacteria 15835
295 Ga0207691_10242744 3300025940 Bacteria 1557
296 Ga0207711_10046284 3300025941 Bacteria 3717
297 Ga0207689_10012071 3300025942 Bacteria 7400
298 Ga0207689_10161431 3300025942 Bacteria 1846
299 Ga0207679_10010834 3300025945 Bacteria 5877
300 Ga0207667_10898832 3300025949 Bacteria 877
301 Ga0207640_10033788 3300025981 Bacteria 3186
302 Ga0207640_10344330 3300025981 Bacteria 1195
303 Ga0207658_10089906 3300025986 Bacteria 2378
304 Ga0207677_10050142 3300026023 Bacteria 2822
305 Ga0207677_10068824 3300026023 Bacteria 2487
306 Ga0207639_10003657 3300026041 Bacteria 10333
307 Ga0207678_10002574 3300026067 Bacteria 16522
308 Ga0207708_10000993 3300026075 Bacteria 21204
309 Ga0207702_10144336 3300026078 Bacteria 2158
310 Ga0207702_10320911 3300026078 Bacteria 1475
311 Ga0207641_10253602 3300026088 Bacteria 1644
312 Ga0207648_10000840 3300026089 Bacteria 34588
313 Ga0207648_10012123 3300026089 Bacteria 8084
314 Ga0207648_10238338 3300026089 Bacteria 1619
315 Ga0207674_10033584 3300026116 Bacteria 5370
316 Ga0207674_10243751 3300026116 Bacteria 1744
317 Ga0207683_10004959 3300026121 Bacteria 11445
318 Ga0209281_1018111 3300027111 Bacteria 1415
319 Ga0209281_1029678 3300027111 Bacteria 985
320 Ga0209973_1002078 3300027252 Bacteria 1829
321 Ga0209282_1003178 3300027666 Bacteria 9720
322 Ga0209971_1005374 3300027682 Bacteria 3045
323 Ga0209813_10078738 3300027866 Bacteria 1085
324 Ga0209974_10015870 3300027876 Bacteria 2501
325 Ga0207428_10098286 3300027907 Bacteria 2265
326 Ga0268266_10021473 3300028379 Bacteria 5499
327 Ga0268265_10247966 3300028380 Bacteria 1575
328 Ga0268264_10090835 3300028381 Bacteria 2633
329 Ga0307515_10000040 3300028794 Bacteria 322704
330 Ga0307515_10000458 3300028794 Bacteria 97523
331 Ga0307515_10106766 3300028794 Bacteria 3317
332 Ga0307515_10147541 3300028794 Bacteria 2482
333 Ga0307512_10174892 3300030522 Bacteria 1221
334 Ga0316177_1103696 3300030731 Bacteria 2402
335 Ga0314311_1049345 3300030733 Bacteria 11896
336 Ga0316178_1053423 3300030735 Bacteria 7152
337 Ga0316183_1023591 3300030742 Bacteria 5350
338 Ga0316183_1194403 3300030742 Bacteria 2630
339 Ga0316181_1061609 3300030744 Bacteria 914
340 Ga0316182_1044621 3300030745 Bacteria 5736
341 Ga0265330_10054816 3300031235 Bacteria 1742
342 Ga0265332_10003751 3300031238 Bacteria 7264
343 Ga0265331_10060652 3300031250 Bacteria 1786
344 Ga0265327_10119761 3300031251 Bacteria 1248
345 Ga0265327_10140962 3300031251 Bacteria 1127
346 Ga0307513_10000194 3300031456 Bacteria 87921
347 Ga0307513_10001393 3300031456 Bacteria 34808
348 Ga0307513_10154016 3300031456 Bacteria 2201
349 Ga0307408_100000171 3300031548 Bacteria 73180
350 Ga0307408_100007277 3300031548 Bacteria 7321
351 Ga0307408_100076061 3300031548 Bacteria 2496
352 Ga0307514_10000828 3300031649 Bacteria 49982
353 Ga0307514_10026727 3300031649 Bacteria 4666
354 Ga0316579_10000177 3300031691 Bacteria 18623
355 Ga0265314_10020869 3300031711 Bacteria 5050
356 Ga0265314_10036600 3300031711 Bacteria 3565
357 Ga0265342_10022315 3300031712 Bacteria 4027
358 Ga0265342_10047726 3300031712 Bacteria 2569
359 Ga0316576_10018905 3300031727 Bacteria 4713
360 Ga0316578_10028686 3300031728 Bacteria 3153
361 Ga0307516_10006663 3300031730 Bacteria 13500
362 Ga0307405_10028542 3300031731 Bacteria 3251
363 Ga0307405_10139849 3300031731 Bacteria 1686
364 Ga0316577_10001607 3300031733 Bacteria 10769
365 Ga0307406_10001400 3300031901 Bacteria 13402
366 Ga0307406_10007237 3300031901 Bacteria 6147
367 Ga0307406_10188084 3300031901 Bacteria 1509
368 Ga0307412_10084078 3300031911 Bacteria 2208
369 Ga0307412_10214401 3300031911 Bacteria 1471
370 Ga0307412_10252776 3300031911 Bacteria 1369
371 Ga0307412_10490751 3300031911 Bacteria 1020
372 Ga0307412_10523127 3300031911 Bacteria 991
373 Ga0307416_100222755 3300032002 Bacteria 1811
374 Ga0307416_100494104 3300032002 Bacteria 1286
375 Ga0307416_100506143 3300032002 Bacteria 1273
376 Ga0307411_10138374 3300032005 Bacteria 1791
377 Ga0316585_10021205 3300032137 Bacteria 1994
378 Ga0316580_10000077 3300032139 Bacteria 16967
379 Ga0316592_1019927 3300033524 Bacteria 1422
380 Ga0373944_0007063 3300035089 Bacteria 3000
381 Ga0373954_0144809 3300035118 Bacteria 1160
382 Ga0373946_0054221 3300035171 Bacteria 1686
383 Ga0316574_0000453 3300035398 Bacteria 16452
384 Ga0373935_0027835 3300035692 Bacteria 3493
385 Ga0373927_0049634 3300035695 Bacteria 2713
386 Ga0373947_0127411 3300035725 Bacteria 1622
387 Ga0316582_0002708 3300036647 Bacteria 8411
388 Ga0316584_0061444 3300036712 Bacteria 2813
389 Ga0395899_0086470 3300037312 Bacteria 2277
390 Ga0395900_0052621 3300037418 Bacteria 4191
391 Ga0395900_0266776 3300037418 Bacteria 1708
392 Ga0395898_0004483 3300037466 Bacteria 15266
393 Ga0395898_0019317 3300037466 Bacteria 6938
394 Ga0395898_0150582 3300037466 Bacteria 2226
395 Ga0395898_0330291 3300037466 Bacteria 1454
396 Ga0395905_0000132 3300037471 Bacteria 123636
397 Ga0395905_0000773 3300037471 Bacteria 42104
398 Ga0395905_0020265 3300037471 Bacteria 6300
399 Ga0395905_0020548 3300037471 Bacteria 6253
400 Ga0395905_0032508 3300037471 Bacteria 4907
401 Ga0395905_0045023 3300037471 Bacteria 4139
402 Ga0395905_0463096 3300037471 Bacteria 1166
403 Ga0395901_0061368 3300038443 Bacteria 3911
404 Ga0395901_0099473 3300038443 Bacteria 3049
405 Ga0395901_0191808 3300038443 Bacteria 2143
406 Ga0395901_0306610 3300038443 Bacteria 1645
407 Ga0395901_0387156 3300038443 Bacteria 1438
408 Ga0436365_1241421 3300039437 Bacteria 833
409 Ga0436361_0206236 3300039447 Bacteria 37288
410 Ga0439436_0033022 3300041404 Bacteria 1499
411 Ga0439436_0048747 3300041404 Bacteria 1200
412 Ga0439438_035333 3300041405 Bacteria 1314
413 Ga0439439_0004892 3300041406 Bacteria 3038
414 Ga0439466_0017020 3300041411 Bacteria 2620
415 Ga0439466_0031968 3300041411 Bacteria 1797
416 Ga0439465_0004122 3300041413 Bacteria 4728
417 Ga0451793_0841222 3300041452 Bacteria 903
418 Ga0451797_1279811 3300041453 Bacteria 1398
419 Ga0451798_0376783 3300041458 Bacteria 1756
420 Ga0451807_0205605 3300041486 Bacteria 1067
421 Ga0451849_1538263 3300041505 Bacteria 1148
422 Ga0451853_2214512 3300041512 Bacteria 1745
423 Ga0439431_0004094 3300041997 Bacteria 3206
424 Ga0439433_0011737 3300041999 Bacteria 1920
425 Ga0439433_0012763 3300041999 Bacteria 1843
426 Ga0439442_001658 3300042002 Bacteria 4363
427 Ga0439445_0040432 3300042004 Bacteria 1237
428 Ga0439445_0043154 3300042004 Bacteria 1203
429 Ga0439432_001627 3300042006 Bacteria 8402
430 Ga0439432_040723 3300042006 Bacteria 1473
431 Ga0439432_054420 3300042006 Bacteria 1243
432 Ga0439449_0000571 3300042007 Bacteria 13827
433 Ga0439449_0010193 3300042007 Bacteria 3551
434 Ga0439449_0027811 3300042007 Bacteria 2109
435 Ga0439452_000889 3300042010 Bacteria 13717
436 Ga0439452_004162 3300042010 Bacteria 4909
437 Ga0439457_021025 3300042014 Bacteria 1447
438 Ga0439457_026479 3300042014 Bacteria 1284
439 Ga0439462_0000395 3300042015 Bacteria 8398
440 Ga0439462_0003003 3300042015 Bacteria 4004
441 Ga0439462_0033542 3300042015 Bacteria 1361
442 Ga0450911_001876 3300042115 Bacteria 4442
443 Ga0450923_000153 3300042125 Bacteria 6176
444 Ga0450923_004312 3300042125 Bacteria 2228
445 Ga0450888_000733 3300042126 Bacteria 3138
446 Ga0450896_009789 3300042133 Bacteria 1339
447 Ga0450898_009975 3300042134 Bacteria 1530
448 Ga0450898_027951 3300042134 Bacteria 1023
449 Ga0450906_003909 3300042145 Bacteria 3157
450 Ga0450907_009943 3300042146 Bacteria 1577
451 Ga0450910_003552 3300042147 Bacteria 2072
452 Ga0450909_006945 3300042185 Bacteria 1633
453 Ga0450909_008427 3300042185 Bacteria 1500
454 Ga0439464_0020302 3300042439 Bacteria 1819
455 Ga0450918_002160 3300042531 Bacteria 3759
456 Ga0450893_0000734 3300042532 Bacteria 4789
457 Ga0450893_0001087 3300042532 Bacteria 4086
458 Ga0450893_0028823 3300042532 Bacteria 983
459 Ga0451577_0000235 3300042876 Bacteria 109693
460 Ga0451577_0033005 3300042876 Bacteria 4665
461 Ga0466969_0056259 3300044656 Bacteria 1921
462 Ga0466969_0066543 3300044656 Bacteria 1739
463 Ga0453683_0000588 3300044673 Bacteria 40294
464 Ga0453683_0002178 3300044673 Bacteria 15579
465 Ga0466966_0005481 3300044684 Bacteria 8341
466 Ga0453684_0000906 3300044712 Bacteria 98768
467 Ga0453684_0048485 3300044712 Bacteria 5615
468 Ga0453684_0421008 3300044712 Bacteria 1492
469 Ga0466968_0043761 3300044735 Bacteria 1896
470 Ga0466970_0073416 3300044765 Bacteria 1841
471 Ga0466960_0133422 3300044901 Bacteria 1313
472 Ga0466959_0120105 3300045049 Bacteria 1869
473 Ga0451576_0016371 3300045051 Bacteria 8185
474 Ga0451576_0209915 3300045051 Bacteria 2033
475 Ga0466958_0281017 3300045836 Bacteria 1067
476 Ga0495627_009827 3300046453 Bacteria 3504
477 Ga0495603_0027022 3300046455 Bacteria 3465
478 Ga0495590_0038292 3300046457 Bacteria 1672
479 Ga0495638_0083365 3300046460 Bacteria 1937
480 Ga0495651_0170788 3300046462 Bacteria 1549
481 Ga0495580_0038734 3300046472 Bacteria 3413
482 Ga0495582_0076600 3300046473 Bacteria 1854
483 Ga0495639_0073112 3300046475 Bacteria 1586
484 Ga0495607_0109887 3300046501 Bacteria 1463
485 Ga0495618_0328101 3300046514 Bacteria 947
486 Ga0495620_0024857 3300046515 Bacteria 2843
487 Ga0495628_0112817 3300046516 Bacteria 2090
488 Ga0495630_0139490 3300046517 Bacteria 1843
489 Ga0495632_0051926 3300046519 Bacteria 2017
490 Ga0495637_0008818 3300046520 Bacteria 4938
491 Ga0495643_0076295 3300046522 Bacteria 1753
492 Ga0495644_0010443 3300046523 Bacteria 3578
493 Ga0495654_0023367 3300046530 Bacteria 3202
494 Ga0495654_0070369 3300046530 Bacteria 1659
495 Ga0495665_0068407 3300046531 Bacteria 1873
496 Ga0495598_0000201 3300046537 Bacteria 10515
497 Ga0495609_0067799 3300046538 Bacteria 1571
498 Ga0495621_0110344 3300046539 Bacteria 1054
499 Ga0495621_0111200 3300046539 Bacteria 1051
500 Ga0495597_0000271 3300046542 Bacteria 47044
501 Ga0495597_0014491 3300046542 Bacteria 3753
502 Ga0495633_0103415 3300046558 Bacteria 1322
503 Ga0495633_0130209 3300046558 Bacteria 1164
504 Ga0495656_0000586 3300046615 Bacteria 11799
505 Ga0495634_0085323 3300046642 Bacteria 2058
506 Ga0495611_0045987 3300046648 Bacteria 1956
507 Ga0495625_0000045 3300046660 Bacteria 202475
508 Ga0495625_0000379 3300046660 Bacteria 67828
509 Ga0495659_0033534 3300046664 Bacteria 1803
510 Ga0495588_0043933 3300046674 Bacteria 2287
511 Ga0495588_0045119 3300046674 Bacteria 2259
512 Ga0495647_0010122 3300046681 Bacteria 3207
513 Ga0495658_0092193 3300046683 Bacteria 1795
514 Ga0495669_0014120 3300046684 Bacteria 3414
515 Ga0495624_0027928 3300046690 Bacteria 3689
516 Ga0495670_0082233 3300046691 Bacteria 1642
517 Ga0495671_0013910 3300046692 Bacteria 4341
518 Ga0495671_0026847 3300046692 Bacteria 2980
519 Ga0495671_0090897 3300046692 Bacteria 1494
520 Ga0495649_0000010 3300046694 Bacteria 430552
521 Ga0495581_0121427 3300047315 Bacteria 1520
522 Ga0495676_0002862 3300047321 Bacteria 15561
523 Ga0495687_000523 3300047443 Bacteria 46029
524 Ga0495677_0032346 3300047445 Bacteria 1905
525 Ga0495681_0065094 3300047470 Bacteria 1668
526 Ga0495593_0005402 3300047673 Bacteria 7552
527 Ga0495614_0004291 3300048089 Bacteria 6423
528 Ga0495615_0027805 3300048090 Bacteria 1330
529 Ga0495626_0080112 3300048091 Bacteria 1452
530 Ga0496100_0009492 3300048903 Bacteria 5467
531 Ga0496100_0054743 3300048903 Bacteria 2603
532 Ga0496100_0305621 3300048903 Bacteria 1191
533 Ga0496101_0030606 3300048904 Bacteria 3776
534 Ga0496101_0063417 3300048904 Bacteria 2690
535 Ga0496101_0082018 3300048904 Bacteria 2386
536 Ga0496102_0149258 3300048905 Bacteria 2195
537 Ga0496103_0004812 3300048906 Bacteria 8157
538 Ga0496103_0041716 3300048906 Bacteria 2821
539 Ga0496104_0013702 3300048907 Bacteria 7310
540 Ga0496104_0170425 3300048907 Bacteria 2087
541 Ga0496104_0257044 3300048907 Bacteria 1659
542 Ga0496104_0623610 3300048907 Unclassified 988
543 Ga0496105_0035506 3300048908 Bacteria 4102
544 Ga0496105_0233350 3300048908 Bacteria 1494
545 Ga0496106_0006246 3300048909 Bacteria 8818
546 Ga0496106_0029989 3300048909 Bacteria 4055
547 Ga0496106_0124152 3300048909 Bacteria 2020
548 Ga0496107_0021262 3300048910 Bacteria 4586
549 Ga0496107_0072969 3300048910 Bacteria 2496
550 Ga0496108_0024365 3300048911 Bacteria 4981
551 Ga0496109_0001638 3300048912 Bacteria 18700
552 Ga0496109_0084610 3300048912 Bacteria 2926
553 Ga0496109_0386946 3300048912 Bacteria 1321
554 Ga0496110_0049590 3300048913 Bacteria 3683
555 Ga0496110_0204062 3300048913 Bacteria 1796
556 Ga0496111_0005028 3300048914 Bacteria 8410
557 Ga0496111_0068482 3300048914 Bacteria 2579
558 Ga0496111_0093096 3300048914 Bacteria 2209
559 Ga0496112_0000852 3300048915 Bacteria 21764
560 Ga0496112_0127295 3300048915 Bacteria 2517
561 Ga0496113_0000175 3300048916 Bacteria 28436
562 Ga0496113_0005782 3300048916 Bacteria 7753
563 Ga0496114_0012990 3300048917 Bacteria 6674
564 Ga0496115_0071168 3300048918 Bacteria 2820
565 Ga0496115_0078284 3300048918 Bacteria 2689
566 Ga0496116_0048461 3300048919 Bacteria 2851
567 Ga0496116_0073305 3300048919 Bacteria 2159
568 Ga0496117_0024067 3300048920 Bacteria 4829
569 Ga0496117_0028409 3300048920 Bacteria 4332
570 Ga0496117_0060609 3300048920 Bacteria 2606
571 Ga0496118_0013925 3300048921 Bacteria 7563
572 Ga0496121_0051436 3300048924 Bacteria 3469
573 Ga0496121_0095038 3300048924 Bacteria 2317
574 Ga0496122_0227542 3300048925 Bacteria 1064
575 Ga0496124_0021946 3300048927 Bacteria 5872
576 Ga0496124_0150891 3300048927 Bacteria 1823
577 Ga0496124_0326387 3300048927 Bacteria 1096
578 Ga0496125_0010440 3300048928 Bacteria 9394
579 Ga0496125_0095622 3300048928 Bacteria 2209
580 Ga0496125_0131223 3300048928 Bacteria 1763
581 Ga0496126_0334829 3300048929 Bacteria 1241
582 Ga0501292_009051 3300049515 Bacteria 1471
583 Ga0501031_0001052 3300049568 Bacteria 16740
584 Ga0501034_0231344 3300049571 Bacteria 1797
585 Ga0501036_0565521 3300049572 Bacteria 944
586 Ga0501038_0315197 3300049574 Bacteria 1225
587 Ga0501038_0354577 3300049574 Bacteria 1142
588 Ga0501047_0117437 3300049581 Bacteria 2542
589 Ga0501072_0142991 3300049588 Bacteria 1908
590 Ga0501223_004131 3300049663 Bacteria 3128
591 Ga0501249_004824 3300049679 Bacteria 2745
592 Ga0501253_012557 3300049683 Bacteria 1329
593 Ga0501221_022229 3300049704 Bacteria 1255
594 Ga0501225_0003847 3300049705 Bacteria 4505
595 Ga0501081_0145622 3300049743 Bacteria 1700
596 Ga0501262_003565 3300049759 Bacteria 1788
597 Ga0501265_004538 3300049762 Bacteria 1584
598 nmdc:mga03683_1072_c1 3300050489 Bacteria 8008
599 nmdc:mga03683_3450_c2 3300050489 Bacteria 3482
600 nmdc:mga03683_77218_c1 3300050489 Bacteria 1433
601 nmdc:mga03n38_232134_c1 3300050490 Bacteria 967
602 nmdc:mga03n38_32650_c1 3300050490 Bacteria 2208
603 nmdc:mga0yw44_4223_c1 3300050492 Bacteria 6542
604 nmdc:mga0yw44_460128_c1 3300050492 Bacteria 862
605 nmdc:mga0yw44_67569_c1 3300050492 Bacteria 2210
606 nmdc:mga0yw44_799_c1 3300050492 Bacteria 11724
607 nmdc:mga0k408_20964_c1 3300050493 Bacteria 3325
608 nmdc:mga0k408_272923_c1 3300050493 Bacteria 1010
609 nmdc:mga0k408_55334_c1 3300050493 Bacteria 2301
610 nmdc:mga0k408_67935_c1 3300050493 Bacteria 2078
611 nmdc:mga06z11_207622_c1 3300050494 Bacteria 1140
612 nmdc:mga04h51_68198_c1 3300050495 Bacteria 1235
613 nmdc:mga07m45_21486_c1 3300050496 Bacteria 3515
614 nmdc:mga07m45_25573_c1 3300050496 Bacteria 3239
615 nmdc:mga07m45_83_c1 3300050496 Bacteria 35468
616 nmdc:mga0qj67_417234_c1 3300050509 Bacteria 1082
617 nmdc:mga08y16_318649_c1 3300050511 Bacteria 1601
618 nmdc:mga08y16_65578_c1 3300050511 Bacteria 3790
619 Ga0495601_0042195 3300053077 Bacteria 2861
620 Ga0500610_0021582 3300053079 Bacteria 3162
621 Ga0495655_0001637 3300053083 Bacteria 3461
622 Ga0495619_0019305 3300053085 Bacteria 4332
623 Ga0495619_0262192 3300053085 Bacteria 1197
624 Ga0500651_0000328 3300053093 Bacteria 26797
625 Ga0500593_000328 3300053117 Bacteria 19163
626 Ga0500593_012616 3300053117 Bacteria 3588
627 Ga0500607_004248 3300053121 Bacteria 9969
628 Ga0500628_002450 3300053129 Bacteria 3068
629 Ga0500658_0000117 3300053134 Bacteria 37704
630 Ga0500658_0000393 3300053134 Bacteria 19079
631 Ga0500568_0009858 3300053139 Bacteria 4513
632 Ga0500574_024317 3300053141 Bacteria 1567
633 Ga0500616_0055110 3300053153 Bacteria 2080
634 Ga0500627_0017547 3300053158 Bacteria 2814
635 Ga0500634_0072388 3300053161 Bacteria 1799
636 Ga0500645_001273 3300053730 Bacteria 13201
637 Ga0530510_0049096 3300061734 Bacteria 3050
638 Ga0530510_0195965 3300061734 Bacteria 1500

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10701174 Ga0163162_107011742 220
2 3300005329 Ga0070683_100056060 Ga0070683_1000560603 221
3 3300005340 Ga0070689_100005913 Ga0070689_1000059136 221
4 3300005564 Ga0070664_100053777 Ga0070664_1000537772 221
5 3300005618 Ga0068864_100093567 Ga0068864_1000935672 221
6 3300005719 Ga0068861_100043266 Ga0068861_1000432664 221
7 3300005840 Ga0068870_10019601 Ga0068870_100196012 221
8 3300006237 Ga0097621_100014841 Ga0097621_1000148413 221
9 3300009094 Ga0111539_10043864 Ga0111539_100438643 221
10 3300009098 Ga0105245_10103501 Ga0105245_101035013 221
11 3300009148 Ga0105243_10022415 Ga0105243_100224152 221
12 3300009174 Ga0105241_10056041 Ga0105241_100560413 221
13 3300009545 Ga0105237_10195666 Ga0105237_101956663 221
14 3300009553 Ga0105249_10086461 Ga0105249_100864612 221
15 3300010375 Ga0105239_10052265 Ga0105239_100522653 221
16 3300013297 Ga0157378_10214115 Ga0157378_102141152 221
17 3300014968 Ga0157379_10030520 Ga0157379_100305203 221
18 3300014969 Ga0157376_10315775 Ga0157376_103157752 221
19 3300025321 Ga0207656_10007159 Ga0207656_100071592 221
20 3300025907 Ga0207645_10005156 Ga0207645_100051565 221
21 3300025919 Ga0207657_10026290 Ga0207657_100262903 221
22 3300025927 Ga0207687_10046561 Ga0207687_100465612 221
23 3300025933 Ga0207706_10008031 Ga0207706_100080319 221
24 3300025936 Ga0207670_10043362 Ga0207670_100433624 221
25 3300025940 Ga0207691_10003250 Ga0207691_100032507 221
26 3300025941 Ga0207711_10046284 Ga0207711_100462845 221
27 3300025942 Ga0207689_10012071 Ga0207689_100120715 221
28 3300026067 Ga0207678_10002574 Ga0207678_1000257411 221
29 3300026075 Ga0207708_10000993 Ga0207708_1000099312 221
30 3300026089 Ga0207648_10000840 Ga0207648_1000084018 221
31 3300028381 Ga0268264_10090835 Ga0268264_100908354 221
32 3300046457 Ga0495590_0038292 Ga0495590_0038292_652_1527 221
33 3300046516 Ga0495628_0112817 Ga0495628_0112817_586_1461 221
34 3300046519 Ga0495632_0051926 Ga0495632_0051926_462_1337 221
35 3300046522 Ga0495643_0076295 Ga0495643_0076295_117_992 221
36 3300046648 Ga0495611_0045987 Ga0495611_0045987_563_1438 221
37 3300046684 Ga0495669_0014120 Ga0495669_0014120_762_1637 221
38 3300047445 Ga0495677_0032346 Ga0495677_0032346_478_1353 221
39 3300047470 Ga0495681_0065094 Ga0495681_0065094_690_1565 221
40 3300048903 Ga0496100_0054743 Ga0496100_0054743_204_1079 221
41 3300048905 Ga0496102_0149258 Ga0496102_0149258_1127_2002 221
42 3300048906 Ga0496103_0004812 Ga0496103_0004812_1623_2498 221
43 3300048907 Ga0496104_0257044 Ga0496104_0257044_204_1079 221
44 3300048908 Ga0496105_0233350 Ga0496105_0233350_194_1069 221
45 3300048909 Ga0496106_0006246 Ga0496106_0006246_2340_3215 221
46 3300048910 Ga0496107_0021262 Ga0496107_0021262_194_1069 221
47 3300048911 Ga0496108_0024365 Ga0496108_0024365_1545_2420 221
48 3300048912 Ga0496109_0084610 Ga0496109_0084610_1184_2059 221
49 3300048914 Ga0496111_0068482 Ga0496111_0068482_965_1840 221
50 3300048915 Ga0496112_0127295 Ga0496112_0127295_1555_2430 221
51 3300048916 Ga0496113_0005782 Ga0496113_0005782_1718_2593 221
52 3300048917 Ga0496114_0012990 Ga0496114_0012990_605_1480 221
53 3300048918 Ga0496115_0078284 Ga0496115_0078284_194_1069 221
54 3300050511 nmdc:mga08y16_318649_c1 nmdc:mga08y16_318649_c1_53_928 221
55 3300053077 Ga0495601_0042195 Ga0495601_0042195_936_1811 221
56 3300053083 Ga0495655_0001637 Ga0495655_0001637_2453_3328 221
57 3300026121 Ga0207683_10004959 Ga0207683_100049595 223
58 3300050492 nmdc:mga0yw44_67569_c1 nmdc:mga0yw44_67569_c1_1206_2081 223
59 3300009177 Ga0105248_10079427 Ga0105248_100794275 224
60 3300035089 Ga0373944_0007063 Ga0373944_0007063_726_1550 229
61 3300035171 Ga0373946_0054221 Ga0373946_0054221_780_1616 229
62 3300035692 Ga0373935_0027835 Ga0373935_0027835_1969_2805 229
63 3300035695 Ga0373927_0049634 Ga0373927_0049634_65_901 229
64 3300035725 Ga0373947_0127411 Ga0373947_0127411_106_942 229
65 3300046455 Ga0495603_0027022 Ga0495603_0027022_1849_2685 229
66 3300046472 Ga0495580_0038734 Ga0495580_0038734_2296_3132 229
67 3300046473 Ga0495582_0076600 Ga0495582_0076600_374_1210 229
68 3300046475 Ga0495639_0073112 Ga0495639_0073112_609_1445 229
69 3300046501 Ga0495607_0109887 Ga0495607_0109887_406_1242 229
70 3300046523 Ga0495644_0010443 Ga0495644_0010443_1121_1966 229
71 3300046537 Ga0495598_0000201 Ga0495598_0000201_9160_9996 229
72 3300046539 Ga0495621_0110344 Ga0495621_0110344_97_933 229
73 3300046558 Ga0495633_0130209 Ga0495633_0130209_192_1028 229
74 3300046642 Ga0495634_0085323 Ga0495634_0085323_454_1305 229
75 3300046664 Ga0495659_0033534 Ga0495659_0033534_273_1097 229
76 3300046674 Ga0495588_0045119 Ga0495588_0045119_724_1548 229
77 3300046681 Ga0495647_0010122 Ga0495647_0010122_1607_2431 229
78 3300046683 Ga0495658_0092193 Ga0495658_0092193_807_1643 229
79 3300046690 Ga0495624_0027928 Ga0495624_0027928_712_1536 229
80 3300046692 Ga0495671_0090897 Ga0495671_0090897_464_1300 229
81 3300047315 Ga0495581_0121427 Ga0495581_0121427_399_1235 229
82 3300035118 Ga0373954_0144809 Ga0373954_0144809_260_1120 230
83 3300053085 Ga0495619_0019305 Ga0495619_0019305_2935_3786 230
84 3300061734 Ga0530510_0195965 Ga0530510_0195965_260_1069 230
85 3300049588 Ga0501072_0142991 Ga0501072_0142991_252_1079 231
86 3300061734 Ga0530510_0049096 Ga0530510_0049096_612_1421 231
87 3300049743 Ga0501081_0145622 Ga0501081_0145622_210_1019 232
88 3300048903 Ga0496100_0305621 Ga0496100_0305621_138_977 233
89 3300048904 Ga0496101_0082018 Ga0496101_0082018_636_1475 233
90 3300048918 Ga0496115_0071168 Ga0496115_0071168_1099_1938 233
91 3300053085 Ga0495619_0262192 Ga0495619_0262192_151_990 233
92 3300049574 Ga0501038_0354577 Ga0501038_0354577_396_1121 241
93 3300031238 Ga0265332_10003751 Ga0265332_100037512 246
94 3300050492 nmdc:mga0yw44_4223_c1 nmdc:mga0yw44_4223_c1_3195_3938 247
95 3300003187 JGI25151J46595_10010871 JGI25151J46595_100108715 248
96 3300005262 Ga0065165_1004502 Ga0065165_10045028 248
97 3300025245 Ga0207425_1001688 Ga0207425_10016882 248
98 3300025258 Ga0209129_1010651 Ga0209129_10106513 248
99 3300025263 Ga0209565_1000122 Ga0209565_100012275 248
100 3300025273 Ga0209673_1000302 Ga0209673_100030261 248
101 3300025284 Ga0209130_1000487 Ga0209130_100048735 248
102 3300025284 Ga0209130_1013513 Ga0209130_10135131 248
103 3300025291 Ga0209675_1000098 Ga0209675_1000098102 248
104 3300025292 Ga0209676_1000013 Ga0209676_1000013719 248
105 3300025292 Ga0209676_1003874 Ga0209676_10038744 248
106 3300025294 Ga0209025_1004202 Ga0209025_10042023 248
107 3300025294 Ga0209025_1005974 Ga0209025_10059744 248
108 3300025295 Ga0209564_1001169 Ga0209564_100116921 248
109 3300025295 Ga0209564_1004130 Ga0209564_10041305 248
110 3300025297 Ga0209758_1025763 Ga0209758_10257632 248
111 3300025298 Ga0209050_1000008 Ga0209050_1000008719 248
112 3300025298 Ga0209050_1006385 Ga0209050_10063856 248
113 3300025299 Ga0209256_1000039 Ga0209256_1000039318 248
114 3300025302 Ga0207426_1001771 Ga0207426_100177115 248
115 3300025303 Ga0209051_1000005 Ga0209051_1000005719 248
116 3300025303 Ga0209051_1078175 Ga0209051_10781751 248
117 3300025304 Ga0209257_1000031 Ga0209257_1000031309 248
118 3300041505 Ga0451849_1538263 Ga0451849_1538263_19_765 248
119 3300039437 Ga0436365_1241421 Ga0436365_1241421_59_817 252
120 3300003323 rootH1_10398388 rootH1_103983882 253
121 3300048907 Ga0496104_0623610 Ga0496104_0623610_75_848 253
122 iso_pu_bacteria 2511231002 2511246025 253
123 iso_pu_bacteria 2599185214 2599626343 253
124 iso_pu_bacteria 2599185226 2599676333 253
125 iso_pu_bacteria 2599185227 2599682045 253
126 iso_pu_bacteria 2599185229 2599695695 253
127 iso_pu_bacteria 2643221570 2643864127 253
128 iso_pu_bacteria 2643221596 2643992427 253
129 iso_pu_bacteria 2643221628 2644161707 253
130 iso_pu_bacteria 2643221652 2644292170 253
131 iso_pu_bacteria 2643221683 2644466884 253
132 iso_pu_bacteria 2738541277 2738721315 253
133 iso_pu_bacteria 2738541307 2738880658 253
134 iso_pu_bacteria 2738543012 2739245747 253
135 iso_pu_bacteria 2738543019 2739280984 253
136 iso_pu_bacteria 2816332133 2816470349 253
137 iso_pu_bacteria 2818991446 2819601622 253
138 iso_pu_bacteria 2831265667 2831269233 253
139 iso_pu_bacteria 2838054893 2838059210 253
140 iso_pu_bacteria 2842677519 2842680331 253
141 iso_pu_bacteria 2881101125 2881105360 253
142 iso_pu_bacteria 2885198086 2885203052 253
143 iso_pu_bacteria 2885211737 2885216551 253
144 iso_pu_bacteria 2899924645 2899930685 253
145 iso_pu_bacteria 2904449895 2904452591 253
146 iso_pu_bacteria 2904456579 2904460810 253
147 iso_pu_bacteria 2904541872 2904545310 253
148 iso_pu_bacteria 2919462493 2919463777 253
149 iso_pu_bacteria 2928037797 2928040993 253
150 iso_pu_bacteria 2928044640 2928047835 253
151 iso_pu_bacteria 2928051484 2928055727 253
152 iso_pu_bacteria 2928064002 2928069826 253
153 iso_pu_bacteria 2928070936 2928075313 253
154 iso_pu_bacteria 2928084124 2928088530 253
155 iso_pu_bacteria 2929160207 2929165502 253
156 iso_pu_bacteria 2929520902 2929522543 253
157 iso_pu_bacteria 2945909444 2945909828 253
158 iso_pu_bacteria 2945945610 2945945906 253
159 iso_pu_bacteria 2945972063 2945975522 253
160 iso_pu_bacteria 2945984333 2945988179 253
161 iso_pu_bacteria 2954767861 2954769035 253
162 3300005618 Ga0068864_100452994 Ga0068864_1004529941 254
163 3300005841 Ga0068863_100181602 Ga0068863_1001816022 254
164 3300026088 Ga0207641_10253602 Ga0207641_102536022 254
165 iso_pu_bacteria 2513020051 2513230664 254
166 iso_pu_bacteria 2547132374 2548501750 254
167 iso_pu_bacteria 2643221658 2644328517 254
168 iso_pu_bacteria 2643221672 2644399754 254
169 iso_pu_bacteria 2643221717 2644646523 254
170 iso_pu_bacteria 2728368998 2728754080 254
171 iso_pu_bacteria 2738543013 2739249577 254
172 iso_pu_bacteria 2885192300 2885192988 254
173 iso_pu_bacteria 2939631187 2939636653 254
174 3300013306 Ga0163162_10004457 Ga0163162_100044576 255
175 3300046694 Ga0495649_0000010 Ga0495649_0000010_362825_363619 255
176 3300006048 Ga0075363_100150362 Ga0075363_1001503622 256
177 3300006353 Ga0075370_10063897 Ga0075370_100638972 256
178 3300013306 Ga0163162_10290805 Ga0163162_102908051 256
179 3300046539 Ga0495621_0111200 Ga0495621_0111200_57_830 256
180 3300001989 JGI24739J22299_10034117 JGI24739J22299_100341172 257
181 3300002704 JGI25155J39150_1000009 JGI25155J39150_1000009184 257
182 3300002705 JGI25156J39149_1000009 JGI25156J39149_100000936 257
183 3300002738 JGI25154J39366_1000024 JGI25154J39366_100002436 257
184 3300002741 JGI25157J39369_1000007 JGI25157J39369_100000736 257
185 3300002773 JGI25152J39213_1010759 JGI25152J39213_10107592 257
186 3300002774 JGI25150J39212_1005464 JGI25150J39212_10054642 257
187 3300002987 JGI25159J45721_1000286 JGI25159J45721_10002869 257
188 3300003187 JGI25151J46595_10013564 JGI25151J46595_100135643 257
189 3300003187 JGI25151J46595_10028708 JGI25151J46595_100287082 257
190 3300003215 JGI25153J46596_10026233 JGI25153J46596_100262332 257
191 3300003215 JGI25153J46596_10036612 JGI25153J46596_100366122 257
192 3300003316 rootH1_10010835 rootH1_100108351 257
193 3300003320 rootH2_10131427 rootH2_101314272 257
194 3300003354 JGI25160J50197_1000242 JGI25160J50197_100024235 257
195 3300003374 JGI25161J50226_1000009 JGI25161J50226_1000009192 257
196 3300003578 Ga0006562J51391_1032156 Ga0006562J51391_10321562 257
197 3300003578 Ga0006562J51391_1050707 Ga0006562J51391_10507072 257
198 3300003761 Ga0055535_1000422 Ga0055535_100042224 257
199 3300003762 Ga0055542_1000074 Ga0055542_100007487 257
200 3300003771 Ga0055526_1000764 Ga0055526_10007648 257
201 3300003771 Ga0055526_1002603 Ga0055526_100260310 257
202 3300003773 Ga0055537_1000235 Ga0055537_100023534 257
203 3300003773 Ga0055537_1001179 Ga0055537_10011792 257
204 3300003773 Ga0055537_1004150 Ga0055537_10041503 257
205 3300003773 Ga0055537_1005789 Ga0055537_10057893 257
206 3300003773 Ga0055537_1008729 Ga0055537_10087292 257
207 3300003775 Ga0055524_1000143 Ga0055524_100014357 257
208 3300003781 Ga0055536_1001550 Ga0055536_10015502 257
209 3300003781 Ga0055536_1002402 Ga0055536_10024027 257
210 3300003784 Ga0055534_1000612 Ga0055534_10006128 257
211 3300003784 Ga0055534_1001150 Ga0055534_100115013 257
212 3300003784 Ga0055534_1007325 Ga0055534_10073252 257
213 3300003784 Ga0055534_1009176 Ga0055534_10091762 257
214 3300003784 Ga0055534_1009747 Ga0055534_10097472 257
215 3300003790 Ga0055528_1001546 Ga0055528_10015464 257
216 3300003790 Ga0055528_1003188 Ga0055528_10031884 257
217 3300003790 Ga0055528_1007187 Ga0055528_10071873 257
218 3300003790 Ga0055528_1012716 Ga0055528_10127163 257
219 3300003790 Ga0055528_1022021 Ga0055528_10220212 257
220 3300003791 Ga0055530_10000474 Ga0055530_1000047426 257
221 3300003791 Ga0055530_10001693 Ga0055530_100016934 257
222 3300003791 Ga0055530_10012948 Ga0055530_100129482 257
223 3300003791 Ga0055530_10053448 Ga0055530_100534481 257
224 3300003792 Ga0055540_1000027 Ga0055540_1000027146 257
225 3300003792 Ga0055540_1001360 Ga0055540_10013604 257
226 3300003792 Ga0055540_1004336 Ga0055540_10043363 257
227 3300003794 Ga0055531_10000465 Ga0055531_1000046510 257
228 3300003794 Ga0055531_10001603 Ga0055531_100016038 257
229 3300003794 Ga0055531_10001892 Ga0055531_1000189210 257
230 3300004625 Ga0055543_1001141 Ga0055543_10011415 257
231 3300004625 Ga0055543_1001635 Ga0055543_10016353 257
232 3300005262 Ga0065165_1005558 Ga0065165_10055584 257
233 3300005262 Ga0065165_1006879 Ga0065165_10068793 257
234 3300005288 Ga0065714_10105539 Ga0065714_101055391 257
235 3300005327 Ga0070658_10034550 Ga0070658_100345502 257
236 3300005327 Ga0070658_10108697 Ga0070658_101086972 257
237 3300005335 Ga0070666_10106400 Ga0070666_101064002 257
238 3300005336 Ga0070680_100136961 Ga0070680_1001369612 257
239 3300005338 Ga0068868_100056705 Ga0068868_1000567052 257
240 3300005338 Ga0068868_100114392 Ga0068868_1001143922 257
241 3300005339 Ga0070660_100029168 Ga0070660_1000291683 257
242 3300005364 Ga0070673_100331359 Ga0070673_1003313591 257
243 3300005366 Ga0070659_100293976 Ga0070659_1002939762 257
244 3300005367 Ga0070667_100017811 Ga0070667_1000178112 257
245 3300005367 Ga0070667_100629041 Ga0070667_1006290411 257
246 3300005455 Ga0070663_100107872 Ga0070663_1001078722 257
247 3300005456 Ga0070678_100210272 Ga0070678_1002102722 257
248 3300005457 Ga0070662_100009652 Ga0070662_1000096524 257
249 3300005457 Ga0070662_100309717 Ga0070662_1003097172 257
250 3300005459 Ga0068867_100030840 Ga0068867_1000308402 257
251 3300005468 Ga0070707_100184730 Ga0070707_1001847302 257
252 3300005530 Ga0070679_100206942 Ga0070679_1002069422 257
253 3300005539 Ga0068853_100059027 Ga0068853_1000590272 257
254 3300005539 Ga0068853_100074017 Ga0068853_1000740172 257
255 3300005539 Ga0068853_100255784 Ga0068853_1002557842 257
256 3300005548 Ga0070665_100011220 Ga0070665_1000112202 257
257 3300005563 Ga0068855_100605676 Ga0068855_1006056761 257
258 3300005564 Ga0070664_100006223 Ga0070664_1000062237 257
259 3300005564 Ga0070664_100121530 Ga0070664_1001215302 257
260 3300005577 Ga0068857_100042748 Ga0068857_1000427483 257
261 3300005578 Ga0068854_100155187 Ga0068854_1001551871 257
262 3300005616 Ga0068852_100018914 Ga0068852_1000189143 257
263 3300005616 Ga0068852_100411181 Ga0068852_1004111811 257
264 3300005618 Ga0068864_100161123 Ga0068864_1001611232 257
265 3300005718 Ga0068866_10263672 Ga0068866_102636722 257
266 3300005718 Ga0068866_10267595 Ga0068866_102675952 257
267 3300005834 Ga0068851_10004316 Ga0068851_100043165 257
268 3300005844 Ga0068862_100120510 Ga0068862_1001205102 257
269 3300006038 Ga0075365_10007399 Ga0075365_100073995 257
270 3300006038 Ga0075365_10041110 Ga0075365_100411101 257
271 3300006038 Ga0075365_10046436 Ga0075365_100464362 257
272 3300006048 Ga0075363_100054659 Ga0075363_1000546592 257
273 3300006048 Ga0075363_100056327 Ga0075363_1000563272 257
274 3300006048 Ga0075363_100065449 Ga0075363_1000654492 257
275 3300006048 Ga0075363_100112523 Ga0075363_1001125231 257
276 3300006048 Ga0075363_100165829 Ga0075363_1001658292 257
277 3300006058 Ga0075432_10010858 Ga0075432_100108581 257
278 3300006177 Ga0075362_10029242 Ga0075362_100292422 257
279 3300006177 Ga0075362_10071658 Ga0075362_100716582 257
280 3300006177 Ga0075362_10099937 Ga0075362_100999372 257
281 3300006177 Ga0075362_10119556 Ga0075362_101195562 257
282 3300006177 Ga0075362_10184126 Ga0075362_101841261 257
283 3300006178 Ga0075367_10140358 Ga0075367_101403582 257
284 3300006195 Ga0075366_10002402 Ga0075366_100024023 257
285 3300006195 Ga0075366_10010869 Ga0075366_100108695 257
286 3300006195 Ga0075366_10061274 Ga0075366_100612742 257
287 3300006195 Ga0075366_10160694 Ga0075366_101606942 257
288 3300006353 Ga0075370_10000174 Ga0075370_1000017420 257
289 3300006353 Ga0075370_10009118 Ga0075370_100091186 257
290 3300006353 Ga0075370_10024397 Ga0075370_100243973 257
291 3300006353 Ga0075370_10250572 Ga0075370_102505721 257
292 3300006358 Ga0068871_100820359 Ga0068871_1008203591 257
293 3300006846 Ga0075430_100050168 Ga0075430_1000501682 257
294 3300006946 Ga0079104_1022241 Ga0079104_10222411 257
295 3300006946 Ga0079104_1042794 Ga0079104_10427941 257
296 3300006948 Ga0099826_10003378 Ga0099826_1000337810 257
297 3300009036 Ga0105244_10001684 Ga0105244_1000168416 257
298 3300009093 Ga0105240_10075554 Ga0105240_100755542 257
299 3300009098 Ga0105245_10112726 Ga0105245_101127262 257
300 3300009148 Ga0105243_10000651 Ga0105243_1000065124 257
301 3300009174 Ga0105241_10035536 Ga0105241_100355363 257
302 3300009174 Ga0105241_10660247 Ga0105241_106602471 257
303 3300009545 Ga0105237_10010332 Ga0105237_1001033210 257
304 3300009545 Ga0105237_10339405 Ga0105237_103394051 257
305 3300009551 Ga0105238_10061871 Ga0105238_100618712 257
306 3300009551 Ga0105238_10394048 Ga0105238_103940482 257
307 3300010375 Ga0105239_10422318 Ga0105239_104223182 257
308 3300011119 Ga0105246_10244001 Ga0105246_102440012 257
309 3300012513 Ga0157326_1002040 Ga0157326_10020402 257
310 3300013100 Ga0157373_10097251 Ga0157373_100972512 257
311 3300013100 Ga0157373_10101670 Ga0157373_101016702 257
312 3300013102 Ga0157371_10011999 Ga0157371_100119996 257
313 3300013104 Ga0157370_10010090 Ga0157370_1001009012 257
314 3300013105 Ga0157369_10104078 Ga0157369_101040782 257
315 3300013297 Ga0157378_10113331 Ga0157378_101133312 257
316 3300013306 Ga0163162_10141172 Ga0163162_101411722 257
317 3300013306 Ga0163162_10603683 Ga0163162_106036832 257
318 3300014325 Ga0163163_10032774 Ga0163163_100327744 257
319 3300014325 Ga0163163_10151219 Ga0163163_101512192 257
320 3300014326 Ga0157380_10102885 Ga0157380_101028852 257
321 3300014497 Ga0182008_10002904 Ga0182008_100029042 257
322 3300014497 Ga0182008_10003704 Ga0182008_100037043 257
323 3300014497 Ga0182008_10049983 Ga0182008_100499832 257
324 3300014969 Ga0157376_10001487 Ga0157376_100014876 257
325 3300014969 Ga0157376_10458427 Ga0157376_104584272 257
326 3300015261 Ga0182006_1001051 Ga0182006_10010513 257
327 3300015262 Ga0182007_10001491 Ga0182007_100014918 257
328 3300015262 Ga0182007_10006789 Ga0182007_100067894 257
329 3300015683 Ga0183362_10005 Ga0183362_10005262 257
330 3300017792 Ga0163161_10010507 Ga0163161_100105073 257
331 3300017792 Ga0163161_10080406 Ga0163161_100804062 257
332 3300017792 Ga0163161_10100266 Ga0163161_101002662 257
333 3300025206 Ga0209435_100051 Ga0209435_10005160 257
334 3300025228 Ga0209672_100519 Ga0209672_10051920 257
335 3300025229 Ga0209147_100419 Ga0209147_1004196 257
336 3300025242 Ga0209258_100176 Ga0209258_10017654 257
337 3300025245 Ga0207425_1000873 Ga0207425_100087311 257
338 3300025245 Ga0207425_1001776 Ga0207425_10017764 257
339 3300025246 Ga0209646_1000029 Ga0209646_1000029336 257
340 3300025250 Ga0209026_1000016 Ga0209026_1000016336 257
341 3300025254 Ga0209148_1000033 Ga0209148_1000033185 257
342 3300025256 Ga0209759_1000016 Ga0209759_1000016336 257
343 3300025258 Ga0209129_1000270 Ga0209129_100027054 257
344 3300025258 Ga0209129_1003689 Ga0209129_10036892 257
345 3300025258 Ga0209129_1008653 Ga0209129_10086533 257
346 3300025258 Ga0209129_1008732 Ga0209129_10087322 257
347 3300025263 Ga0209565_1000020 Ga0209565_1000020295 257
348 3300025263 Ga0209565_1000373 Ga0209565_100037310 257
349 3300025263 Ga0209565_1001818 Ga0209565_10018186 257
350 3300025263 Ga0209565_1003152 Ga0209565_10031525 257
351 3300025273 Ga0209673_1000209 Ga0209673_100020992 257
352 3300025273 Ga0209673_1001386 Ga0209673_100138623 257
353 3300025273 Ga0209673_1003803 Ga0209673_10038036 257
354 3300025284 Ga0209130_1000014 Ga0209130_100001436 257
355 3300025284 Ga0209130_1000335 Ga0209130_100033544 257
356 3300025284 Ga0209130_1000495 Ga0209130_10004959 257
357 3300025284 Ga0209130_1001175 Ga0209130_100117515 257
358 3300025284 Ga0209130_1007904 Ga0209130_10079042 257
359 3300025291 Ga0209675_1000014 Ga0209675_1000014284 257
360 3300025291 Ga0209675_1001308 Ga0209675_10013086 257
361 3300025291 Ga0209675_1003982 Ga0209675_10039826 257
362 3300025291 Ga0209675_1005447 Ga0209675_10054474 257
363 3300025291 Ga0209675_1014889 Ga0209675_10148892 257
364 3300025292 Ga0209676_1000048 Ga0209676_1000048144 257
365 3300025292 Ga0209676_1000124 Ga0209676_1000124202 257
366 3300025292 Ga0209676_1000604 Ga0209676_10006042 257
367 3300025292 Ga0209676_1006692 Ga0209676_10066922 257
368 3300025294 Ga0209025_1000324 Ga0209025_100032493 257
369 3300025294 Ga0209025_1000597 Ga0209025_100059761 257
370 3300025294 Ga0209025_1000733 Ga0209025_10007336 257
371 3300025294 Ga0209025_1005897 Ga0209025_10058973 257
372 3300025294 Ga0209025_1010658 Ga0209025_10106585 257
373 3300025294 Ga0209025_1016839 Ga0209025_10168392 257
374 3300025295 Ga0209564_1000423 Ga0209564_100042372 257
375 3300025295 Ga0209564_1001202 Ga0209564_100120221 257
376 3300025295 Ga0209564_1003808 Ga0209564_10038083 257
377 3300025297 Ga0209758_1000833 Ga0209758_100083343 257
378 3300025297 Ga0209758_1003579 Ga0209758_10035798 257
379 3300025298 Ga0209050_1000012 Ga0209050_1000012144 257
380 3300025298 Ga0209050_1001045 Ga0209050_100104520 257
381 3300025298 Ga0209050_1002039 Ga0209050_100203910 257
382 3300025299 Ga0209256_1000095 Ga0209256_1000095143 257
383 3300025299 Ga0209256_1000527 Ga0209256_100052754 257
384 3300025302 Ga0207426_1000161 Ga0207426_100016128 257
385 3300025302 Ga0207426_1000224 Ga0207426_100022436 257
386 3300025302 Ga0207426_1000955 Ga0207426_10009556 257
387 3300025303 Ga0209051_1000019 Ga0209051_100001963 257
388 3300025303 Ga0209051_1000099 Ga0209051_1000099150 257
389 3300025303 Ga0209051_1000117 Ga0209051_100011748 257
390 3300025303 Ga0209051_1000207 Ga0209051_100020783 257
391 3300025303 Ga0209051_1000833 Ga0209051_100083321 257
392 3300025303 Ga0209051_1011109 Ga0209051_10111092 257
393 3300025304 Ga0209257_1000024 Ga0209257_100002490 257
394 3300025304 Ga0209257_1000161 Ga0209257_10001619 257
395 3300025304 Ga0209257_1000258 Ga0209257_100025829 257
396 3300025304 Ga0209257_1004843 Ga0209257_10048432 257
397 3300025304 Ga0209257_1009295 Ga0209257_10092954 257
398 3300025304 Ga0209257_1011333 Ga0209257_10113334 257
399 3300025304 Ga0209257_1061272 Ga0209257_10612721 257
400 3300025321 Ga0207656_10036545 Ga0207656_100365453 257
401 3300025728 Ga0207655_1001510 Ga0207655_100151021 257
402 3300025728 Ga0207655_1079886 Ga0207655_10798862 257
403 3300025903 Ga0207680_10272860 Ga0207680_102728601 257
404 3300025907 Ga0207645_10008002 Ga0207645_100080022 257
405 3300025913 Ga0207695_10133853 Ga0207695_101338532 257
406 3300025919 Ga0207657_10041810 Ga0207657_100418102 257
407 3300025921 Ga0207652_10178927 Ga0207652_101789272 257
408 3300025924 Ga0207694_10319898 Ga0207694_103198981 257
409 3300025925 Ga0207650_10001983 Ga0207650_100019835 257
410 3300025925 Ga0207650_10253994 Ga0207650_102539941 257
411 3300025927 Ga0207687_10034205 Ga0207687_100342052 257
412 3300025931 Ga0207644_10030857 Ga0207644_100308572 257
413 3300025933 Ga0207706_10001771 Ga0207706_1000177119 257
414 3300025933 Ga0207706_10142747 Ga0207706_101427472 257
415 3300025935 Ga0207709_10000313 Ga0207709_1000031339 257
416 3300025935 Ga0207709_10000669 Ga0207709_100006697 257
417 3300025937 Ga0207669_10422166 Ga0207669_104221662 257
418 3300025940 Ga0207691_10242744 Ga0207691_102427442 257
419 3300025942 Ga0207689_10161431 Ga0207689_101614312 257
420 3300025945 Ga0207679_10010834 Ga0207679_100108343 257
421 3300025949 Ga0207667_10898832 Ga0207667_108988321 257
422 3300025981 Ga0207640_10033788 Ga0207640_100337882 257
423 3300025981 Ga0207640_10344330 Ga0207640_103443302 257
424 3300025986 Ga0207658_10089906 Ga0207658_100899062 257
425 3300026023 Ga0207677_10050142 Ga0207677_100501422 257
426 3300026023 Ga0207677_10068824 Ga0207677_100688242 257
427 3300026041 Ga0207639_10003657 Ga0207639_1000365712 257
428 3300026078 Ga0207702_10144336 Ga0207702_101443363 257
429 3300026078 Ga0207702_10320911 Ga0207702_103209112 257
430 3300026089 Ga0207648_10012123 Ga0207648_100121236 257
431 3300026089 Ga0207648_10238338 Ga0207648_102383382 257
432 3300026116 Ga0207674_10033584 Ga0207674_100335843 257
433 3300026116 Ga0207674_10243751 Ga0207674_102437512 257
434 3300027111 Ga0209281_1018111 Ga0209281_10181112 257
435 3300027111 Ga0209281_1029678 Ga0209281_10296781 257
436 3300027252 Ga0209973_1002078 Ga0209973_10020782 257
437 3300027666 Ga0209282_1003178 Ga0209282_10031784 257
438 3300027682 Ga0209971_1005374 Ga0209971_10053742 257
439 3300027866 Ga0209813_10078738 Ga0209813_100787382 257
440 3300027876 Ga0209974_10015870 Ga0209974_100158701 257
441 3300027907 Ga0207428_10098286 Ga0207428_100982862 257
442 3300028379 Ga0268266_10021473 Ga0268266_100214734 257
443 3300028380 Ga0268265_10247966 Ga0268265_102479662 257
444 3300028794 Ga0307515_10000040 Ga0307515_1000004064 257
445 3300028794 Ga0307515_10000458 Ga0307515_1000045848 257
446 3300028794 Ga0307515_10106766 Ga0307515_101067662 257
447 3300028794 Ga0307515_10147541 Ga0307515_101475412 257
448 3300030522 Ga0307512_10174892 Ga0307512_101748922 257
449 3300030731 Ga0316177_1103696 Ga0316177_11036961 257
450 3300030733 Ga0314311_1049345 Ga0314311_104934512 257
451 3300030735 Ga0316178_1053423 Ga0316178_10534238 257
452 3300030742 Ga0316183_1023591 Ga0316183_10235912 257
453 3300030742 Ga0316183_1194403 Ga0316183_11944033 257
454 3300030744 Ga0316181_1061609 Ga0316181_10616091 257
455 3300030745 Ga0316182_1044621 Ga0316182_10446215 257
456 3300031235 Ga0265330_10054816 Ga0265330_100548162 257
457 3300031250 Ga0265331_10060652 Ga0265331_100606521 257
458 3300031251 Ga0265327_10119761 Ga0265327_101197612 257
459 3300031251 Ga0265327_10140962 Ga0265327_101409621 257
460 3300031456 Ga0307513_10000194 Ga0307513_100001946 257
461 3300031456 Ga0307513_10001393 Ga0307513_100013937 257
462 3300031456 Ga0307513_10154016 Ga0307513_101540162 257
463 3300031548 Ga0307408_100000171 Ga0307408_1000001717 257
464 3300031548 Ga0307408_100007277 Ga0307408_1000072772 257
465 3300031548 Ga0307408_100076061 Ga0307408_1000760612 257
466 3300031649 Ga0307514_10000828 Ga0307514_100008288 257
467 3300031649 Ga0307514_10026727 Ga0307514_100267274 257
468 3300031691 Ga0316579_10000177 Ga0316579_1000017716 257
469 3300031711 Ga0265314_10020869 Ga0265314_100208694 257
470 3300031711 Ga0265314_10036600 Ga0265314_100366002 257
471 3300031712 Ga0265342_10022315 Ga0265342_100223153 257
472 3300031712 Ga0265342_10047726 Ga0265342_100477261 257
473 3300031727 Ga0316576_10018905 Ga0316576_100189052 257
474 3300031728 Ga0316578_10028686 Ga0316578_100286862 257
475 3300031730 Ga0307516_10006663 Ga0307516_100066639 257
476 3300031731 Ga0307405_10028542 Ga0307405_100285422 257
477 3300031731 Ga0307405_10139849 Ga0307405_101398491 257
478 3300031733 Ga0316577_10001607 Ga0316577_100016074 257
479 3300031901 Ga0307406_10001400 Ga0307406_1000140011 257
480 3300031901 Ga0307406_10007237 Ga0307406_100072372 257
481 3300031901 Ga0307406_10188084 Ga0307406_101880842 257
482 3300031911 Ga0307412_10084078 Ga0307412_100840783 257
483 3300031911 Ga0307412_10214401 Ga0307412_102144011 257
484 3300031911 Ga0307412_10252776 Ga0307412_102527762 257
485 3300031911 Ga0307412_10490751 Ga0307412_104907512 257
486 3300031911 Ga0307412_10523127 Ga0307412_105231271 257
487 3300032002 Ga0307416_100222755 Ga0307416_1002227552 257
488 3300032002 Ga0307416_100494104 Ga0307416_1004941042 257
489 3300032002 Ga0307416_100506143 Ga0307416_1005061432 257
490 3300032005 Ga0307411_10138374 Ga0307411_101383741 257
491 3300032137 Ga0316585_10021205 Ga0316585_100212052 257
492 3300032139 Ga0316580_10000077 Ga0316580_100000771 257
493 3300033524 Ga0316592_1019927 Ga0316592_10199271 257
494 3300035398 Ga0316574_0000453 Ga0316574_0000453_6548_7330 257
495 3300036647 Ga0316582_0002708 Ga0316582_0002708_6946_7728 257
496 3300036712 Ga0316584_0061444 Ga0316584_0061444_42_824 257
497 3300037312 Ga0395899_0086470 Ga0395899_0086470_1146_1919 257
498 3300037418 Ga0395900_0052621 Ga0395900_0052621_2493_3266 257
499 3300037418 Ga0395900_0266776 Ga0395900_0266776_601_1374 257
500 3300037466 Ga0395898_0004483 Ga0395898_0004483_2774_3550 257
501 3300037466 Ga0395898_0019317 Ga0395898_0019317_4373_5146 257
502 3300037466 Ga0395898_0150582 Ga0395898_0150582_1145_1918 257
503 3300037466 Ga0395898_0330291 Ga0395898_0330291_247_1068 257
504 3300037471 Ga0395905_0000132 Ga0395905_0000132_92329_93102 257
505 3300037471 Ga0395905_0000773 Ga0395905_0000773_5838_6632 257
506 3300037471 Ga0395905_0020265 Ga0395905_0020265_1665_2438 257
507 3300037471 Ga0395905_0020548 Ga0395905_0020548_2218_3039 257
508 3300037471 Ga0395905_0032508 Ga0395905_0032508_3948_4844 257
509 3300037471 Ga0395905_0045023 Ga0395905_0045023_185_958 257
510 3300037471 Ga0395905_0463096 Ga0395905_0463096_286_1059 257
511 3300038443 Ga0395901_0061368 Ga0395901_0061368_926_1699 257
512 3300038443 Ga0395901_0099473 Ga0395901_0099473_2102_2878 257
513 3300038443 Ga0395901_0191808 Ga0395901_0191808_396_1217 257
514 3300038443 Ga0395901_0306610 Ga0395901_0306610_600_1412 257
515 3300038443 Ga0395901_0387156 Ga0395901_0387156_651_1424 257
516 3300039447 Ga0436361_0206236 Ga0436361_0206236_14494_15282 257
517 3300041404 Ga0439436_0033022 Ga0439436_0033022_144_920 257
518 3300041404 Ga0439436_0048747 Ga0439436_0048747_415_1188 257
519 3300041405 Ga0439438_035333 Ga0439438_035333_318_1091 257
520 3300041406 Ga0439439_0004892 Ga0439439_0004892_1566_2339 257
521 3300041411 Ga0439466_0017020 Ga0439466_0017020_1425_2198 257
522 3300041411 Ga0439466_0031968 Ga0439466_0031968_151_924 257
523 3300041413 Ga0439465_0004122 Ga0439465_0004122_2851_3627 257
524 3300041452 Ga0451793_0841222 Ga0451793_0841222_72_848 257
525 3300041453 Ga0451797_1279811 Ga0451797_1279811_174_947 257
526 3300041458 Ga0451798_0376783 Ga0451798_0376783_498_1271 257
527 3300041486 Ga0451807_0205605 Ga0451807_0205605_198_971 257
528 3300041512 Ga0451853_2214512 Ga0451853_2214512_294_1067 257
529 3300041997 Ga0439431_0004094 Ga0439431_0004094_2034_2810 257
530 3300041999 Ga0439433_0011737 Ga0439433_0011737_533_1321 257
531 3300041999 Ga0439433_0012763 Ga0439433_0012763_912_1685 257
532 3300042002 Ga0439442_001658 Ga0439442_001658_578_1351 257
533 3300042004 Ga0439445_0040432 Ga0439445_0040432_274_1047 257
534 3300042004 Ga0439445_0043154 Ga0439445_0043154_125_898 257
535 3300042006 Ga0439432_001627 Ga0439432_001627_2981_3757 257
536 3300042006 Ga0439432_040723 Ga0439432_040723_421_1197 257
537 3300042006 Ga0439432_054420 Ga0439432_054420_420_1193 257
538 3300042007 Ga0439449_0000571 Ga0439449_0000571_2925_3701 257
539 3300042007 Ga0439449_0010193 Ga0439449_0010193_587_1375 257
540 3300042007 Ga0439449_0027811 Ga0439449_0027811_545_1321 257
541 3300042010 Ga0439452_000889 Ga0439452_000889_3207_3983 257
542 3300042010 Ga0439452_004162 Ga0439452_004162_2141_2914 257
543 3300042014 Ga0439457_021025 Ga0439457_021025_32_805 257
544 3300042014 Ga0439457_026479 Ga0439457_026479_103_879 257
545 3300042015 Ga0439462_0000395 Ga0439462_0000395_5661_6449 257
546 3300042015 Ga0439462_0003003 Ga0439462_0003003_2598_3371 257
547 3300042015 Ga0439462_0033542 Ga0439462_0033542_107_883 257
548 3300042115 Ga0450911_001876 Ga0450911_001876_557_1330 257
549 3300042125 Ga0450923_000153 Ga0450923_000153_1654_2439 257
550 3300042125 Ga0450923_004312 Ga0450923_004312_701_1474 257
551 3300042126 Ga0450888_000733 Ga0450888_000733_623_1438 257
552 3300042133 Ga0450896_009789 Ga0450896_009789_284_1057 257
553 3300042134 Ga0450898_009975 Ga0450898_009975_719_1492 257
554 3300042134 Ga0450898_027951 Ga0450898_027951_106_879 257
555 3300042145 Ga0450906_003909 Ga0450906_003909_766_1539 257
556 3300042146 Ga0450907_009943 Ga0450907_009943_126_899 257
557 3300042147 Ga0450910_003552 Ga0450910_003552_519_1292 257
558 3300042185 Ga0450909_006945 Ga0450909_006945_468_1241 257
559 3300042185 Ga0450909_008427 Ga0450909_008427_394_1170 257
560 3300042439 Ga0439464_0020302 Ga0439464_0020302_433_1209 257
561 3300042531 Ga0450918_002160 Ga0450918_002160_2397_3170 257
562 3300042532 Ga0450893_0000734 Ga0450893_0000734_1082_1897 257
563 3300042532 Ga0450893_0001087 Ga0450893_0001087_3110_3883 257
564 3300042532 Ga0450893_0028823 Ga0450893_0028823_155_928 257
565 3300042876 Ga0451577_0000235 Ga0451577_0000235_84351_85127 257
566 3300042876 Ga0451577_0033005 Ga0451577_0033005_2698_3504 257
567 3300044656 Ga0466969_0056259 Ga0466969_0056259_885_1658 257
568 3300044656 Ga0466969_0066543 Ga0466969_0066543_129_902 257
569 3300044673 Ga0453683_0000588 Ga0453683_0000588_33879_34655 257
570 3300044673 Ga0453683_0002178 Ga0453683_0002178_14482_15288 257
571 3300044684 Ga0466966_0005481 Ga0466966_0005481_7365_8138 257
572 3300044712 Ga0453684_0000906 Ga0453684_0000906_73476_74252 257
573 3300044712 Ga0453684_0048485 Ga0453684_0048485_2112_2918 257
574 3300044712 Ga0453684_0421008 Ga0453684_0421008_562_1344 257
575 3300044735 Ga0466968_0043761 Ga0466968_0043761_178_999 257
576 3300044765 Ga0466970_0073416 Ga0466970_0073416_26_799 257
577 3300044901 Ga0466960_0133422 Ga0466960_0133422_283_1059 257
578 3300045049 Ga0466959_0120105 Ga0466959_0120105_244_1017 257
579 3300045051 Ga0451576_0016371 Ga0451576_0016371_6859_7635 257
580 3300045051 Ga0451576_0209915 Ga0451576_0209915_38_844 257
581 3300045836 Ga0466958_0281017 Ga0466958_0281017_56_829 257
582 3300046453 Ga0495627_009827 Ga0495627_009827_2224_2997 257
583 3300046460 Ga0495638_0083365 Ga0495638_0083365_46_819 257
584 3300046462 Ga0495651_0170788 Ga0495651_0170788_717_1490 257
585 3300046514 Ga0495618_0328101 Ga0495618_0328101_22_795 257
586 3300046515 Ga0495620_0024857 Ga0495620_0024857_360_1133 257
587 3300046517 Ga0495630_0139490 Ga0495630_0139490_344_1183 257
588 3300046520 Ga0495637_0008818 Ga0495637_0008818_3911_4684 257
589 3300046530 Ga0495654_0023367 Ga0495654_0023367_444_1226 257
590 3300046530 Ga0495654_0070369 Ga0495654_0070369_870_1643 257
591 3300046531 Ga0495665_0068407 Ga0495665_0068407_558_1397 257
592 3300046538 Ga0495609_0067799 Ga0495609_0067799_686_1459 257
593 3300046542 Ga0495597_0000271 Ga0495597_0000271_29475_30257 257
594 3300046542 Ga0495597_0014491 Ga0495597_0014491_770_1600 257
595 3300046558 Ga0495633_0103415 Ga0495633_0103415_60_833 257
596 3300046615 Ga0495656_0000586 Ga0495656_0000586_666_1439 257
597 3300046660 Ga0495625_0000045 Ga0495625_0000045_72843_73616 257
598 3300046660 Ga0495625_0000379 Ga0495625_0000379_98_904 257
599 3300046674 Ga0495588_0043933 Ga0495588_0043933_918_1691 257
600 3300046691 Ga0495670_0082233 Ga0495670_0082233_628_1401 257
601 3300046692 Ga0495671_0013910 Ga0495671_0013910_78_884 257
602 3300046692 Ga0495671_0026847 Ga0495671_0026847_500_1273 257
603 3300047321 Ga0495676_0002862 Ga0495676_0002862_10052_10825 257
604 3300047443 Ga0495687_000523 Ga0495687_000523_9358_10188 257
605 3300047673 Ga0495593_0005402 Ga0495593_0005402_3655_4428 257
606 3300048089 Ga0495614_0004291 Ga0495614_0004291_5025_5798 257
607 3300048090 Ga0495615_0027805 Ga0495615_0027805_195_968 257
608 3300048091 Ga0495626_0080112 Ga0495626_0080112_554_1384 257
609 3300048903 Ga0496100_0009492 Ga0496100_0009492_592_1365 257
610 3300048904 Ga0496101_0030606 Ga0496101_0030606_825_1598 257
611 3300048904 Ga0496101_0063417 Ga0496101_0063417_316_1089 257
612 3300048906 Ga0496103_0041716 Ga0496103_0041716_387_1226 257
613 3300048907 Ga0496104_0013702 Ga0496104_0013702_5001_5840 257
614 3300048907 Ga0496104_0170425 Ga0496104_0170425_1211_1984 257
615 3300048908 Ga0496105_0035506 Ga0496105_0035506_1509_2348 257
616 3300048909 Ga0496106_0029989 Ga0496106_0029989_605_1444 257
617 3300048909 Ga0496106_0124152 Ga0496106_0124152_544_1317 257
618 3300048910 Ga0496107_0072969 Ga0496107_0072969_974_1747 257
619 3300048912 Ga0496109_0001638 Ga0496109_0001638_8001_8840 257
620 3300048912 Ga0496109_0386946 Ga0496109_0386946_227_1000 257
621 3300048913 Ga0496110_0049590 Ga0496110_0049590_1850_2689 257
622 3300048913 Ga0496110_0204062 Ga0496110_0204062_228_1001 257
623 3300048914 Ga0496111_0005028 Ga0496111_0005028_1604_2443 257
624 3300048914 Ga0496111_0093096 Ga0496111_0093096_1247_2020 257
625 3300048915 Ga0496112_0000852 Ga0496112_0000852_5001_5840 257
626 3300048916 Ga0496113_0000175 Ga0496113_0000175_26199_27038 257
627 3300048919 Ga0496116_0048461 Ga0496116_0048461_61_846 257
628 3300048919 Ga0496116_0073305 Ga0496116_0073305_975_1748 257
629 3300048920 Ga0496117_0024067 Ga0496117_0024067_699_1472 257
630 3300048920 Ga0496117_0028409 Ga0496117_0028409_2120_2905 257
631 3300048920 Ga0496117_0060609 Ga0496117_0060609_699_1472 257
632 3300048921 Ga0496118_0013925 Ga0496118_0013925_6244_7017 257
633 3300048924 Ga0496121_0051436 Ga0496121_0051436_2207_2980 257
634 3300048924 Ga0496121_0095038 Ga0496121_0095038_918_1691 257
635 3300048925 Ga0496122_0227542 Ga0496122_0227542_55_828 257
636 3300048927 Ga0496124_0021946 Ga0496124_0021946_1255_2040 257
637 3300048927 Ga0496124_0150891 Ga0496124_0150891_483_1256 257
638 3300048927 Ga0496124_0326387 Ga0496124_0326387_77_850 257
639 3300048928 Ga0496125_0010440 Ga0496125_0010440_3239_4012 257
640 3300048928 Ga0496125_0095622 Ga0496125_0095622_492_1265 257
641 3300048928 Ga0496125_0131223 Ga0496125_0131223_212_985 257
642 3300048929 Ga0496126_0334829 Ga0496126_0334829_69_842 257
643 3300049515 Ga0501292_009051 Ga0501292_009051_418_1236 257
644 3300049568 Ga0501031_0001052 Ga0501031_0001052_9934_10728 257
645 3300049571 Ga0501034_0231344 Ga0501034_0231344_993_1766 257
646 3300049572 Ga0501036_0565521 Ga0501036_0565521_149_922 257
647 3300049574 Ga0501038_0315197 Ga0501038_0315197_164_940 257
648 3300049581 Ga0501047_0117437 Ga0501047_0117437_1371_2189 257
649 3300049663 Ga0501223_004131 Ga0501223_004131_2303_3088 257
650 3300049679 Ga0501249_004824 Ga0501249_004824_927_1700 257
651 3300049683 Ga0501253_012557 Ga0501253_012557_123_941 257
652 3300049704 Ga0501221_022229 Ga0501221_022229_268_1041 257
653 3300049705 Ga0501225_0003847 Ga0501225_0003847_622_1395 257
654 3300049759 Ga0501262_003565 Ga0501262_003565_371_1144 257
655 3300049762 Ga0501265_004538 Ga0501265_004538_251_1069 257
656 3300050489 nmdc:mga03683_1072_c1 nmdc:mga03683_1072_c1_6570_7346 257
657 3300050489 nmdc:mga03683_3450_c2 nmdc:mga03683_3450_c2_2374_3147 257
658 3300050489 nmdc:mga03683_77218_c1 nmdc:mga03683_77218_c1_172_945 257
659 3300050490 nmdc:mga03n38_232134_c1 nmdc:mga03n38_232134_c1_100_873 257
660 3300050490 nmdc:mga03n38_32650_c1 nmdc:mga03n38_32650_c1_502_1275 257
661 3300050492 nmdc:mga0yw44_460128_c1 nmdc:mga0yw44_460128_c1_70_846 257
662 3300050492 nmdc:mga0yw44_799_c1 nmdc:mga0yw44_799_c1_8744_9517 257
663 3300050493 nmdc:mga0k408_20964_c1 nmdc:mga0k408_20964_c1_1597_2409 257
664 3300050493 nmdc:mga0k408_272923_c1 nmdc:mga0k408_272923_c1_15_788 257
665 3300050493 nmdc:mga0k408_55334_c1 nmdc:mga0k408_55334_c1_724_1497 257
666 3300050493 nmdc:mga0k408_67935_c1 nmdc:mga0k408_67935_c1_574_1350 257
667 3300050494 nmdc:mga06z11_207622_c1 nmdc:mga06z11_207622_c1_337_1110 257
668 3300050495 nmdc:mga04h51_68198_c1 nmdc:mga04h51_68198_c1_148_921 257
669 3300050496 nmdc:mga07m45_21486_c1 nmdc:mga07m45_21486_c1_64_849 257
670 3300050496 nmdc:mga07m45_25573_c1 nmdc:mga07m45_25573_c1_1320_2093 257
671 3300050496 nmdc:mga07m45_83_c1 nmdc:mga07m45_83_c1_25173_25946 257
672 3300050509 nmdc:mga0qj67_417234_c1 nmdc:mga0qj67_417234_c1_295_1071 257
673 3300050511 nmdc:mga08y16_65578_c1 nmdc:mga08y16_65578_c1_988_1827 257
674 3300053079 Ga0500610_0021582 Ga0500610_0021582_1449_2222 257
675 3300053093 Ga0500651_0000328 Ga0500651_0000328_19116_19889 257
676 3300053117 Ga0500593_000328 Ga0500593_000328_8429_9202 257
677 3300053117 Ga0500593_012616 Ga0500593_012616_502_1275 257
678 3300053121 Ga0500607_004248 Ga0500607_004248_8246_9019 257
679 3300053129 Ga0500628_002450 Ga0500628_002450_473_1246 257
680 3300053134 Ga0500658_0000117 Ga0500658_0000117_6723_7496 257
681 3300053134 Ga0500658_0000393 Ga0500658_0000393_5055_5828 257
682 3300053139 Ga0500568_0009858 Ga0500568_0009858_3453_4226 257
683 3300053141 Ga0500574_024317 Ga0500574_024317_380_1153 257
684 3300053153 Ga0500616_0055110 Ga0500616_0055110_152_925 257
685 3300053158 Ga0500627_0017547 Ga0500627_0017547_1835_2608 257
686 3300053161 Ga0500634_0072388 Ga0500634_0072388_459_1232 257
687 3300053730 Ga0500645_001273 Ga0500645_001273_3941_4714 257
688 iso_pu_bacteria 2643221611 2644072810 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

50

298

0.97

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

55

290

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hin-assembly1.cif.gz_A crystal structure of putative enoyl-coa hydratase from rhodopseudomonas palustris cga009 0.9463 5 254
4izd-assembly1.cif.gz_B crystal structure of dmdd e121a in complex with mmpa-coa 0.9347 2 251
4izb-assembly1.cif.gz_B crystal structure of dmdd, a crotonase superfamily enzyme that catalyzes the hydration and hydrolysis of methylthioacryloyl-coa 0.9345 2 242
5z7r-assembly1.cif.gz_A crystal structure of crotonase from clostridium acetobutylicum 0.9336 1 251
3myb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase mycobacterium smegmatis 0.9287 3 253
ID Description Score Start End Superfamily
3hinB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9609 5 199 3.90.226.10
4izcA01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9405 2 199 3.90.226.10
5z7rC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9379 1 199 3.90.226.10
3hinB01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9284 5 199 3.90.226.10
af_B7F9R1_37_234_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9267 13 198 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A372ENQ7-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9769 1 257 GO:0004300
GO:0006635
AF-A0A371B8H6-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9758 1 257 GO:0004300
GO:0006635
AF-A0A640JNW7-F1-model_v4 deleted 0.9757 1 257
AF-A0A2N4SPL2-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9755 1 257 GO:0004300
GO:0006635
AF-A0A260THM0-F1-model_v4 deleted 0.9755 3 257

Feature Viewer

pLDDT pTM Quality
92.75 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map