F475340
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 688 | 413 | 638 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0032508|Ga0395905_0032508_3948_4844 |
| Length | 298 |
| Sequence | MSIATRLAWSIFGFVLGVLAAPCLELIILYNNNPPIRQPGDMNTPDIHFELQGAVAIVRLARPAKRNAISDELILGIRSTFESMPEGVGAIVLDGQGDHFCAGLDLSELKERDAGAGMHHSRMWHAALETVQFGPAPVIAALHGAVVGGGLELAAACHIRVADETAFYSLPEGSRGIFVGGGGAVRIPRLIGEARMADMMFTGRVYDAKEGERIGLSQYIVPAGTAFAKAMELAERVAKNAPLTNYALMHALPRISEQPADQGFLTEALMAAIAQSAPEAKTRVREFLEGRGPKVKKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 9 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 10 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 11 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 12 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 13 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 14 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 15 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 16 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 17 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 18 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 19 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 20 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 21 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 22 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 23 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 24 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 25 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 26 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 27 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 28 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 29 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 30 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 31 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 32 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 33 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 34 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 35 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 36 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 37 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 38 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 39 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 40 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 41 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 42 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 43 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 44 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 45 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 46 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 47 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 48 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 49 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 50 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 51 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 52 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 53 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 54 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 55 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 56 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 57 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 58 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 59 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 60 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 61 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 62 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 63 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 64 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 65 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 66 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 67 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 70 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 71 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 72 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 73 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 74 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 77 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 78 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 79 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 80 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 86 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 88 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 95 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 100 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 102 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 105 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 106 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 107 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 108 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 111 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 112 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 113 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 121 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 122 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 123 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 136 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 145 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 157 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 160 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 163 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 216 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 217 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 218 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 219 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 220 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 221 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 222 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 223 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 224 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 225 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 228 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 229 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 230 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 231 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 233 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 234 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 242 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 243 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 244 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 253 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 254 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 262 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 263 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 264 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 265 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 266 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 271 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 272 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 273 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 274 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 275 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 276 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 277 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 278 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 279 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 280 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 281 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 282 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 283 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 284 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 285 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 286 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 287 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 288 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 289 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 290 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 291 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 292 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 293 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 294 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 295 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 296 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 297 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 298 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 299 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 300 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 301 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 302 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 303 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 304 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 361 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 362 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 363 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 364 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 365 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 366 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 367 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 368 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 372 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 375 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 383 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 384 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 385 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 386 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 388 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 389 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 393 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 394 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 395 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 396 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 403 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 404 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 405 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 406 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 408 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 409 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 410 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 412 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 413 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.3 |
| Metatranscriptomes | 0.44 |
| Isolates | 7.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.47 |
| Nodule | 1.16 |
| Rhizoplane | 6.25 |
| Rhizosphere | 54.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10034117 | 3300001989 | Bacteria | 1736 |
| 2 | JGI25155J39150_1000009 | 3300002704 | Bacteria | 224358 |
| 3 | JGI25156J39149_1000009 | 3300002705 | Bacteria | 224379 |
| 4 | JGI25154J39366_1000024 | 3300002738 | Bacteria | 211372 |
| 5 | JGI25157J39369_1000007 | 3300002741 | Bacteria | 224377 |
| 6 | JGI25152J39213_1010759 | 3300002773 | Bacteria | 2068 |
| 7 | JGI25150J39212_1005464 | 3300002774 | Bacteria | 2709 |
| 8 | JGI25159J45721_1000286 | 3300002987 | Bacteria | 23822 |
| 9 | JGI25151J46595_10010871 | 3300003187 | Bacteria | 4211 |
| 10 | JGI25151J46595_10013564 | 3300003187 | Bacteria | 3663 |
| 11 | JGI25151J46595_10028708 | 3300003187 | Bacteria | 2212 |
| 12 | JGI25153J46596_10026233 | 3300003215 | Bacteria | 2067 |
| 13 | JGI25153J46596_10036612 | 3300003215 | Bacteria | 1570 |
| 14 | rootH1_10010835 | 3300003316 | Bacteria | 3326 |
| 15 | rootH2_10131427 | 3300003320 | Bacteria | 2314 |
| 16 | rootH1_10398388 | 3300003323 | Bacteria | 1153 |
| 17 | JGI25160J50197_1000242 | 3300003354 | Bacteria | 42399 |
| 18 | JGI25161J50226_1000009 | 3300003374 | Bacteria | 224699 |
| 19 | Ga0006562J51391_1032156 | 3300003578 | Bacteria | 1910 |
| 20 | Ga0006562J51391_1050707 | 3300003578 | Bacteria | 1180 |
| 21 | Ga0055535_1000422 | 3300003761 | Bacteria | 39771 |
| 22 | Ga0055542_1000074 | 3300003762 | Bacteria | 141185 |
| 23 | Ga0055526_1000764 | 3300003771 | Bacteria | 24002 |
| 24 | Ga0055526_1002603 | 3300003771 | Bacteria | 12065 |
| 25 | Ga0055537_1000235 | 3300003773 | Bacteria | 40558 |
| 26 | Ga0055537_1001179 | 3300003773 | Bacteria | 11166 |
| 27 | Ga0055537_1004150 | 3300003773 | Bacteria | 4225 |
| 28 | Ga0055537_1005789 | 3300003773 | Bacteria | 3247 |
| 29 | Ga0055537_1008729 | 3300003773 | Bacteria | 2307 |
| 30 | Ga0055524_1000143 | 3300003775 | Bacteria | 84686 |
| 31 | Ga0055536_1001550 | 3300003781 | Bacteria | 13780 |
| 32 | Ga0055536_1002402 | 3300003781 | Bacteria | 10534 |
| 33 | Ga0055534_1000612 | 3300003784 | Bacteria | 18479 |
| 34 | Ga0055534_1001150 | 3300003784 | Bacteria | 11173 |
| 35 | Ga0055534_1007325 | 3300003784 | Bacteria | 2643 |
| 36 | Ga0055534_1009176 | 3300003784 | Bacteria | 2169 |
| 37 | Ga0055534_1009747 | 3300003784 | Bacteria | 2061 |
| 38 | Ga0055528_1001546 | 3300003790 | Bacteria | 13849 |
| 39 | Ga0055528_1003188 | 3300003790 | Bacteria | 8390 |
| 40 | Ga0055528_1007187 | 3300003790 | Bacteria | 4953 |
| 41 | Ga0055528_1012716 | 3300003790 | Bacteria | 3247 |
| 42 | Ga0055528_1022021 | 3300003790 | Bacteria | 1998 |
| 43 | Ga0055530_10000474 | 3300003791 | Bacteria | 34978 |
| 44 | Ga0055530_10001693 | 3300003791 | Bacteria | 15609 |
| 45 | Ga0055530_10012948 | 3300003791 | Bacteria | 2877 |
| 46 | Ga0055530_10053448 | 3300003791 | Bacteria | 927 |
| 47 | Ga0055540_1000027 | 3300003792 | Bacteria | 187454 |
| 48 | Ga0055540_1001360 | 3300003792 | Bacteria | 14663 |
| 49 | Ga0055540_1004336 | 3300003792 | Bacteria | 6448 |
| 50 | Ga0055531_10000465 | 3300003794 | Bacteria | 37499 |
| 51 | Ga0055531_10001603 | 3300003794 | Bacteria | 16421 |
| 52 | Ga0055531_10001892 | 3300003794 | Bacteria | 14663 |
| 53 | Ga0055543_1001141 | 3300004625 | Bacteria | 11343 |
| 54 | Ga0055543_1001635 | 3300004625 | Bacteria | 8548 |
| 55 | Ga0065165_1004502 | 3300005262 | Bacteria | 8567 |
| 56 | Ga0065165_1005558 | 3300005262 | Bacteria | 7011 |
| 57 | Ga0065165_1006879 | 3300005262 | Bacteria | 5781 |
| 58 | Ga0065714_10105539 | 3300005288 | Bacteria | 1536 |
| 59 | Ga0070658_10034550 | 3300005327 | Bacteria | 4068 |
| 60 | Ga0070658_10108697 | 3300005327 | Bacteria | 2296 |
| 61 | Ga0070683_100056060 | 3300005329 | Bacteria | 3659 |
| 62 | Ga0070666_10106400 | 3300005335 | Bacteria | 1938 |
| 63 | Ga0070680_100136961 | 3300005336 | Bacteria | 2051 |
| 64 | Ga0068868_100056705 | 3300005338 | Bacteria | 3094 |
| 65 | Ga0068868_100114392 | 3300005338 | Bacteria | 2195 |
| 66 | Ga0070660_100029168 | 3300005339 | Bacteria | 4133 |
| 67 | Ga0070689_100005913 | 3300005340 | Bacteria | 8413 |
| 68 | Ga0070673_100331359 | 3300005364 | Bacteria | 1347 |
| 69 | Ga0070659_100293976 | 3300005366 | Bacteria | 1353 |
| 70 | Ga0070667_100017811 | 3300005367 | Bacteria | 5886 |
| 71 | Ga0070667_100629041 | 3300005367 | Bacteria | 990 |
| 72 | Ga0070663_100107872 | 3300005455 | Bacteria | 2088 |
| 73 | Ga0070678_100210272 | 3300005456 | Bacteria | 1611 |
| 74 | Ga0070662_100009652 | 3300005457 | Bacteria | 6313 |
| 75 | Ga0070662_100309717 | 3300005457 | Bacteria | 1285 |
| 76 | Ga0068867_100030840 | 3300005459 | Bacteria | 3867 |
| 77 | Ga0070707_100184730 | 3300005468 | Bacteria | 2033 |
| 78 | Ga0070679_100206942 | 3300005530 | Bacteria | 1926 |
| 79 | Ga0068853_100059027 | 3300005539 | Bacteria | 3313 |
| 80 | Ga0068853_100074017 | 3300005539 | Bacteria | 2971 |
| 81 | Ga0068853_100255784 | 3300005539 | Bacteria | 1608 |
| 82 | Ga0070665_100011220 | 3300005548 | Bacteria | 9060 |
| 83 | Ga0068855_100605676 | 3300005563 | Bacteria | 1181 |
| 84 | Ga0070664_100006223 | 3300005564 | Bacteria | 9642 |
| 85 | Ga0070664_100053777 | 3300005564 | Bacteria | 3414 |
| 86 | Ga0070664_100121530 | 3300005564 | Bacteria | 2287 |
| 87 | Ga0068857_100042748 | 3300005577 | Bacteria | 4020 |
| 88 | Ga0068854_100155187 | 3300005578 | Bacteria | 1768 |
| 89 | Ga0068852_100018914 | 3300005616 | Bacteria | 5440 |
| 90 | Ga0068852_100411181 | 3300005616 | Bacteria | 1333 |
| 91 | Ga0068864_100093567 | 3300005618 | Bacteria | 2655 |
| 92 | Ga0068864_100161123 | 3300005618 | Bacteria | 2039 |
| 93 | Ga0068864_100452994 | 3300005618 | Bacteria | 1227 |
| 94 | Ga0068866_10263672 | 3300005718 | Bacteria | 1060 |
| 95 | Ga0068866_10267595 | 3300005718 | Bacteria | 1053 |
| 96 | Ga0068861_100043266 | 3300005719 | Bacteria | 3379 |
| 97 | Ga0068851_10004316 | 3300005834 | Bacteria | 6400 |
| 98 | Ga0068870_10019601 | 3300005840 | Bacteria | 3282 |
| 99 | Ga0068863_100181602 | 3300005841 | Unclassified | 2020 |
| 100 | Ga0068862_100120510 | 3300005844 | Bacteria | 2312 |
| 101 | Ga0075365_10007399 | 3300006038 | Bacteria | 6144 |
| 102 | Ga0075365_10041110 | 3300006038 | Bacteria | 3018 |
| 103 | Ga0075365_10046436 | 3300006038 | Bacteria | 2852 |
| 104 | Ga0075363_100054659 | 3300006048 | Bacteria | 2137 |
| 105 | Ga0075363_100056327 | 3300006048 | Bacteria | 2107 |
| 106 | Ga0075363_100065449 | 3300006048 | Bacteria | 1965 |
| 107 | Ga0075363_100112523 | 3300006048 | Bacteria | 1514 |
| 108 | Ga0075363_100150362 | 3300006048 | Bacteria | 1314 |
| 109 | Ga0075363_100165829 | 3300006048 | Bacteria | 1252 |
| 110 | Ga0075432_10010858 | 3300006058 | Bacteria | 3095 |
| 111 | Ga0075362_10029242 | 3300006177 | Bacteria | 2373 |
| 112 | Ga0075362_10071658 | 3300006177 | Bacteria | 1583 |
| 113 | Ga0075362_10099937 | 3300006177 | Bacteria | 1355 |
| 114 | Ga0075362_10119556 | 3300006177 | Bacteria | 1246 |
| 115 | Ga0075362_10184126 | 3300006177 | Bacteria | 1013 |
| 116 | Ga0075367_10140358 | 3300006178 | Bacteria | 1496 |
| 117 | Ga0075366_10002402 | 3300006195 | Bacteria | 9611 |
| 118 | Ga0075366_10010869 | 3300006195 | Bacteria | 5122 |
| 119 | Ga0075366_10061274 | 3300006195 | Bacteria | 2236 |
| 120 | Ga0075366_10160694 | 3300006195 | Bacteria | 1361 |
| 121 | Ga0097621_100014841 | 3300006237 | Bacteria | 5843 |
| 122 | Ga0075370_10000174 | 3300006353 | Bacteria | 22330 |
| 123 | Ga0075370_10009118 | 3300006353 | Bacteria | 5134 |
| 124 | Ga0075370_10024397 | 3300006353 | Bacteria | 3339 |
| 125 | Ga0075370_10063897 | 3300006353 | Bacteria | 2099 |
| 126 | Ga0075370_10250572 | 3300006353 | Bacteria | 1049 |
| 127 | Ga0068871_100820359 | 3300006358 | Bacteria | 858 |
| 128 | Ga0075430_100050168 | 3300006846 | Bacteria | 3521 |
| 129 | Ga0079104_1022241 | 3300006946 | Bacteria | 1710 |
| 130 | Ga0079104_1042794 | 3300006946 | Bacteria | 1047 |
| 131 | Ga0099826_10003378 | 3300006948 | Bacteria | 10802 |
| 132 | Ga0105244_10001684 | 3300009036 | Bacteria | 17460 |
| 133 | Ga0105240_10075554 | 3300009093 | Bacteria | 4156 |
| 134 | Ga0111539_10043864 | 3300009094 | Bacteria | 5360 |
| 135 | Ga0105245_10103501 | 3300009098 | Bacteria | 2638 |
| 136 | Ga0105245_10112726 | 3300009098 | Bacteria | 2531 |
| 137 | Ga0105243_10000651 | 3300009148 | Bacteria | 34393 |
| 138 | Ga0105243_10022415 | 3300009148 | Bacteria | 4800 |
| 139 | Ga0105241_10035536 | 3300009174 | Bacteria | 3747 |
| 140 | Ga0105241_10056041 | 3300009174 | Bacteria | 3021 |
| 141 | Ga0105241_10660247 | 3300009174 | Bacteria | 951 |
| 142 | Ga0105248_10079427 | 3300009177 | Bacteria | 3687 |
| 143 | Ga0105237_10010332 | 3300009545 | Bacteria | 9943 |
| 144 | Ga0105237_10195666 | 3300009545 | Bacteria | 2022 |
| 145 | Ga0105237_10339405 | 3300009545 | Bacteria | 1507 |
| 146 | Ga0105238_10061871 | 3300009551 | Bacteria | 3745 |
| 147 | Ga0105238_10394048 | 3300009551 | Bacteria | 1377 |
| 148 | Ga0105249_10086461 | 3300009553 | Bacteria | 2924 |
| 149 | Ga0105239_10052265 | 3300010375 | Bacteria | 4480 |
| 150 | Ga0105239_10422318 | 3300010375 | Bacteria | 1511 |
| 151 | Ga0105246_10244001 | 3300011119 | Bacteria | 1422 |
| 152 | Ga0157326_1002040 | 3300012513 | Bacteria | 2190 |
| 153 | Ga0157373_10097251 | 3300013100 | Bacteria | 2072 |
| 154 | Ga0157373_10101670 | 3300013100 | Bacteria | 2022 |
| 155 | Ga0157371_10011999 | 3300013102 | Bacteria | 6641 |
| 156 | Ga0157370_10010090 | 3300013104 | Bacteria | 9977 |
| 157 | Ga0157369_10104078 | 3300013105 | Bacteria | 3023 |
| 158 | Ga0157378_10113331 | 3300013297 | Bacteria | 2489 |
| 159 | Ga0157378_10214115 | 3300013297 | Bacteria | 1828 |
| 160 | Ga0163162_10004457 | 3300013306 | Bacteria | 13490 |
| 161 | Ga0163162_10141172 | 3300013306 | Bacteria | 2522 |
| 162 | Ga0163162_10290805 | 3300013306 | Bacteria | 1766 |
| 163 | Ga0163162_10603683 | 3300013306 | Bacteria | 1223 |
| 164 | Ga0163162_10701174 | 3300013306 | Bacteria | 1134 |
| 165 | Ga0163163_10032774 | 3300014325 | Bacteria | 5020 |
| 166 | Ga0163163_10151219 | 3300014325 | Bacteria | 2365 |
| 167 | Ga0157380_10102885 | 3300014326 | Bacteria | 2382 |
| 168 | Ga0182008_10002904 | 3300014497 | Bacteria | 10607 |
| 169 | Ga0182008_10003704 | 3300014497 | Bacteria | 9120 |
| 170 | Ga0182008_10049983 | 3300014497 | Bacteria | 2075 |
| 171 | Ga0157379_10030520 | 3300014968 | Bacteria | 4798 |
| 172 | Ga0157376_10001487 | 3300014969 | Bacteria | 15450 |
| 173 | Ga0157376_10315775 | 3300014969 | Bacteria | 1484 |
| 174 | Ga0157376_10458427 | 3300014969 | Bacteria | 1245 |
| 175 | Ga0182006_1001051 | 3300015261 | Bacteria | 17843 |
| 176 | Ga0182007_10001491 | 3300015262 | Bacteria | 12532 |
| 177 | Ga0182007_10006789 | 3300015262 | Bacteria | 4875 |
| 178 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 179 | Ga0163161_10010507 | 3300017792 | Bacteria | 6411 |
| 180 | Ga0163161_10080406 | 3300017792 | Bacteria | 2398 |
| 181 | Ga0163161_10100266 | 3300017792 | Bacteria | 2155 |
| 182 | Ga0209435_100051 | 3300025206 | Bacteria | 90866 |
| 183 | Ga0209672_100519 | 3300025228 | Bacteria | 21142 |
| 184 | Ga0209147_100419 | 3300025229 | Bacteria | 27989 |
| 185 | Ga0209258_100176 | 3300025242 | Bacteria | 141261 |
| 186 | Ga0207425_1000873 | 3300025245 | Bacteria | 14742 |
| 187 | Ga0207425_1001688 | 3300025245 | Bacteria | 8790 |
| 188 | Ga0207425_1001776 | 3300025245 | Bacteria | 8382 |
| 189 | Ga0209646_1000029 | 3300025246 | Bacteria | 386414 |
| 190 | Ga0209026_1000016 | 3300025250 | Bacteria | 386457 |
| 191 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 192 | Ga0209759_1000016 | 3300025256 | Bacteria | 386414 |
| 193 | Ga0209129_1000270 | 3300025258 | Bacteria | 50956 |
| 194 | Ga0209129_1003689 | 3300025258 | Bacteria | 6499 |
| 195 | Ga0209129_1008653 | 3300025258 | Bacteria | 2799 |
| 196 | Ga0209129_1008732 | 3300025258 | Bacteria | 2776 |
| 197 | Ga0209129_1010651 | 3300025258 | Bacteria | 2274 |
| 198 | Ga0209565_1000020 | 3300025263 | Bacteria | 432627 |
| 199 | Ga0209565_1000122 | 3300025263 | Bacteria | 111132 |
| 200 | Ga0209565_1000373 | 3300025263 | Bacteria | 38291 |
| 201 | Ga0209565_1001818 | 3300025263 | Bacteria | 8564 |
| 202 | Ga0209565_1003152 | 3300025263 | Bacteria | 5498 |
| 203 | Ga0209673_1000209 | 3300025273 | Bacteria | 117670 |
| 204 | Ga0209673_1000302 | 3300025273 | Bacteria | 91221 |
| 205 | Ga0209673_1001386 | 3300025273 | Bacteria | 23772 |
| 206 | Ga0209673_1003803 | 3300025273 | Bacteria | 8564 |
| 207 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 208 | Ga0209130_1000335 | 3300025284 | Bacteria | 53993 |
| 209 | Ga0209130_1000487 | 3300025284 | Bacteria | 40823 |
| 210 | Ga0209130_1000495 | 3300025284 | Bacteria | 40276 |
| 211 | Ga0209130_1001175 | 3300025284 | Bacteria | 18766 |
| 212 | Ga0209130_1007904 | 3300025284 | Bacteria | 3211 |
| 213 | Ga0209130_1013513 | 3300025284 | Bacteria | 2087 |
| 214 | Ga0209675_1000014 | 3300025291 | Bacteria | 421902 |
| 215 | Ga0209675_1000098 | 3300025291 | Bacteria | 130512 |
| 216 | Ga0209675_1001308 | 3300025291 | Bacteria | 14763 |
| 217 | Ga0209675_1003982 | 3300025291 | Bacteria | 6748 |
| 218 | Ga0209675_1005447 | 3300025291 | Bacteria | 5326 |
| 219 | Ga0209675_1014889 | 3300025291 | Bacteria | 2341 |
| 220 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 221 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 222 | Ga0209676_1000124 | 3300025292 | Bacteria | 194206 |
| 223 | Ga0209676_1000604 | 3300025292 | Bacteria | 52933 |
| 224 | Ga0209676_1003874 | 3300025292 | Bacteria | 8733 |
| 225 | Ga0209676_1006692 | 3300025292 | Bacteria | 5613 |
| 226 | Ga0209025_1000324 | 3300025294 | Bacteria | 106257 |
| 227 | Ga0209025_1000597 | 3300025294 | Bacteria | 65153 |
| 228 | Ga0209025_1000733 | 3300025294 | Bacteria | 55578 |
| 229 | Ga0209025_1004202 | 3300025294 | Bacteria | 12704 |
| 230 | Ga0209025_1005897 | 3300025294 | Bacteria | 9789 |
| 231 | Ga0209025_1005974 | 3300025294 | Bacteria | 9674 |
| 232 | Ga0209025_1010658 | 3300025294 | Bacteria | 6191 |
| 233 | Ga0209025_1016839 | 3300025294 | Bacteria | 4271 |
| 234 | Ga0209564_1000423 | 3300025295 | Bacteria | 74528 |
| 235 | Ga0209564_1001169 | 3300025295 | Bacteria | 30538 |
| 236 | Ga0209564_1001202 | 3300025295 | Bacteria | 29560 |
| 237 | Ga0209564_1003808 | 3300025295 | Bacteria | 9782 |
| 238 | Ga0209564_1004130 | 3300025295 | Bacteria | 9113 |
| 239 | Ga0209758_1000833 | 3300025297 | Bacteria | 43061 |
| 240 | Ga0209758_1003579 | 3300025297 | Bacteria | 13912 |
| 241 | Ga0209758_1025763 | 3300025297 | Bacteria | 2569 |
| 242 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 243 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 244 | Ga0209050_1001045 | 3300025298 | Bacteria | 34179 |
| 245 | Ga0209050_1002039 | 3300025298 | Bacteria | 18656 |
| 246 | Ga0209050_1006385 | 3300025298 | Bacteria | 6995 |
| 247 | Ga0209256_1000039 | 3300025299 | Bacteria | 372337 |
| 248 | Ga0209256_1000095 | 3300025299 | Bacteria | 206120 |
| 249 | Ga0209256_1000527 | 3300025299 | Bacteria | 55578 |
| 250 | Ga0207426_1000161 | 3300025302 | Bacteria | 172765 |
| 251 | Ga0207426_1000224 | 3300025302 | Bacteria | 130233 |
| 252 | Ga0207426_1000955 | 3300025302 | Bacteria | 28485 |
| 253 | Ga0207426_1001771 | 3300025302 | Bacteria | 16279 |
| 254 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 255 | Ga0209051_1000019 | 3300025303 | Bacteria | 511268 |
| 256 | Ga0209051_1000099 | 3300025303 | Bacteria | 165161 |
| 257 | Ga0209051_1000117 | 3300025303 | Bacteria | 150156 |
| 258 | Ga0209051_1000207 | 3300025303 | Bacteria | 103683 |
| 259 | Ga0209051_1000833 | 3300025303 | Bacteria | 31762 |
| 260 | Ga0209051_1011109 | 3300025303 | Bacteria | 4474 |
| 261 | Ga0209051_1078175 | 3300025303 | Bacteria | 965 |
| 262 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 263 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 264 | Ga0209257_1000161 | 3300025304 | Bacteria | 176089 |
| 265 | Ga0209257_1000258 | 3300025304 | Bacteria | 122220 |
| 266 | Ga0209257_1004843 | 3300025304 | Bacteria | 9963 |
| 267 | Ga0209257_1009295 | 3300025304 | Bacteria | 5309 |
| 268 | Ga0209257_1011333 | 3300025304 | Bacteria | 4311 |
| 269 | Ga0209257_1061272 | 3300025304 | Bacteria | 1021 |
| 270 | Ga0207656_10007159 | 3300025321 | Bacteria | 4055 |
| 271 | Ga0207656_10036545 | 3300025321 | Bacteria | 2062 |
| 272 | Ga0207655_1001510 | 3300025728 | Bacteria | 21219 |
| 273 | Ga0207655_1079886 | 3300025728 | Bacteria | 1184 |
| 274 | Ga0207680_10272860 | 3300025903 | Bacteria | 1173 |
| 275 | Ga0207645_10005156 | 3300025907 | Bacteria | 9549 |
| 276 | Ga0207645_10008002 | 3300025907 | Bacteria | 7415 |
| 277 | Ga0207695_10133853 | 3300025913 | Bacteria | 2434 |
| 278 | Ga0207657_10026290 | 3300025919 | Bacteria | 5351 |
| 279 | Ga0207657_10041810 | 3300025919 | Bacteria | 4049 |
| 280 | Ga0207652_10178927 | 3300025921 | Bacteria | 1905 |
| 281 | Ga0207694_10319898 | 3300025924 | Bacteria | 1280 |
| 282 | Ga0207650_10001983 | 3300025925 | Bacteria | 14357 |
| 283 | Ga0207650_10253994 | 3300025925 | Bacteria | 1424 |
| 284 | Ga0207687_10034205 | 3300025927 | Bacteria | 3450 |
| 285 | Ga0207687_10046561 | 3300025927 | Bacteria | 3003 |
| 286 | Ga0207644_10030857 | 3300025931 | Bacteria | 3731 |
| 287 | Ga0207706_10001771 | 3300025933 | Bacteria | 21193 |
| 288 | Ga0207706_10008031 | 3300025933 | Bacteria | 9739 |
| 289 | Ga0207706_10142747 | 3300025933 | Bacteria | 2106 |
| 290 | Ga0207709_10000313 | 3300025935 | Bacteria | 52906 |
| 291 | Ga0207709_10000669 | 3300025935 | Bacteria | 27749 |
| 292 | Ga0207670_10043362 | 3300025936 | Bacteria | 2970 |
| 293 | Ga0207669_10422166 | 3300025937 | Bacteria | 1050 |
| 294 | Ga0207691_10003250 | 3300025940 | Bacteria | 15835 |
| 295 | Ga0207691_10242744 | 3300025940 | Bacteria | 1557 |
| 296 | Ga0207711_10046284 | 3300025941 | Bacteria | 3717 |
| 297 | Ga0207689_10012071 | 3300025942 | Bacteria | 7400 |
| 298 | Ga0207689_10161431 | 3300025942 | Bacteria | 1846 |
| 299 | Ga0207679_10010834 | 3300025945 | Bacteria | 5877 |
| 300 | Ga0207667_10898832 | 3300025949 | Bacteria | 877 |
| 301 | Ga0207640_10033788 | 3300025981 | Bacteria | 3186 |
| 302 | Ga0207640_10344330 | 3300025981 | Bacteria | 1195 |
| 303 | Ga0207658_10089906 | 3300025986 | Bacteria | 2378 |
| 304 | Ga0207677_10050142 | 3300026023 | Bacteria | 2822 |
| 305 | Ga0207677_10068824 | 3300026023 | Bacteria | 2487 |
| 306 | Ga0207639_10003657 | 3300026041 | Bacteria | 10333 |
| 307 | Ga0207678_10002574 | 3300026067 | Bacteria | 16522 |
| 308 | Ga0207708_10000993 | 3300026075 | Bacteria | 21204 |
| 309 | Ga0207702_10144336 | 3300026078 | Bacteria | 2158 |
| 310 | Ga0207702_10320911 | 3300026078 | Bacteria | 1475 |
| 311 | Ga0207641_10253602 | 3300026088 | Bacteria | 1644 |
| 312 | Ga0207648_10000840 | 3300026089 | Bacteria | 34588 |
| 313 | Ga0207648_10012123 | 3300026089 | Bacteria | 8084 |
| 314 | Ga0207648_10238338 | 3300026089 | Bacteria | 1619 |
| 315 | Ga0207674_10033584 | 3300026116 | Bacteria | 5370 |
| 316 | Ga0207674_10243751 | 3300026116 | Bacteria | 1744 |
| 317 | Ga0207683_10004959 | 3300026121 | Bacteria | 11445 |
| 318 | Ga0209281_1018111 | 3300027111 | Bacteria | 1415 |
| 319 | Ga0209281_1029678 | 3300027111 | Bacteria | 985 |
| 320 | Ga0209973_1002078 | 3300027252 | Bacteria | 1829 |
| 321 | Ga0209282_1003178 | 3300027666 | Bacteria | 9720 |
| 322 | Ga0209971_1005374 | 3300027682 | Bacteria | 3045 |
| 323 | Ga0209813_10078738 | 3300027866 | Bacteria | 1085 |
| 324 | Ga0209974_10015870 | 3300027876 | Bacteria | 2501 |
| 325 | Ga0207428_10098286 | 3300027907 | Bacteria | 2265 |
| 326 | Ga0268266_10021473 | 3300028379 | Bacteria | 5499 |
| 327 | Ga0268265_10247966 | 3300028380 | Bacteria | 1575 |
| 328 | Ga0268264_10090835 | 3300028381 | Bacteria | 2633 |
| 329 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 330 | Ga0307515_10000458 | 3300028794 | Bacteria | 97523 |
| 331 | Ga0307515_10106766 | 3300028794 | Bacteria | 3317 |
| 332 | Ga0307515_10147541 | 3300028794 | Bacteria | 2482 |
| 333 | Ga0307512_10174892 | 3300030522 | Bacteria | 1221 |
| 334 | Ga0316177_1103696 | 3300030731 | Bacteria | 2402 |
| 335 | Ga0314311_1049345 | 3300030733 | Bacteria | 11896 |
| 336 | Ga0316178_1053423 | 3300030735 | Bacteria | 7152 |
| 337 | Ga0316183_1023591 | 3300030742 | Bacteria | 5350 |
| 338 | Ga0316183_1194403 | 3300030742 | Bacteria | 2630 |
| 339 | Ga0316181_1061609 | 3300030744 | Bacteria | 914 |
| 340 | Ga0316182_1044621 | 3300030745 | Bacteria | 5736 |
| 341 | Ga0265330_10054816 | 3300031235 | Bacteria | 1742 |
| 342 | Ga0265332_10003751 | 3300031238 | Bacteria | 7264 |
| 343 | Ga0265331_10060652 | 3300031250 | Bacteria | 1786 |
| 344 | Ga0265327_10119761 | 3300031251 | Bacteria | 1248 |
| 345 | Ga0265327_10140962 | 3300031251 | Bacteria | 1127 |
| 346 | Ga0307513_10000194 | 3300031456 | Bacteria | 87921 |
| 347 | Ga0307513_10001393 | 3300031456 | Bacteria | 34808 |
| 348 | Ga0307513_10154016 | 3300031456 | Bacteria | 2201 |
| 349 | Ga0307408_100000171 | 3300031548 | Bacteria | 73180 |
| 350 | Ga0307408_100007277 | 3300031548 | Bacteria | 7321 |
| 351 | Ga0307408_100076061 | 3300031548 | Bacteria | 2496 |
| 352 | Ga0307514_10000828 | 3300031649 | Bacteria | 49982 |
| 353 | Ga0307514_10026727 | 3300031649 | Bacteria | 4666 |
| 354 | Ga0316579_10000177 | 3300031691 | Bacteria | 18623 |
| 355 | Ga0265314_10020869 | 3300031711 | Bacteria | 5050 |
| 356 | Ga0265314_10036600 | 3300031711 | Bacteria | 3565 |
| 357 | Ga0265342_10022315 | 3300031712 | Bacteria | 4027 |
| 358 | Ga0265342_10047726 | 3300031712 | Bacteria | 2569 |
| 359 | Ga0316576_10018905 | 3300031727 | Bacteria | 4713 |
| 360 | Ga0316578_10028686 | 3300031728 | Bacteria | 3153 |
| 361 | Ga0307516_10006663 | 3300031730 | Bacteria | 13500 |
| 362 | Ga0307405_10028542 | 3300031731 | Bacteria | 3251 |
| 363 | Ga0307405_10139849 | 3300031731 | Bacteria | 1686 |
| 364 | Ga0316577_10001607 | 3300031733 | Bacteria | 10769 |
| 365 | Ga0307406_10001400 | 3300031901 | Bacteria | 13402 |
| 366 | Ga0307406_10007237 | 3300031901 | Bacteria | 6147 |
| 367 | Ga0307406_10188084 | 3300031901 | Bacteria | 1509 |
| 368 | Ga0307412_10084078 | 3300031911 | Bacteria | 2208 |
| 369 | Ga0307412_10214401 | 3300031911 | Bacteria | 1471 |
| 370 | Ga0307412_10252776 | 3300031911 | Bacteria | 1369 |
| 371 | Ga0307412_10490751 | 3300031911 | Bacteria | 1020 |
| 372 | Ga0307412_10523127 | 3300031911 | Bacteria | 991 |
| 373 | Ga0307416_100222755 | 3300032002 | Bacteria | 1811 |
| 374 | Ga0307416_100494104 | 3300032002 | Bacteria | 1286 |
| 375 | Ga0307416_100506143 | 3300032002 | Bacteria | 1273 |
| 376 | Ga0307411_10138374 | 3300032005 | Bacteria | 1791 |
| 377 | Ga0316585_10021205 | 3300032137 | Bacteria | 1994 |
| 378 | Ga0316580_10000077 | 3300032139 | Bacteria | 16967 |
| 379 | Ga0316592_1019927 | 3300033524 | Bacteria | 1422 |
| 380 | Ga0373944_0007063 | 3300035089 | Bacteria | 3000 |
| 381 | Ga0373954_0144809 | 3300035118 | Bacteria | 1160 |
| 382 | Ga0373946_0054221 | 3300035171 | Bacteria | 1686 |
| 383 | Ga0316574_0000453 | 3300035398 | Bacteria | 16452 |
| 384 | Ga0373935_0027835 | 3300035692 | Bacteria | 3493 |
| 385 | Ga0373927_0049634 | 3300035695 | Bacteria | 2713 |
| 386 | Ga0373947_0127411 | 3300035725 | Bacteria | 1622 |
| 387 | Ga0316582_0002708 | 3300036647 | Bacteria | 8411 |
| 388 | Ga0316584_0061444 | 3300036712 | Bacteria | 2813 |
| 389 | Ga0395899_0086470 | 3300037312 | Bacteria | 2277 |
| 390 | Ga0395900_0052621 | 3300037418 | Bacteria | 4191 |
| 391 | Ga0395900_0266776 | 3300037418 | Bacteria | 1708 |
| 392 | Ga0395898_0004483 | 3300037466 | Bacteria | 15266 |
| 393 | Ga0395898_0019317 | 3300037466 | Bacteria | 6938 |
| 394 | Ga0395898_0150582 | 3300037466 | Bacteria | 2226 |
| 395 | Ga0395898_0330291 | 3300037466 | Bacteria | 1454 |
| 396 | Ga0395905_0000132 | 3300037471 | Bacteria | 123636 |
| 397 | Ga0395905_0000773 | 3300037471 | Bacteria | 42104 |
| 398 | Ga0395905_0020265 | 3300037471 | Bacteria | 6300 |
| 399 | Ga0395905_0020548 | 3300037471 | Bacteria | 6253 |
| 400 | Ga0395905_0032508 | 3300037471 | Bacteria | 4907 |
| 401 | Ga0395905_0045023 | 3300037471 | Bacteria | 4139 |
| 402 | Ga0395905_0463096 | 3300037471 | Bacteria | 1166 |
| 403 | Ga0395901_0061368 | 3300038443 | Bacteria | 3911 |
| 404 | Ga0395901_0099473 | 3300038443 | Bacteria | 3049 |
| 405 | Ga0395901_0191808 | 3300038443 | Bacteria | 2143 |
| 406 | Ga0395901_0306610 | 3300038443 | Bacteria | 1645 |
| 407 | Ga0395901_0387156 | 3300038443 | Bacteria | 1438 |
| 408 | Ga0436365_1241421 | 3300039437 | Bacteria | 833 |
| 409 | Ga0436361_0206236 | 3300039447 | Bacteria | 37288 |
| 410 | Ga0439436_0033022 | 3300041404 | Bacteria | 1499 |
| 411 | Ga0439436_0048747 | 3300041404 | Bacteria | 1200 |
| 412 | Ga0439438_035333 | 3300041405 | Bacteria | 1314 |
| 413 | Ga0439439_0004892 | 3300041406 | Bacteria | 3038 |
| 414 | Ga0439466_0017020 | 3300041411 | Bacteria | 2620 |
| 415 | Ga0439466_0031968 | 3300041411 | Bacteria | 1797 |
| 416 | Ga0439465_0004122 | 3300041413 | Bacteria | 4728 |
| 417 | Ga0451793_0841222 | 3300041452 | Bacteria | 903 |
| 418 | Ga0451797_1279811 | 3300041453 | Bacteria | 1398 |
| 419 | Ga0451798_0376783 | 3300041458 | Bacteria | 1756 |
| 420 | Ga0451807_0205605 | 3300041486 | Bacteria | 1067 |
| 421 | Ga0451849_1538263 | 3300041505 | Bacteria | 1148 |
| 422 | Ga0451853_2214512 | 3300041512 | Bacteria | 1745 |
| 423 | Ga0439431_0004094 | 3300041997 | Bacteria | 3206 |
| 424 | Ga0439433_0011737 | 3300041999 | Bacteria | 1920 |
| 425 | Ga0439433_0012763 | 3300041999 | Bacteria | 1843 |
| 426 | Ga0439442_001658 | 3300042002 | Bacteria | 4363 |
| 427 | Ga0439445_0040432 | 3300042004 | Bacteria | 1237 |
| 428 | Ga0439445_0043154 | 3300042004 | Bacteria | 1203 |
| 429 | Ga0439432_001627 | 3300042006 | Bacteria | 8402 |
| 430 | Ga0439432_040723 | 3300042006 | Bacteria | 1473 |
| 431 | Ga0439432_054420 | 3300042006 | Bacteria | 1243 |
| 432 | Ga0439449_0000571 | 3300042007 | Bacteria | 13827 |
| 433 | Ga0439449_0010193 | 3300042007 | Bacteria | 3551 |
| 434 | Ga0439449_0027811 | 3300042007 | Bacteria | 2109 |
| 435 | Ga0439452_000889 | 3300042010 | Bacteria | 13717 |
| 436 | Ga0439452_004162 | 3300042010 | Bacteria | 4909 |
| 437 | Ga0439457_021025 | 3300042014 | Bacteria | 1447 |
| 438 | Ga0439457_026479 | 3300042014 | Bacteria | 1284 |
| 439 | Ga0439462_0000395 | 3300042015 | Bacteria | 8398 |
| 440 | Ga0439462_0003003 | 3300042015 | Bacteria | 4004 |
| 441 | Ga0439462_0033542 | 3300042015 | Bacteria | 1361 |
| 442 | Ga0450911_001876 | 3300042115 | Bacteria | 4442 |
| 443 | Ga0450923_000153 | 3300042125 | Bacteria | 6176 |
| 444 | Ga0450923_004312 | 3300042125 | Bacteria | 2228 |
| 445 | Ga0450888_000733 | 3300042126 | Bacteria | 3138 |
| 446 | Ga0450896_009789 | 3300042133 | Bacteria | 1339 |
| 447 | Ga0450898_009975 | 3300042134 | Bacteria | 1530 |
| 448 | Ga0450898_027951 | 3300042134 | Bacteria | 1023 |
| 449 | Ga0450906_003909 | 3300042145 | Bacteria | 3157 |
| 450 | Ga0450907_009943 | 3300042146 | Bacteria | 1577 |
| 451 | Ga0450910_003552 | 3300042147 | Bacteria | 2072 |
| 452 | Ga0450909_006945 | 3300042185 | Bacteria | 1633 |
| 453 | Ga0450909_008427 | 3300042185 | Bacteria | 1500 |
| 454 | Ga0439464_0020302 | 3300042439 | Bacteria | 1819 |
| 455 | Ga0450918_002160 | 3300042531 | Bacteria | 3759 |
| 456 | Ga0450893_0000734 | 3300042532 | Bacteria | 4789 |
| 457 | Ga0450893_0001087 | 3300042532 | Bacteria | 4086 |
| 458 | Ga0450893_0028823 | 3300042532 | Bacteria | 983 |
| 459 | Ga0451577_0000235 | 3300042876 | Bacteria | 109693 |
| 460 | Ga0451577_0033005 | 3300042876 | Bacteria | 4665 |
| 461 | Ga0466969_0056259 | 3300044656 | Bacteria | 1921 |
| 462 | Ga0466969_0066543 | 3300044656 | Bacteria | 1739 |
| 463 | Ga0453683_0000588 | 3300044673 | Bacteria | 40294 |
| 464 | Ga0453683_0002178 | 3300044673 | Bacteria | 15579 |
| 465 | Ga0466966_0005481 | 3300044684 | Bacteria | 8341 |
| 466 | Ga0453684_0000906 | 3300044712 | Bacteria | 98768 |
| 467 | Ga0453684_0048485 | 3300044712 | Bacteria | 5615 |
| 468 | Ga0453684_0421008 | 3300044712 | Bacteria | 1492 |
| 469 | Ga0466968_0043761 | 3300044735 | Bacteria | 1896 |
| 470 | Ga0466970_0073416 | 3300044765 | Bacteria | 1841 |
| 471 | Ga0466960_0133422 | 3300044901 | Bacteria | 1313 |
| 472 | Ga0466959_0120105 | 3300045049 | Bacteria | 1869 |
| 473 | Ga0451576_0016371 | 3300045051 | Bacteria | 8185 |
| 474 | Ga0451576_0209915 | 3300045051 | Bacteria | 2033 |
| 475 | Ga0466958_0281017 | 3300045836 | Bacteria | 1067 |
| 476 | Ga0495627_009827 | 3300046453 | Bacteria | 3504 |
| 477 | Ga0495603_0027022 | 3300046455 | Bacteria | 3465 |
| 478 | Ga0495590_0038292 | 3300046457 | Bacteria | 1672 |
| 479 | Ga0495638_0083365 | 3300046460 | Bacteria | 1937 |
| 480 | Ga0495651_0170788 | 3300046462 | Bacteria | 1549 |
| 481 | Ga0495580_0038734 | 3300046472 | Bacteria | 3413 |
| 482 | Ga0495582_0076600 | 3300046473 | Bacteria | 1854 |
| 483 | Ga0495639_0073112 | 3300046475 | Bacteria | 1586 |
| 484 | Ga0495607_0109887 | 3300046501 | Bacteria | 1463 |
| 485 | Ga0495618_0328101 | 3300046514 | Bacteria | 947 |
| 486 | Ga0495620_0024857 | 3300046515 | Bacteria | 2843 |
| 487 | Ga0495628_0112817 | 3300046516 | Bacteria | 2090 |
| 488 | Ga0495630_0139490 | 3300046517 | Bacteria | 1843 |
| 489 | Ga0495632_0051926 | 3300046519 | Bacteria | 2017 |
| 490 | Ga0495637_0008818 | 3300046520 | Bacteria | 4938 |
| 491 | Ga0495643_0076295 | 3300046522 | Bacteria | 1753 |
| 492 | Ga0495644_0010443 | 3300046523 | Bacteria | 3578 |
| 493 | Ga0495654_0023367 | 3300046530 | Bacteria | 3202 |
| 494 | Ga0495654_0070369 | 3300046530 | Bacteria | 1659 |
| 495 | Ga0495665_0068407 | 3300046531 | Bacteria | 1873 |
| 496 | Ga0495598_0000201 | 3300046537 | Bacteria | 10515 |
| 497 | Ga0495609_0067799 | 3300046538 | Bacteria | 1571 |
| 498 | Ga0495621_0110344 | 3300046539 | Bacteria | 1054 |
| 499 | Ga0495621_0111200 | 3300046539 | Bacteria | 1051 |
| 500 | Ga0495597_0000271 | 3300046542 | Bacteria | 47044 |
| 501 | Ga0495597_0014491 | 3300046542 | Bacteria | 3753 |
| 502 | Ga0495633_0103415 | 3300046558 | Bacteria | 1322 |
| 503 | Ga0495633_0130209 | 3300046558 | Bacteria | 1164 |
| 504 | Ga0495656_0000586 | 3300046615 | Bacteria | 11799 |
| 505 | Ga0495634_0085323 | 3300046642 | Bacteria | 2058 |
| 506 | Ga0495611_0045987 | 3300046648 | Bacteria | 1956 |
| 507 | Ga0495625_0000045 | 3300046660 | Bacteria | 202475 |
| 508 | Ga0495625_0000379 | 3300046660 | Bacteria | 67828 |
| 509 | Ga0495659_0033534 | 3300046664 | Bacteria | 1803 |
| 510 | Ga0495588_0043933 | 3300046674 | Bacteria | 2287 |
| 511 | Ga0495588_0045119 | 3300046674 | Bacteria | 2259 |
| 512 | Ga0495647_0010122 | 3300046681 | Bacteria | 3207 |
| 513 | Ga0495658_0092193 | 3300046683 | Bacteria | 1795 |
| 514 | Ga0495669_0014120 | 3300046684 | Bacteria | 3414 |
| 515 | Ga0495624_0027928 | 3300046690 | Bacteria | 3689 |
| 516 | Ga0495670_0082233 | 3300046691 | Bacteria | 1642 |
| 517 | Ga0495671_0013910 | 3300046692 | Bacteria | 4341 |
| 518 | Ga0495671_0026847 | 3300046692 | Bacteria | 2980 |
| 519 | Ga0495671_0090897 | 3300046692 | Bacteria | 1494 |
| 520 | Ga0495649_0000010 | 3300046694 | Bacteria | 430552 |
| 521 | Ga0495581_0121427 | 3300047315 | Bacteria | 1520 |
| 522 | Ga0495676_0002862 | 3300047321 | Bacteria | 15561 |
| 523 | Ga0495687_000523 | 3300047443 | Bacteria | 46029 |
| 524 | Ga0495677_0032346 | 3300047445 | Bacteria | 1905 |
| 525 | Ga0495681_0065094 | 3300047470 | Bacteria | 1668 |
| 526 | Ga0495593_0005402 | 3300047673 | Bacteria | 7552 |
| 527 | Ga0495614_0004291 | 3300048089 | Bacteria | 6423 |
| 528 | Ga0495615_0027805 | 3300048090 | Bacteria | 1330 |
| 529 | Ga0495626_0080112 | 3300048091 | Bacteria | 1452 |
| 530 | Ga0496100_0009492 | 3300048903 | Bacteria | 5467 |
| 531 | Ga0496100_0054743 | 3300048903 | Bacteria | 2603 |
| 532 | Ga0496100_0305621 | 3300048903 | Bacteria | 1191 |
| 533 | Ga0496101_0030606 | 3300048904 | Bacteria | 3776 |
| 534 | Ga0496101_0063417 | 3300048904 | Bacteria | 2690 |
| 535 | Ga0496101_0082018 | 3300048904 | Bacteria | 2386 |
| 536 | Ga0496102_0149258 | 3300048905 | Bacteria | 2195 |
| 537 | Ga0496103_0004812 | 3300048906 | Bacteria | 8157 |
| 538 | Ga0496103_0041716 | 3300048906 | Bacteria | 2821 |
| 539 | Ga0496104_0013702 | 3300048907 | Bacteria | 7310 |
| 540 | Ga0496104_0170425 | 3300048907 | Bacteria | 2087 |
| 541 | Ga0496104_0257044 | 3300048907 | Bacteria | 1659 |
| 542 | Ga0496104_0623610 | 3300048907 | Unclassified | 988 |
| 543 | Ga0496105_0035506 | 3300048908 | Bacteria | 4102 |
| 544 | Ga0496105_0233350 | 3300048908 | Bacteria | 1494 |
| 545 | Ga0496106_0006246 | 3300048909 | Bacteria | 8818 |
| 546 | Ga0496106_0029989 | 3300048909 | Bacteria | 4055 |
| 547 | Ga0496106_0124152 | 3300048909 | Bacteria | 2020 |
| 548 | Ga0496107_0021262 | 3300048910 | Bacteria | 4586 |
| 549 | Ga0496107_0072969 | 3300048910 | Bacteria | 2496 |
| 550 | Ga0496108_0024365 | 3300048911 | Bacteria | 4981 |
| 551 | Ga0496109_0001638 | 3300048912 | Bacteria | 18700 |
| 552 | Ga0496109_0084610 | 3300048912 | Bacteria | 2926 |
| 553 | Ga0496109_0386946 | 3300048912 | Bacteria | 1321 |
| 554 | Ga0496110_0049590 | 3300048913 | Bacteria | 3683 |
| 555 | Ga0496110_0204062 | 3300048913 | Bacteria | 1796 |
| 556 | Ga0496111_0005028 | 3300048914 | Bacteria | 8410 |
| 557 | Ga0496111_0068482 | 3300048914 | Bacteria | 2579 |
| 558 | Ga0496111_0093096 | 3300048914 | Bacteria | 2209 |
| 559 | Ga0496112_0000852 | 3300048915 | Bacteria | 21764 |
| 560 | Ga0496112_0127295 | 3300048915 | Bacteria | 2517 |
| 561 | Ga0496113_0000175 | 3300048916 | Bacteria | 28436 |
| 562 | Ga0496113_0005782 | 3300048916 | Bacteria | 7753 |
| 563 | Ga0496114_0012990 | 3300048917 | Bacteria | 6674 |
| 564 | Ga0496115_0071168 | 3300048918 | Bacteria | 2820 |
| 565 | Ga0496115_0078284 | 3300048918 | Bacteria | 2689 |
| 566 | Ga0496116_0048461 | 3300048919 | Bacteria | 2851 |
| 567 | Ga0496116_0073305 | 3300048919 | Bacteria | 2159 |
| 568 | Ga0496117_0024067 | 3300048920 | Bacteria | 4829 |
| 569 | Ga0496117_0028409 | 3300048920 | Bacteria | 4332 |
| 570 | Ga0496117_0060609 | 3300048920 | Bacteria | 2606 |
| 571 | Ga0496118_0013925 | 3300048921 | Bacteria | 7563 |
| 572 | Ga0496121_0051436 | 3300048924 | Bacteria | 3469 |
| 573 | Ga0496121_0095038 | 3300048924 | Bacteria | 2317 |
| 574 | Ga0496122_0227542 | 3300048925 | Bacteria | 1064 |
| 575 | Ga0496124_0021946 | 3300048927 | Bacteria | 5872 |
| 576 | Ga0496124_0150891 | 3300048927 | Bacteria | 1823 |
| 577 | Ga0496124_0326387 | 3300048927 | Bacteria | 1096 |
| 578 | Ga0496125_0010440 | 3300048928 | Bacteria | 9394 |
| 579 | Ga0496125_0095622 | 3300048928 | Bacteria | 2209 |
| 580 | Ga0496125_0131223 | 3300048928 | Bacteria | 1763 |
| 581 | Ga0496126_0334829 | 3300048929 | Bacteria | 1241 |
| 582 | Ga0501292_009051 | 3300049515 | Bacteria | 1471 |
| 583 | Ga0501031_0001052 | 3300049568 | Bacteria | 16740 |
| 584 | Ga0501034_0231344 | 3300049571 | Bacteria | 1797 |
| 585 | Ga0501036_0565521 | 3300049572 | Bacteria | 944 |
| 586 | Ga0501038_0315197 | 3300049574 | Bacteria | 1225 |
| 587 | Ga0501038_0354577 | 3300049574 | Bacteria | 1142 |
| 588 | Ga0501047_0117437 | 3300049581 | Bacteria | 2542 |
| 589 | Ga0501072_0142991 | 3300049588 | Bacteria | 1908 |
| 590 | Ga0501223_004131 | 3300049663 | Bacteria | 3128 |
| 591 | Ga0501249_004824 | 3300049679 | Bacteria | 2745 |
| 592 | Ga0501253_012557 | 3300049683 | Bacteria | 1329 |
| 593 | Ga0501221_022229 | 3300049704 | Bacteria | 1255 |
| 594 | Ga0501225_0003847 | 3300049705 | Bacteria | 4505 |
| 595 | Ga0501081_0145622 | 3300049743 | Bacteria | 1700 |
| 596 | Ga0501262_003565 | 3300049759 | Bacteria | 1788 |
| 597 | Ga0501265_004538 | 3300049762 | Bacteria | 1584 |
| 598 | nmdc:mga03683_1072_c1 | 3300050489 | Bacteria | 8008 |
| 599 | nmdc:mga03683_3450_c2 | 3300050489 | Bacteria | 3482 |
| 600 | nmdc:mga03683_77218_c1 | 3300050489 | Bacteria | 1433 |
| 601 | nmdc:mga03n38_232134_c1 | 3300050490 | Bacteria | 967 |
| 602 | nmdc:mga03n38_32650_c1 | 3300050490 | Bacteria | 2208 |
| 603 | nmdc:mga0yw44_4223_c1 | 3300050492 | Bacteria | 6542 |
| 604 | nmdc:mga0yw44_460128_c1 | 3300050492 | Bacteria | 862 |
| 605 | nmdc:mga0yw44_67569_c1 | 3300050492 | Bacteria | 2210 |
| 606 | nmdc:mga0yw44_799_c1 | 3300050492 | Bacteria | 11724 |
| 607 | nmdc:mga0k408_20964_c1 | 3300050493 | Bacteria | 3325 |
| 608 | nmdc:mga0k408_272923_c1 | 3300050493 | Bacteria | 1010 |
| 609 | nmdc:mga0k408_55334_c1 | 3300050493 | Bacteria | 2301 |
| 610 | nmdc:mga0k408_67935_c1 | 3300050493 | Bacteria | 2078 |
| 611 | nmdc:mga06z11_207622_c1 | 3300050494 | Bacteria | 1140 |
| 612 | nmdc:mga04h51_68198_c1 | 3300050495 | Bacteria | 1235 |
| 613 | nmdc:mga07m45_21486_c1 | 3300050496 | Bacteria | 3515 |
| 614 | nmdc:mga07m45_25573_c1 | 3300050496 | Bacteria | 3239 |
| 615 | nmdc:mga07m45_83_c1 | 3300050496 | Bacteria | 35468 |
| 616 | nmdc:mga0qj67_417234_c1 | 3300050509 | Bacteria | 1082 |
| 617 | nmdc:mga08y16_318649_c1 | 3300050511 | Bacteria | 1601 |
| 618 | nmdc:mga08y16_65578_c1 | 3300050511 | Bacteria | 3790 |
| 619 | Ga0495601_0042195 | 3300053077 | Bacteria | 2861 |
| 620 | Ga0500610_0021582 | 3300053079 | Bacteria | 3162 |
| 621 | Ga0495655_0001637 | 3300053083 | Bacteria | 3461 |
| 622 | Ga0495619_0019305 | 3300053085 | Bacteria | 4332 |
| 623 | Ga0495619_0262192 | 3300053085 | Bacteria | 1197 |
| 624 | Ga0500651_0000328 | 3300053093 | Bacteria | 26797 |
| 625 | Ga0500593_000328 | 3300053117 | Bacteria | 19163 |
| 626 | Ga0500593_012616 | 3300053117 | Bacteria | 3588 |
| 627 | Ga0500607_004248 | 3300053121 | Bacteria | 9969 |
| 628 | Ga0500628_002450 | 3300053129 | Bacteria | 3068 |
| 629 | Ga0500658_0000117 | 3300053134 | Bacteria | 37704 |
| 630 | Ga0500658_0000393 | 3300053134 | Bacteria | 19079 |
| 631 | Ga0500568_0009858 | 3300053139 | Bacteria | 4513 |
| 632 | Ga0500574_024317 | 3300053141 | Bacteria | 1567 |
| 633 | Ga0500616_0055110 | 3300053153 | Bacteria | 2080 |
| 634 | Ga0500627_0017547 | 3300053158 | Bacteria | 2814 |
| 635 | Ga0500634_0072388 | 3300053161 | Bacteria | 1799 |
| 636 | Ga0500645_001273 | 3300053730 | Bacteria | 13201 |
| 637 | Ga0530510_0049096 | 3300061734 | Bacteria | 3050 |
| 638 | Ga0530510_0195965 | 3300061734 | Bacteria | 1500 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10701174 | Ga0163162_107011742 | 220 |
| 2 | 3300005329 | Ga0070683_100056060 | Ga0070683_1000560603 | 221 |
| 3 | 3300005340 | Ga0070689_100005913 | Ga0070689_1000059136 | 221 |
| 4 | 3300005564 | Ga0070664_100053777 | Ga0070664_1000537772 | 221 |
| 5 | 3300005618 | Ga0068864_100093567 | Ga0068864_1000935672 | 221 |
| 6 | 3300005719 | Ga0068861_100043266 | Ga0068861_1000432664 | 221 |
| 7 | 3300005840 | Ga0068870_10019601 | Ga0068870_100196012 | 221 |
| 8 | 3300006237 | Ga0097621_100014841 | Ga0097621_1000148413 | 221 |
| 9 | 3300009094 | Ga0111539_10043864 | Ga0111539_100438643 | 221 |
| 10 | 3300009098 | Ga0105245_10103501 | Ga0105245_101035013 | 221 |
| 11 | 3300009148 | Ga0105243_10022415 | Ga0105243_100224152 | 221 |
| 12 | 3300009174 | Ga0105241_10056041 | Ga0105241_100560413 | 221 |
| 13 | 3300009545 | Ga0105237_10195666 | Ga0105237_101956663 | 221 |
| 14 | 3300009553 | Ga0105249_10086461 | Ga0105249_100864612 | 221 |
| 15 | 3300010375 | Ga0105239_10052265 | Ga0105239_100522653 | 221 |
| 16 | 3300013297 | Ga0157378_10214115 | Ga0157378_102141152 | 221 |
| 17 | 3300014968 | Ga0157379_10030520 | Ga0157379_100305203 | 221 |
| 18 | 3300014969 | Ga0157376_10315775 | Ga0157376_103157752 | 221 |
| 19 | 3300025321 | Ga0207656_10007159 | Ga0207656_100071592 | 221 |
| 20 | 3300025907 | Ga0207645_10005156 | Ga0207645_100051565 | 221 |
| 21 | 3300025919 | Ga0207657_10026290 | Ga0207657_100262903 | 221 |
| 22 | 3300025927 | Ga0207687_10046561 | Ga0207687_100465612 | 221 |
| 23 | 3300025933 | Ga0207706_10008031 | Ga0207706_100080319 | 221 |
| 24 | 3300025936 | Ga0207670_10043362 | Ga0207670_100433624 | 221 |
| 25 | 3300025940 | Ga0207691_10003250 | Ga0207691_100032507 | 221 |
| 26 | 3300025941 | Ga0207711_10046284 | Ga0207711_100462845 | 221 |
| 27 | 3300025942 | Ga0207689_10012071 | Ga0207689_100120715 | 221 |
| 28 | 3300026067 | Ga0207678_10002574 | Ga0207678_1000257411 | 221 |
| 29 | 3300026075 | Ga0207708_10000993 | Ga0207708_1000099312 | 221 |
| 30 | 3300026089 | Ga0207648_10000840 | Ga0207648_1000084018 | 221 |
| 31 | 3300028381 | Ga0268264_10090835 | Ga0268264_100908354 | 221 |
| 32 | 3300046457 | Ga0495590_0038292 | Ga0495590_0038292_652_1527 | 221 |
| 33 | 3300046516 | Ga0495628_0112817 | Ga0495628_0112817_586_1461 | 221 |
| 34 | 3300046519 | Ga0495632_0051926 | Ga0495632_0051926_462_1337 | 221 |
| 35 | 3300046522 | Ga0495643_0076295 | Ga0495643_0076295_117_992 | 221 |
| 36 | 3300046648 | Ga0495611_0045987 | Ga0495611_0045987_563_1438 | 221 |
| 37 | 3300046684 | Ga0495669_0014120 | Ga0495669_0014120_762_1637 | 221 |
| 38 | 3300047445 | Ga0495677_0032346 | Ga0495677_0032346_478_1353 | 221 |
| 39 | 3300047470 | Ga0495681_0065094 | Ga0495681_0065094_690_1565 | 221 |
| 40 | 3300048903 | Ga0496100_0054743 | Ga0496100_0054743_204_1079 | 221 |
| 41 | 3300048905 | Ga0496102_0149258 | Ga0496102_0149258_1127_2002 | 221 |
| 42 | 3300048906 | Ga0496103_0004812 | Ga0496103_0004812_1623_2498 | 221 |
| 43 | 3300048907 | Ga0496104_0257044 | Ga0496104_0257044_204_1079 | 221 |
| 44 | 3300048908 | Ga0496105_0233350 | Ga0496105_0233350_194_1069 | 221 |
| 45 | 3300048909 | Ga0496106_0006246 | Ga0496106_0006246_2340_3215 | 221 |
| 46 | 3300048910 | Ga0496107_0021262 | Ga0496107_0021262_194_1069 | 221 |
| 47 | 3300048911 | Ga0496108_0024365 | Ga0496108_0024365_1545_2420 | 221 |
| 48 | 3300048912 | Ga0496109_0084610 | Ga0496109_0084610_1184_2059 | 221 |
| 49 | 3300048914 | Ga0496111_0068482 | Ga0496111_0068482_965_1840 | 221 |
| 50 | 3300048915 | Ga0496112_0127295 | Ga0496112_0127295_1555_2430 | 221 |
| 51 | 3300048916 | Ga0496113_0005782 | Ga0496113_0005782_1718_2593 | 221 |
| 52 | 3300048917 | Ga0496114_0012990 | Ga0496114_0012990_605_1480 | 221 |
| 53 | 3300048918 | Ga0496115_0078284 | Ga0496115_0078284_194_1069 | 221 |
| 54 | 3300050511 | nmdc:mga08y16_318649_c1 | nmdc:mga08y16_318649_c1_53_928 | 221 |
| 55 | 3300053077 | Ga0495601_0042195 | Ga0495601_0042195_936_1811 | 221 |
| 56 | 3300053083 | Ga0495655_0001637 | Ga0495655_0001637_2453_3328 | 221 |
| 57 | 3300026121 | Ga0207683_10004959 | Ga0207683_100049595 | 223 |
| 58 | 3300050492 | nmdc:mga0yw44_67569_c1 | nmdc:mga0yw44_67569_c1_1206_2081 | 223 |
| 59 | 3300009177 | Ga0105248_10079427 | Ga0105248_100794275 | 224 |
| 60 | 3300035089 | Ga0373944_0007063 | Ga0373944_0007063_726_1550 | 229 |
| 61 | 3300035171 | Ga0373946_0054221 | Ga0373946_0054221_780_1616 | 229 |
| 62 | 3300035692 | Ga0373935_0027835 | Ga0373935_0027835_1969_2805 | 229 |
| 63 | 3300035695 | Ga0373927_0049634 | Ga0373927_0049634_65_901 | 229 |
| 64 | 3300035725 | Ga0373947_0127411 | Ga0373947_0127411_106_942 | 229 |
| 65 | 3300046455 | Ga0495603_0027022 | Ga0495603_0027022_1849_2685 | 229 |
| 66 | 3300046472 | Ga0495580_0038734 | Ga0495580_0038734_2296_3132 | 229 |
| 67 | 3300046473 | Ga0495582_0076600 | Ga0495582_0076600_374_1210 | 229 |
| 68 | 3300046475 | Ga0495639_0073112 | Ga0495639_0073112_609_1445 | 229 |
| 69 | 3300046501 | Ga0495607_0109887 | Ga0495607_0109887_406_1242 | 229 |
| 70 | 3300046523 | Ga0495644_0010443 | Ga0495644_0010443_1121_1966 | 229 |
| 71 | 3300046537 | Ga0495598_0000201 | Ga0495598_0000201_9160_9996 | 229 |
| 72 | 3300046539 | Ga0495621_0110344 | Ga0495621_0110344_97_933 | 229 |
| 73 | 3300046558 | Ga0495633_0130209 | Ga0495633_0130209_192_1028 | 229 |
| 74 | 3300046642 | Ga0495634_0085323 | Ga0495634_0085323_454_1305 | 229 |
| 75 | 3300046664 | Ga0495659_0033534 | Ga0495659_0033534_273_1097 | 229 |
| 76 | 3300046674 | Ga0495588_0045119 | Ga0495588_0045119_724_1548 | 229 |
| 77 | 3300046681 | Ga0495647_0010122 | Ga0495647_0010122_1607_2431 | 229 |
| 78 | 3300046683 | Ga0495658_0092193 | Ga0495658_0092193_807_1643 | 229 |
| 79 | 3300046690 | Ga0495624_0027928 | Ga0495624_0027928_712_1536 | 229 |
| 80 | 3300046692 | Ga0495671_0090897 | Ga0495671_0090897_464_1300 | 229 |
| 81 | 3300047315 | Ga0495581_0121427 | Ga0495581_0121427_399_1235 | 229 |
| 82 | 3300035118 | Ga0373954_0144809 | Ga0373954_0144809_260_1120 | 230 |
| 83 | 3300053085 | Ga0495619_0019305 | Ga0495619_0019305_2935_3786 | 230 |
| 84 | 3300061734 | Ga0530510_0195965 | Ga0530510_0195965_260_1069 | 230 |
| 85 | 3300049588 | Ga0501072_0142991 | Ga0501072_0142991_252_1079 | 231 |
| 86 | 3300061734 | Ga0530510_0049096 | Ga0530510_0049096_612_1421 | 231 |
| 87 | 3300049743 | Ga0501081_0145622 | Ga0501081_0145622_210_1019 | 232 |
| 88 | 3300048903 | Ga0496100_0305621 | Ga0496100_0305621_138_977 | 233 |
| 89 | 3300048904 | Ga0496101_0082018 | Ga0496101_0082018_636_1475 | 233 |
| 90 | 3300048918 | Ga0496115_0071168 | Ga0496115_0071168_1099_1938 | 233 |
| 91 | 3300053085 | Ga0495619_0262192 | Ga0495619_0262192_151_990 | 233 |
| 92 | 3300049574 | Ga0501038_0354577 | Ga0501038_0354577_396_1121 | 241 |
| 93 | 3300031238 | Ga0265332_10003751 | Ga0265332_100037512 | 246 |
| 94 | 3300050492 | nmdc:mga0yw44_4223_c1 | nmdc:mga0yw44_4223_c1_3195_3938 | 247 |
| 95 | 3300003187 | JGI25151J46595_10010871 | JGI25151J46595_100108715 | 248 |
| 96 | 3300005262 | Ga0065165_1004502 | Ga0065165_10045028 | 248 |
| 97 | 3300025245 | Ga0207425_1001688 | Ga0207425_10016882 | 248 |
| 98 | 3300025258 | Ga0209129_1010651 | Ga0209129_10106513 | 248 |
| 99 | 3300025263 | Ga0209565_1000122 | Ga0209565_100012275 | 248 |
| 100 | 3300025273 | Ga0209673_1000302 | Ga0209673_100030261 | 248 |
| 101 | 3300025284 | Ga0209130_1000487 | Ga0209130_100048735 | 248 |
| 102 | 3300025284 | Ga0209130_1013513 | Ga0209130_10135131 | 248 |
| 103 | 3300025291 | Ga0209675_1000098 | Ga0209675_1000098102 | 248 |
| 104 | 3300025292 | Ga0209676_1000013 | Ga0209676_1000013719 | 248 |
| 105 | 3300025292 | Ga0209676_1003874 | Ga0209676_10038744 | 248 |
| 106 | 3300025294 | Ga0209025_1004202 | Ga0209025_10042023 | 248 |
| 107 | 3300025294 | Ga0209025_1005974 | Ga0209025_10059744 | 248 |
| 108 | 3300025295 | Ga0209564_1001169 | Ga0209564_100116921 | 248 |
| 109 | 3300025295 | Ga0209564_1004130 | Ga0209564_10041305 | 248 |
| 110 | 3300025297 | Ga0209758_1025763 | Ga0209758_10257632 | 248 |
| 111 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008719 | 248 |
| 112 | 3300025298 | Ga0209050_1006385 | Ga0209050_10063856 | 248 |
| 113 | 3300025299 | Ga0209256_1000039 | Ga0209256_1000039318 | 248 |
| 114 | 3300025302 | Ga0207426_1001771 | Ga0207426_100177115 | 248 |
| 115 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005719 | 248 |
| 116 | 3300025303 | Ga0209051_1078175 | Ga0209051_10781751 | 248 |
| 117 | 3300025304 | Ga0209257_1000031 | Ga0209257_1000031309 | 248 |
| 118 | 3300041505 | Ga0451849_1538263 | Ga0451849_1538263_19_765 | 248 |
| 119 | 3300039437 | Ga0436365_1241421 | Ga0436365_1241421_59_817 | 252 |
| 120 | 3300003323 | rootH1_10398388 | rootH1_103983882 | 253 |
| 121 | 3300048907 | Ga0496104_0623610 | Ga0496104_0623610_75_848 | 253 |
| 122 | iso_pu_bacteria | 2511231002 | 2511246025 | 253 |
| 123 | iso_pu_bacteria | 2599185214 | 2599626343 | 253 |
| 124 | iso_pu_bacteria | 2599185226 | 2599676333 | 253 |
| 125 | iso_pu_bacteria | 2599185227 | 2599682045 | 253 |
| 126 | iso_pu_bacteria | 2599185229 | 2599695695 | 253 |
| 127 | iso_pu_bacteria | 2643221570 | 2643864127 | 253 |
| 128 | iso_pu_bacteria | 2643221596 | 2643992427 | 253 |
| 129 | iso_pu_bacteria | 2643221628 | 2644161707 | 253 |
| 130 | iso_pu_bacteria | 2643221652 | 2644292170 | 253 |
| 131 | iso_pu_bacteria | 2643221683 | 2644466884 | 253 |
| 132 | iso_pu_bacteria | 2738541277 | 2738721315 | 253 |
| 133 | iso_pu_bacteria | 2738541307 | 2738880658 | 253 |
| 134 | iso_pu_bacteria | 2738543012 | 2739245747 | 253 |
| 135 | iso_pu_bacteria | 2738543019 | 2739280984 | 253 |
| 136 | iso_pu_bacteria | 2816332133 | 2816470349 | 253 |
| 137 | iso_pu_bacteria | 2818991446 | 2819601622 | 253 |
| 138 | iso_pu_bacteria | 2831265667 | 2831269233 | 253 |
| 139 | iso_pu_bacteria | 2838054893 | 2838059210 | 253 |
| 140 | iso_pu_bacteria | 2842677519 | 2842680331 | 253 |
| 141 | iso_pu_bacteria | 2881101125 | 2881105360 | 253 |
| 142 | iso_pu_bacteria | 2885198086 | 2885203052 | 253 |
| 143 | iso_pu_bacteria | 2885211737 | 2885216551 | 253 |
| 144 | iso_pu_bacteria | 2899924645 | 2899930685 | 253 |
| 145 | iso_pu_bacteria | 2904449895 | 2904452591 | 253 |
| 146 | iso_pu_bacteria | 2904456579 | 2904460810 | 253 |
| 147 | iso_pu_bacteria | 2904541872 | 2904545310 | 253 |
| 148 | iso_pu_bacteria | 2919462493 | 2919463777 | 253 |
| 149 | iso_pu_bacteria | 2928037797 | 2928040993 | 253 |
| 150 | iso_pu_bacteria | 2928044640 | 2928047835 | 253 |
| 151 | iso_pu_bacteria | 2928051484 | 2928055727 | 253 |
| 152 | iso_pu_bacteria | 2928064002 | 2928069826 | 253 |
| 153 | iso_pu_bacteria | 2928070936 | 2928075313 | 253 |
| 154 | iso_pu_bacteria | 2928084124 | 2928088530 | 253 |
| 155 | iso_pu_bacteria | 2929160207 | 2929165502 | 253 |
| 156 | iso_pu_bacteria | 2929520902 | 2929522543 | 253 |
| 157 | iso_pu_bacteria | 2945909444 | 2945909828 | 253 |
| 158 | iso_pu_bacteria | 2945945610 | 2945945906 | 253 |
| 159 | iso_pu_bacteria | 2945972063 | 2945975522 | 253 |
| 160 | iso_pu_bacteria | 2945984333 | 2945988179 | 253 |
| 161 | iso_pu_bacteria | 2954767861 | 2954769035 | 253 |
| 162 | 3300005618 | Ga0068864_100452994 | Ga0068864_1004529941 | 254 |
| 163 | 3300005841 | Ga0068863_100181602 | Ga0068863_1001816022 | 254 |
| 164 | 3300026088 | Ga0207641_10253602 | Ga0207641_102536022 | 254 |
| 165 | iso_pu_bacteria | 2513020051 | 2513230664 | 254 |
| 166 | iso_pu_bacteria | 2547132374 | 2548501750 | 254 |
| 167 | iso_pu_bacteria | 2643221658 | 2644328517 | 254 |
| 168 | iso_pu_bacteria | 2643221672 | 2644399754 | 254 |
| 169 | iso_pu_bacteria | 2643221717 | 2644646523 | 254 |
| 170 | iso_pu_bacteria | 2728368998 | 2728754080 | 254 |
| 171 | iso_pu_bacteria | 2738543013 | 2739249577 | 254 |
| 172 | iso_pu_bacteria | 2885192300 | 2885192988 | 254 |
| 173 | iso_pu_bacteria | 2939631187 | 2939636653 | 254 |
| 174 | 3300013306 | Ga0163162_10004457 | Ga0163162_100044576 | 255 |
| 175 | 3300046694 | Ga0495649_0000010 | Ga0495649_0000010_362825_363619 | 255 |
| 176 | 3300006048 | Ga0075363_100150362 | Ga0075363_1001503622 | 256 |
| 177 | 3300006353 | Ga0075370_10063897 | Ga0075370_100638972 | 256 |
| 178 | 3300013306 | Ga0163162_10290805 | Ga0163162_102908051 | 256 |
| 179 | 3300046539 | Ga0495621_0111200 | Ga0495621_0111200_57_830 | 256 |
| 180 | 3300001989 | JGI24739J22299_10034117 | JGI24739J22299_100341172 | 257 |
| 181 | 3300002704 | JGI25155J39150_1000009 | JGI25155J39150_1000009184 | 257 |
| 182 | 3300002705 | JGI25156J39149_1000009 | JGI25156J39149_100000936 | 257 |
| 183 | 3300002738 | JGI25154J39366_1000024 | JGI25154J39366_100002436 | 257 |
| 184 | 3300002741 | JGI25157J39369_1000007 | JGI25157J39369_100000736 | 257 |
| 185 | 3300002773 | JGI25152J39213_1010759 | JGI25152J39213_10107592 | 257 |
| 186 | 3300002774 | JGI25150J39212_1005464 | JGI25150J39212_10054642 | 257 |
| 187 | 3300002987 | JGI25159J45721_1000286 | JGI25159J45721_10002869 | 257 |
| 188 | 3300003187 | JGI25151J46595_10013564 | JGI25151J46595_100135643 | 257 |
| 189 | 3300003187 | JGI25151J46595_10028708 | JGI25151J46595_100287082 | 257 |
| 190 | 3300003215 | JGI25153J46596_10026233 | JGI25153J46596_100262332 | 257 |
| 191 | 3300003215 | JGI25153J46596_10036612 | JGI25153J46596_100366122 | 257 |
| 192 | 3300003316 | rootH1_10010835 | rootH1_100108351 | 257 |
| 193 | 3300003320 | rootH2_10131427 | rootH2_101314272 | 257 |
| 194 | 3300003354 | JGI25160J50197_1000242 | JGI25160J50197_100024235 | 257 |
| 195 | 3300003374 | JGI25161J50226_1000009 | JGI25161J50226_1000009192 | 257 |
| 196 | 3300003578 | Ga0006562J51391_1032156 | Ga0006562J51391_10321562 | 257 |
| 197 | 3300003578 | Ga0006562J51391_1050707 | Ga0006562J51391_10507072 | 257 |
| 198 | 3300003761 | Ga0055535_1000422 | Ga0055535_100042224 | 257 |
| 199 | 3300003762 | Ga0055542_1000074 | Ga0055542_100007487 | 257 |
| 200 | 3300003771 | Ga0055526_1000764 | Ga0055526_10007648 | 257 |
| 201 | 3300003771 | Ga0055526_1002603 | Ga0055526_100260310 | 257 |
| 202 | 3300003773 | Ga0055537_1000235 | Ga0055537_100023534 | 257 |
| 203 | 3300003773 | Ga0055537_1001179 | Ga0055537_10011792 | 257 |
| 204 | 3300003773 | Ga0055537_1004150 | Ga0055537_10041503 | 257 |
| 205 | 3300003773 | Ga0055537_1005789 | Ga0055537_10057893 | 257 |
| 206 | 3300003773 | Ga0055537_1008729 | Ga0055537_10087292 | 257 |
| 207 | 3300003775 | Ga0055524_1000143 | Ga0055524_100014357 | 257 |
| 208 | 3300003781 | Ga0055536_1001550 | Ga0055536_10015502 | 257 |
| 209 | 3300003781 | Ga0055536_1002402 | Ga0055536_10024027 | 257 |
| 210 | 3300003784 | Ga0055534_1000612 | Ga0055534_10006128 | 257 |
| 211 | 3300003784 | Ga0055534_1001150 | Ga0055534_100115013 | 257 |
| 212 | 3300003784 | Ga0055534_1007325 | Ga0055534_10073252 | 257 |
| 213 | 3300003784 | Ga0055534_1009176 | Ga0055534_10091762 | 257 |
| 214 | 3300003784 | Ga0055534_1009747 | Ga0055534_10097472 | 257 |
| 215 | 3300003790 | Ga0055528_1001546 | Ga0055528_10015464 | 257 |
| 216 | 3300003790 | Ga0055528_1003188 | Ga0055528_10031884 | 257 |
| 217 | 3300003790 | Ga0055528_1007187 | Ga0055528_10071873 | 257 |
| 218 | 3300003790 | Ga0055528_1012716 | Ga0055528_10127163 | 257 |
| 219 | 3300003790 | Ga0055528_1022021 | Ga0055528_10220212 | 257 |
| 220 | 3300003791 | Ga0055530_10000474 | Ga0055530_1000047426 | 257 |
| 221 | 3300003791 | Ga0055530_10001693 | Ga0055530_100016934 | 257 |
| 222 | 3300003791 | Ga0055530_10012948 | Ga0055530_100129482 | 257 |
| 223 | 3300003791 | Ga0055530_10053448 | Ga0055530_100534481 | 257 |
| 224 | 3300003792 | Ga0055540_1000027 | Ga0055540_1000027146 | 257 |
| 225 | 3300003792 | Ga0055540_1001360 | Ga0055540_10013604 | 257 |
| 226 | 3300003792 | Ga0055540_1004336 | Ga0055540_10043363 | 257 |
| 227 | 3300003794 | Ga0055531_10000465 | Ga0055531_1000046510 | 257 |
| 228 | 3300003794 | Ga0055531_10001603 | Ga0055531_100016038 | 257 |
| 229 | 3300003794 | Ga0055531_10001892 | Ga0055531_1000189210 | 257 |
| 230 | 3300004625 | Ga0055543_1001141 | Ga0055543_10011415 | 257 |
| 231 | 3300004625 | Ga0055543_1001635 | Ga0055543_10016353 | 257 |
| 232 | 3300005262 | Ga0065165_1005558 | Ga0065165_10055584 | 257 |
| 233 | 3300005262 | Ga0065165_1006879 | Ga0065165_10068793 | 257 |
| 234 | 3300005288 | Ga0065714_10105539 | Ga0065714_101055391 | 257 |
| 235 | 3300005327 | Ga0070658_10034550 | Ga0070658_100345502 | 257 |
| 236 | 3300005327 | Ga0070658_10108697 | Ga0070658_101086972 | 257 |
| 237 | 3300005335 | Ga0070666_10106400 | Ga0070666_101064002 | 257 |
| 238 | 3300005336 | Ga0070680_100136961 | Ga0070680_1001369612 | 257 |
| 239 | 3300005338 | Ga0068868_100056705 | Ga0068868_1000567052 | 257 |
| 240 | 3300005338 | Ga0068868_100114392 | Ga0068868_1001143922 | 257 |
| 241 | 3300005339 | Ga0070660_100029168 | Ga0070660_1000291683 | 257 |
| 242 | 3300005364 | Ga0070673_100331359 | Ga0070673_1003313591 | 257 |
| 243 | 3300005366 | Ga0070659_100293976 | Ga0070659_1002939762 | 257 |
| 244 | 3300005367 | Ga0070667_100017811 | Ga0070667_1000178112 | 257 |
| 245 | 3300005367 | Ga0070667_100629041 | Ga0070667_1006290411 | 257 |
| 246 | 3300005455 | Ga0070663_100107872 | Ga0070663_1001078722 | 257 |
| 247 | 3300005456 | Ga0070678_100210272 | Ga0070678_1002102722 | 257 |
| 248 | 3300005457 | Ga0070662_100009652 | Ga0070662_1000096524 | 257 |
| 249 | 3300005457 | Ga0070662_100309717 | Ga0070662_1003097172 | 257 |
| 250 | 3300005459 | Ga0068867_100030840 | Ga0068867_1000308402 | 257 |
| 251 | 3300005468 | Ga0070707_100184730 | Ga0070707_1001847302 | 257 |
| 252 | 3300005530 | Ga0070679_100206942 | Ga0070679_1002069422 | 257 |
| 253 | 3300005539 | Ga0068853_100059027 | Ga0068853_1000590272 | 257 |
| 254 | 3300005539 | Ga0068853_100074017 | Ga0068853_1000740172 | 257 |
| 255 | 3300005539 | Ga0068853_100255784 | Ga0068853_1002557842 | 257 |
| 256 | 3300005548 | Ga0070665_100011220 | Ga0070665_1000112202 | 257 |
| 257 | 3300005563 | Ga0068855_100605676 | Ga0068855_1006056761 | 257 |
| 258 | 3300005564 | Ga0070664_100006223 | Ga0070664_1000062237 | 257 |
| 259 | 3300005564 | Ga0070664_100121530 | Ga0070664_1001215302 | 257 |
| 260 | 3300005577 | Ga0068857_100042748 | Ga0068857_1000427483 | 257 |
| 261 | 3300005578 | Ga0068854_100155187 | Ga0068854_1001551871 | 257 |
| 262 | 3300005616 | Ga0068852_100018914 | Ga0068852_1000189143 | 257 |
| 263 | 3300005616 | Ga0068852_100411181 | Ga0068852_1004111811 | 257 |
| 264 | 3300005618 | Ga0068864_100161123 | Ga0068864_1001611232 | 257 |
| 265 | 3300005718 | Ga0068866_10263672 | Ga0068866_102636722 | 257 |
| 266 | 3300005718 | Ga0068866_10267595 | Ga0068866_102675952 | 257 |
| 267 | 3300005834 | Ga0068851_10004316 | Ga0068851_100043165 | 257 |
| 268 | 3300005844 | Ga0068862_100120510 | Ga0068862_1001205102 | 257 |
| 269 | 3300006038 | Ga0075365_10007399 | Ga0075365_100073995 | 257 |
| 270 | 3300006038 | Ga0075365_10041110 | Ga0075365_100411101 | 257 |
| 271 | 3300006038 | Ga0075365_10046436 | Ga0075365_100464362 | 257 |
| 272 | 3300006048 | Ga0075363_100054659 | Ga0075363_1000546592 | 257 |
| 273 | 3300006048 | Ga0075363_100056327 | Ga0075363_1000563272 | 257 |
| 274 | 3300006048 | Ga0075363_100065449 | Ga0075363_1000654492 | 257 |
| 275 | 3300006048 | Ga0075363_100112523 | Ga0075363_1001125231 | 257 |
| 276 | 3300006048 | Ga0075363_100165829 | Ga0075363_1001658292 | 257 |
| 277 | 3300006058 | Ga0075432_10010858 | Ga0075432_100108581 | 257 |
| 278 | 3300006177 | Ga0075362_10029242 | Ga0075362_100292422 | 257 |
| 279 | 3300006177 | Ga0075362_10071658 | Ga0075362_100716582 | 257 |
| 280 | 3300006177 | Ga0075362_10099937 | Ga0075362_100999372 | 257 |
| 281 | 3300006177 | Ga0075362_10119556 | Ga0075362_101195562 | 257 |
| 282 | 3300006177 | Ga0075362_10184126 | Ga0075362_101841261 | 257 |
| 283 | 3300006178 | Ga0075367_10140358 | Ga0075367_101403582 | 257 |
| 284 | 3300006195 | Ga0075366_10002402 | Ga0075366_100024023 | 257 |
| 285 | 3300006195 | Ga0075366_10010869 | Ga0075366_100108695 | 257 |
| 286 | 3300006195 | Ga0075366_10061274 | Ga0075366_100612742 | 257 |
| 287 | 3300006195 | Ga0075366_10160694 | Ga0075366_101606942 | 257 |
| 288 | 3300006353 | Ga0075370_10000174 | Ga0075370_1000017420 | 257 |
| 289 | 3300006353 | Ga0075370_10009118 | Ga0075370_100091186 | 257 |
| 290 | 3300006353 | Ga0075370_10024397 | Ga0075370_100243973 | 257 |
| 291 | 3300006353 | Ga0075370_10250572 | Ga0075370_102505721 | 257 |
| 292 | 3300006358 | Ga0068871_100820359 | Ga0068871_1008203591 | 257 |
| 293 | 3300006846 | Ga0075430_100050168 | Ga0075430_1000501682 | 257 |
| 294 | 3300006946 | Ga0079104_1022241 | Ga0079104_10222411 | 257 |
| 295 | 3300006946 | Ga0079104_1042794 | Ga0079104_10427941 | 257 |
| 296 | 3300006948 | Ga0099826_10003378 | Ga0099826_1000337810 | 257 |
| 297 | 3300009036 | Ga0105244_10001684 | Ga0105244_1000168416 | 257 |
| 298 | 3300009093 | Ga0105240_10075554 | Ga0105240_100755542 | 257 |
| 299 | 3300009098 | Ga0105245_10112726 | Ga0105245_101127262 | 257 |
| 300 | 3300009148 | Ga0105243_10000651 | Ga0105243_1000065124 | 257 |
| 301 | 3300009174 | Ga0105241_10035536 | Ga0105241_100355363 | 257 |
| 302 | 3300009174 | Ga0105241_10660247 | Ga0105241_106602471 | 257 |
| 303 | 3300009545 | Ga0105237_10010332 | Ga0105237_1001033210 | 257 |
| 304 | 3300009545 | Ga0105237_10339405 | Ga0105237_103394051 | 257 |
| 305 | 3300009551 | Ga0105238_10061871 | Ga0105238_100618712 | 257 |
| 306 | 3300009551 | Ga0105238_10394048 | Ga0105238_103940482 | 257 |
| 307 | 3300010375 | Ga0105239_10422318 | Ga0105239_104223182 | 257 |
| 308 | 3300011119 | Ga0105246_10244001 | Ga0105246_102440012 | 257 |
| 309 | 3300012513 | Ga0157326_1002040 | Ga0157326_10020402 | 257 |
| 310 | 3300013100 | Ga0157373_10097251 | Ga0157373_100972512 | 257 |
| 311 | 3300013100 | Ga0157373_10101670 | Ga0157373_101016702 | 257 |
| 312 | 3300013102 | Ga0157371_10011999 | Ga0157371_100119996 | 257 |
| 313 | 3300013104 | Ga0157370_10010090 | Ga0157370_1001009012 | 257 |
| 314 | 3300013105 | Ga0157369_10104078 | Ga0157369_101040782 | 257 |
| 315 | 3300013297 | Ga0157378_10113331 | Ga0157378_101133312 | 257 |
| 316 | 3300013306 | Ga0163162_10141172 | Ga0163162_101411722 | 257 |
| 317 | 3300013306 | Ga0163162_10603683 | Ga0163162_106036832 | 257 |
| 318 | 3300014325 | Ga0163163_10032774 | Ga0163163_100327744 | 257 |
| 319 | 3300014325 | Ga0163163_10151219 | Ga0163163_101512192 | 257 |
| 320 | 3300014326 | Ga0157380_10102885 | Ga0157380_101028852 | 257 |
| 321 | 3300014497 | Ga0182008_10002904 | Ga0182008_100029042 | 257 |
| 322 | 3300014497 | Ga0182008_10003704 | Ga0182008_100037043 | 257 |
| 323 | 3300014497 | Ga0182008_10049983 | Ga0182008_100499832 | 257 |
| 324 | 3300014969 | Ga0157376_10001487 | Ga0157376_100014876 | 257 |
| 325 | 3300014969 | Ga0157376_10458427 | Ga0157376_104584272 | 257 |
| 326 | 3300015261 | Ga0182006_1001051 | Ga0182006_10010513 | 257 |
| 327 | 3300015262 | Ga0182007_10001491 | Ga0182007_100014918 | 257 |
| 328 | 3300015262 | Ga0182007_10006789 | Ga0182007_100067894 | 257 |
| 329 | 3300015683 | Ga0183362_10005 | Ga0183362_10005262 | 257 |
| 330 | 3300017792 | Ga0163161_10010507 | Ga0163161_100105073 | 257 |
| 331 | 3300017792 | Ga0163161_10080406 | Ga0163161_100804062 | 257 |
| 332 | 3300017792 | Ga0163161_10100266 | Ga0163161_101002662 | 257 |
| 333 | 3300025206 | Ga0209435_100051 | Ga0209435_10005160 | 257 |
| 334 | 3300025228 | Ga0209672_100519 | Ga0209672_10051920 | 257 |
| 335 | 3300025229 | Ga0209147_100419 | Ga0209147_1004196 | 257 |
| 336 | 3300025242 | Ga0209258_100176 | Ga0209258_10017654 | 257 |
| 337 | 3300025245 | Ga0207425_1000873 | Ga0207425_100087311 | 257 |
| 338 | 3300025245 | Ga0207425_1001776 | Ga0207425_10017764 | 257 |
| 339 | 3300025246 | Ga0209646_1000029 | Ga0209646_1000029336 | 257 |
| 340 | 3300025250 | Ga0209026_1000016 | Ga0209026_1000016336 | 257 |
| 341 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033185 | 257 |
| 342 | 3300025256 | Ga0209759_1000016 | Ga0209759_1000016336 | 257 |
| 343 | 3300025258 | Ga0209129_1000270 | Ga0209129_100027054 | 257 |
| 344 | 3300025258 | Ga0209129_1003689 | Ga0209129_10036892 | 257 |
| 345 | 3300025258 | Ga0209129_1008653 | Ga0209129_10086533 | 257 |
| 346 | 3300025258 | Ga0209129_1008732 | Ga0209129_10087322 | 257 |
| 347 | 3300025263 | Ga0209565_1000020 | Ga0209565_1000020295 | 257 |
| 348 | 3300025263 | Ga0209565_1000373 | Ga0209565_100037310 | 257 |
| 349 | 3300025263 | Ga0209565_1001818 | Ga0209565_10018186 | 257 |
| 350 | 3300025263 | Ga0209565_1003152 | Ga0209565_10031525 | 257 |
| 351 | 3300025273 | Ga0209673_1000209 | Ga0209673_100020992 | 257 |
| 352 | 3300025273 | Ga0209673_1001386 | Ga0209673_100138623 | 257 |
| 353 | 3300025273 | Ga0209673_1003803 | Ga0209673_10038036 | 257 |
| 354 | 3300025284 | Ga0209130_1000014 | Ga0209130_100001436 | 257 |
| 355 | 3300025284 | Ga0209130_1000335 | Ga0209130_100033544 | 257 |
| 356 | 3300025284 | Ga0209130_1000495 | Ga0209130_10004959 | 257 |
| 357 | 3300025284 | Ga0209130_1001175 | Ga0209130_100117515 | 257 |
| 358 | 3300025284 | Ga0209130_1007904 | Ga0209130_10079042 | 257 |
| 359 | 3300025291 | Ga0209675_1000014 | Ga0209675_1000014284 | 257 |
| 360 | 3300025291 | Ga0209675_1001308 | Ga0209675_10013086 | 257 |
| 361 | 3300025291 | Ga0209675_1003982 | Ga0209675_10039826 | 257 |
| 362 | 3300025291 | Ga0209675_1005447 | Ga0209675_10054474 | 257 |
| 363 | 3300025291 | Ga0209675_1014889 | Ga0209675_10148892 | 257 |
| 364 | 3300025292 | Ga0209676_1000048 | Ga0209676_1000048144 | 257 |
| 365 | 3300025292 | Ga0209676_1000124 | Ga0209676_1000124202 | 257 |
| 366 | 3300025292 | Ga0209676_1000604 | Ga0209676_10006042 | 257 |
| 367 | 3300025292 | Ga0209676_1006692 | Ga0209676_10066922 | 257 |
| 368 | 3300025294 | Ga0209025_1000324 | Ga0209025_100032493 | 257 |
| 369 | 3300025294 | Ga0209025_1000597 | Ga0209025_100059761 | 257 |
| 370 | 3300025294 | Ga0209025_1000733 | Ga0209025_10007336 | 257 |
| 371 | 3300025294 | Ga0209025_1005897 | Ga0209025_10058973 | 257 |
| 372 | 3300025294 | Ga0209025_1010658 | Ga0209025_10106585 | 257 |
| 373 | 3300025294 | Ga0209025_1016839 | Ga0209025_10168392 | 257 |
| 374 | 3300025295 | Ga0209564_1000423 | Ga0209564_100042372 | 257 |
| 375 | 3300025295 | Ga0209564_1001202 | Ga0209564_100120221 | 257 |
| 376 | 3300025295 | Ga0209564_1003808 | Ga0209564_10038083 | 257 |
| 377 | 3300025297 | Ga0209758_1000833 | Ga0209758_100083343 | 257 |
| 378 | 3300025297 | Ga0209758_1003579 | Ga0209758_10035798 | 257 |
| 379 | 3300025298 | Ga0209050_1000012 | Ga0209050_1000012144 | 257 |
| 380 | 3300025298 | Ga0209050_1001045 | Ga0209050_100104520 | 257 |
| 381 | 3300025298 | Ga0209050_1002039 | Ga0209050_100203910 | 257 |
| 382 | 3300025299 | Ga0209256_1000095 | Ga0209256_1000095143 | 257 |
| 383 | 3300025299 | Ga0209256_1000527 | Ga0209256_100052754 | 257 |
| 384 | 3300025302 | Ga0207426_1000161 | Ga0207426_100016128 | 257 |
| 385 | 3300025302 | Ga0207426_1000224 | Ga0207426_100022436 | 257 |
| 386 | 3300025302 | Ga0207426_1000955 | Ga0207426_10009556 | 257 |
| 387 | 3300025303 | Ga0209051_1000019 | Ga0209051_100001963 | 257 |
| 388 | 3300025303 | Ga0209051_1000099 | Ga0209051_1000099150 | 257 |
| 389 | 3300025303 | Ga0209051_1000117 | Ga0209051_100011748 | 257 |
| 390 | 3300025303 | Ga0209051_1000207 | Ga0209051_100020783 | 257 |
| 391 | 3300025303 | Ga0209051_1000833 | Ga0209051_100083321 | 257 |
| 392 | 3300025303 | Ga0209051_1011109 | Ga0209051_10111092 | 257 |
| 393 | 3300025304 | Ga0209257_1000024 | Ga0209257_100002490 | 257 |
| 394 | 3300025304 | Ga0209257_1000161 | Ga0209257_10001619 | 257 |
| 395 | 3300025304 | Ga0209257_1000258 | Ga0209257_100025829 | 257 |
| 396 | 3300025304 | Ga0209257_1004843 | Ga0209257_10048432 | 257 |
| 397 | 3300025304 | Ga0209257_1009295 | Ga0209257_10092954 | 257 |
| 398 | 3300025304 | Ga0209257_1011333 | Ga0209257_10113334 | 257 |
| 399 | 3300025304 | Ga0209257_1061272 | Ga0209257_10612721 | 257 |
| 400 | 3300025321 | Ga0207656_10036545 | Ga0207656_100365453 | 257 |
| 401 | 3300025728 | Ga0207655_1001510 | Ga0207655_100151021 | 257 |
| 402 | 3300025728 | Ga0207655_1079886 | Ga0207655_10798862 | 257 |
| 403 | 3300025903 | Ga0207680_10272860 | Ga0207680_102728601 | 257 |
| 404 | 3300025907 | Ga0207645_10008002 | Ga0207645_100080022 | 257 |
| 405 | 3300025913 | Ga0207695_10133853 | Ga0207695_101338532 | 257 |
| 406 | 3300025919 | Ga0207657_10041810 | Ga0207657_100418102 | 257 |
| 407 | 3300025921 | Ga0207652_10178927 | Ga0207652_101789272 | 257 |
| 408 | 3300025924 | Ga0207694_10319898 | Ga0207694_103198981 | 257 |
| 409 | 3300025925 | Ga0207650_10001983 | Ga0207650_100019835 | 257 |
| 410 | 3300025925 | Ga0207650_10253994 | Ga0207650_102539941 | 257 |
| 411 | 3300025927 | Ga0207687_10034205 | Ga0207687_100342052 | 257 |
| 412 | 3300025931 | Ga0207644_10030857 | Ga0207644_100308572 | 257 |
| 413 | 3300025933 | Ga0207706_10001771 | Ga0207706_1000177119 | 257 |
| 414 | 3300025933 | Ga0207706_10142747 | Ga0207706_101427472 | 257 |
| 415 | 3300025935 | Ga0207709_10000313 | Ga0207709_1000031339 | 257 |
| 416 | 3300025935 | Ga0207709_10000669 | Ga0207709_100006697 | 257 |
| 417 | 3300025937 | Ga0207669_10422166 | Ga0207669_104221662 | 257 |
| 418 | 3300025940 | Ga0207691_10242744 | Ga0207691_102427442 | 257 |
| 419 | 3300025942 | Ga0207689_10161431 | Ga0207689_101614312 | 257 |
| 420 | 3300025945 | Ga0207679_10010834 | Ga0207679_100108343 | 257 |
| 421 | 3300025949 | Ga0207667_10898832 | Ga0207667_108988321 | 257 |
| 422 | 3300025981 | Ga0207640_10033788 | Ga0207640_100337882 | 257 |
| 423 | 3300025981 | Ga0207640_10344330 | Ga0207640_103443302 | 257 |
| 424 | 3300025986 | Ga0207658_10089906 | Ga0207658_100899062 | 257 |
| 425 | 3300026023 | Ga0207677_10050142 | Ga0207677_100501422 | 257 |
| 426 | 3300026023 | Ga0207677_10068824 | Ga0207677_100688242 | 257 |
| 427 | 3300026041 | Ga0207639_10003657 | Ga0207639_1000365712 | 257 |
| 428 | 3300026078 | Ga0207702_10144336 | Ga0207702_101443363 | 257 |
| 429 | 3300026078 | Ga0207702_10320911 | Ga0207702_103209112 | 257 |
| 430 | 3300026089 | Ga0207648_10012123 | Ga0207648_100121236 | 257 |
| 431 | 3300026089 | Ga0207648_10238338 | Ga0207648_102383382 | 257 |
| 432 | 3300026116 | Ga0207674_10033584 | Ga0207674_100335843 | 257 |
| 433 | 3300026116 | Ga0207674_10243751 | Ga0207674_102437512 | 257 |
| 434 | 3300027111 | Ga0209281_1018111 | Ga0209281_10181112 | 257 |
| 435 | 3300027111 | Ga0209281_1029678 | Ga0209281_10296781 | 257 |
| 436 | 3300027252 | Ga0209973_1002078 | Ga0209973_10020782 | 257 |
| 437 | 3300027666 | Ga0209282_1003178 | Ga0209282_10031784 | 257 |
| 438 | 3300027682 | Ga0209971_1005374 | Ga0209971_10053742 | 257 |
| 439 | 3300027866 | Ga0209813_10078738 | Ga0209813_100787382 | 257 |
| 440 | 3300027876 | Ga0209974_10015870 | Ga0209974_100158701 | 257 |
| 441 | 3300027907 | Ga0207428_10098286 | Ga0207428_100982862 | 257 |
| 442 | 3300028379 | Ga0268266_10021473 | Ga0268266_100214734 | 257 |
| 443 | 3300028380 | Ga0268265_10247966 | Ga0268265_102479662 | 257 |
| 444 | 3300028794 | Ga0307515_10000040 | Ga0307515_1000004064 | 257 |
| 445 | 3300028794 | Ga0307515_10000458 | Ga0307515_1000045848 | 257 |
| 446 | 3300028794 | Ga0307515_10106766 | Ga0307515_101067662 | 257 |
| 447 | 3300028794 | Ga0307515_10147541 | Ga0307515_101475412 | 257 |
| 448 | 3300030522 | Ga0307512_10174892 | Ga0307512_101748922 | 257 |
| 449 | 3300030731 | Ga0316177_1103696 | Ga0316177_11036961 | 257 |
| 450 | 3300030733 | Ga0314311_1049345 | Ga0314311_104934512 | 257 |
| 451 | 3300030735 | Ga0316178_1053423 | Ga0316178_10534238 | 257 |
| 452 | 3300030742 | Ga0316183_1023591 | Ga0316183_10235912 | 257 |
| 453 | 3300030742 | Ga0316183_1194403 | Ga0316183_11944033 | 257 |
| 454 | 3300030744 | Ga0316181_1061609 | Ga0316181_10616091 | 257 |
| 455 | 3300030745 | Ga0316182_1044621 | Ga0316182_10446215 | 257 |
| 456 | 3300031235 | Ga0265330_10054816 | Ga0265330_100548162 | 257 |
| 457 | 3300031250 | Ga0265331_10060652 | Ga0265331_100606521 | 257 |
| 458 | 3300031251 | Ga0265327_10119761 | Ga0265327_101197612 | 257 |
| 459 | 3300031251 | Ga0265327_10140962 | Ga0265327_101409621 | 257 |
| 460 | 3300031456 | Ga0307513_10000194 | Ga0307513_100001946 | 257 |
| 461 | 3300031456 | Ga0307513_10001393 | Ga0307513_100013937 | 257 |
| 462 | 3300031456 | Ga0307513_10154016 | Ga0307513_101540162 | 257 |
| 463 | 3300031548 | Ga0307408_100000171 | Ga0307408_1000001717 | 257 |
| 464 | 3300031548 | Ga0307408_100007277 | Ga0307408_1000072772 | 257 |
| 465 | 3300031548 | Ga0307408_100076061 | Ga0307408_1000760612 | 257 |
| 466 | 3300031649 | Ga0307514_10000828 | Ga0307514_100008288 | 257 |
| 467 | 3300031649 | Ga0307514_10026727 | Ga0307514_100267274 | 257 |
| 468 | 3300031691 | Ga0316579_10000177 | Ga0316579_1000017716 | 257 |
| 469 | 3300031711 | Ga0265314_10020869 | Ga0265314_100208694 | 257 |
| 470 | 3300031711 | Ga0265314_10036600 | Ga0265314_100366002 | 257 |
| 471 | 3300031712 | Ga0265342_10022315 | Ga0265342_100223153 | 257 |
| 472 | 3300031712 | Ga0265342_10047726 | Ga0265342_100477261 | 257 |
| 473 | 3300031727 | Ga0316576_10018905 | Ga0316576_100189052 | 257 |
| 474 | 3300031728 | Ga0316578_10028686 | Ga0316578_100286862 | 257 |
| 475 | 3300031730 | Ga0307516_10006663 | Ga0307516_100066639 | 257 |
| 476 | 3300031731 | Ga0307405_10028542 | Ga0307405_100285422 | 257 |
| 477 | 3300031731 | Ga0307405_10139849 | Ga0307405_101398491 | 257 |
| 478 | 3300031733 | Ga0316577_10001607 | Ga0316577_100016074 | 257 |
| 479 | 3300031901 | Ga0307406_10001400 | Ga0307406_1000140011 | 257 |
| 480 | 3300031901 | Ga0307406_10007237 | Ga0307406_100072372 | 257 |
| 481 | 3300031901 | Ga0307406_10188084 | Ga0307406_101880842 | 257 |
| 482 | 3300031911 | Ga0307412_10084078 | Ga0307412_100840783 | 257 |
| 483 | 3300031911 | Ga0307412_10214401 | Ga0307412_102144011 | 257 |
| 484 | 3300031911 | Ga0307412_10252776 | Ga0307412_102527762 | 257 |
| 485 | 3300031911 | Ga0307412_10490751 | Ga0307412_104907512 | 257 |
| 486 | 3300031911 | Ga0307412_10523127 | Ga0307412_105231271 | 257 |
| 487 | 3300032002 | Ga0307416_100222755 | Ga0307416_1002227552 | 257 |
| 488 | 3300032002 | Ga0307416_100494104 | Ga0307416_1004941042 | 257 |
| 489 | 3300032002 | Ga0307416_100506143 | Ga0307416_1005061432 | 257 |
| 490 | 3300032005 | Ga0307411_10138374 | Ga0307411_101383741 | 257 |
| 491 | 3300032137 | Ga0316585_10021205 | Ga0316585_100212052 | 257 |
| 492 | 3300032139 | Ga0316580_10000077 | Ga0316580_100000771 | 257 |
| 493 | 3300033524 | Ga0316592_1019927 | Ga0316592_10199271 | 257 |
| 494 | 3300035398 | Ga0316574_0000453 | Ga0316574_0000453_6548_7330 | 257 |
| 495 | 3300036647 | Ga0316582_0002708 | Ga0316582_0002708_6946_7728 | 257 |
| 496 | 3300036712 | Ga0316584_0061444 | Ga0316584_0061444_42_824 | 257 |
| 497 | 3300037312 | Ga0395899_0086470 | Ga0395899_0086470_1146_1919 | 257 |
| 498 | 3300037418 | Ga0395900_0052621 | Ga0395900_0052621_2493_3266 | 257 |
| 499 | 3300037418 | Ga0395900_0266776 | Ga0395900_0266776_601_1374 | 257 |
| 500 | 3300037466 | Ga0395898_0004483 | Ga0395898_0004483_2774_3550 | 257 |
| 501 | 3300037466 | Ga0395898_0019317 | Ga0395898_0019317_4373_5146 | 257 |
| 502 | 3300037466 | Ga0395898_0150582 | Ga0395898_0150582_1145_1918 | 257 |
| 503 | 3300037466 | Ga0395898_0330291 | Ga0395898_0330291_247_1068 | 257 |
| 504 | 3300037471 | Ga0395905_0000132 | Ga0395905_0000132_92329_93102 | 257 |
| 505 | 3300037471 | Ga0395905_0000773 | Ga0395905_0000773_5838_6632 | 257 |
| 506 | 3300037471 | Ga0395905_0020265 | Ga0395905_0020265_1665_2438 | 257 |
| 507 | 3300037471 | Ga0395905_0020548 | Ga0395905_0020548_2218_3039 | 257 |
| 508 | 3300037471 | Ga0395905_0032508 | Ga0395905_0032508_3948_4844 | 257 |
| 509 | 3300037471 | Ga0395905_0045023 | Ga0395905_0045023_185_958 | 257 |
| 510 | 3300037471 | Ga0395905_0463096 | Ga0395905_0463096_286_1059 | 257 |
| 511 | 3300038443 | Ga0395901_0061368 | Ga0395901_0061368_926_1699 | 257 |
| 512 | 3300038443 | Ga0395901_0099473 | Ga0395901_0099473_2102_2878 | 257 |
| 513 | 3300038443 | Ga0395901_0191808 | Ga0395901_0191808_396_1217 | 257 |
| 514 | 3300038443 | Ga0395901_0306610 | Ga0395901_0306610_600_1412 | 257 |
| 515 | 3300038443 | Ga0395901_0387156 | Ga0395901_0387156_651_1424 | 257 |
| 516 | 3300039447 | Ga0436361_0206236 | Ga0436361_0206236_14494_15282 | 257 |
| 517 | 3300041404 | Ga0439436_0033022 | Ga0439436_0033022_144_920 | 257 |
| 518 | 3300041404 | Ga0439436_0048747 | Ga0439436_0048747_415_1188 | 257 |
| 519 | 3300041405 | Ga0439438_035333 | Ga0439438_035333_318_1091 | 257 |
| 520 | 3300041406 | Ga0439439_0004892 | Ga0439439_0004892_1566_2339 | 257 |
| 521 | 3300041411 | Ga0439466_0017020 | Ga0439466_0017020_1425_2198 | 257 |
| 522 | 3300041411 | Ga0439466_0031968 | Ga0439466_0031968_151_924 | 257 |
| 523 | 3300041413 | Ga0439465_0004122 | Ga0439465_0004122_2851_3627 | 257 |
| 524 | 3300041452 | Ga0451793_0841222 | Ga0451793_0841222_72_848 | 257 |
| 525 | 3300041453 | Ga0451797_1279811 | Ga0451797_1279811_174_947 | 257 |
| 526 | 3300041458 | Ga0451798_0376783 | Ga0451798_0376783_498_1271 | 257 |
| 527 | 3300041486 | Ga0451807_0205605 | Ga0451807_0205605_198_971 | 257 |
| 528 | 3300041512 | Ga0451853_2214512 | Ga0451853_2214512_294_1067 | 257 |
| 529 | 3300041997 | Ga0439431_0004094 | Ga0439431_0004094_2034_2810 | 257 |
| 530 | 3300041999 | Ga0439433_0011737 | Ga0439433_0011737_533_1321 | 257 |
| 531 | 3300041999 | Ga0439433_0012763 | Ga0439433_0012763_912_1685 | 257 |
| 532 | 3300042002 | Ga0439442_001658 | Ga0439442_001658_578_1351 | 257 |
| 533 | 3300042004 | Ga0439445_0040432 | Ga0439445_0040432_274_1047 | 257 |
| 534 | 3300042004 | Ga0439445_0043154 | Ga0439445_0043154_125_898 | 257 |
| 535 | 3300042006 | Ga0439432_001627 | Ga0439432_001627_2981_3757 | 257 |
| 536 | 3300042006 | Ga0439432_040723 | Ga0439432_040723_421_1197 | 257 |
| 537 | 3300042006 | Ga0439432_054420 | Ga0439432_054420_420_1193 | 257 |
| 538 | 3300042007 | Ga0439449_0000571 | Ga0439449_0000571_2925_3701 | 257 |
| 539 | 3300042007 | Ga0439449_0010193 | Ga0439449_0010193_587_1375 | 257 |
| 540 | 3300042007 | Ga0439449_0027811 | Ga0439449_0027811_545_1321 | 257 |
| 541 | 3300042010 | Ga0439452_000889 | Ga0439452_000889_3207_3983 | 257 |
| 542 | 3300042010 | Ga0439452_004162 | Ga0439452_004162_2141_2914 | 257 |
| 543 | 3300042014 | Ga0439457_021025 | Ga0439457_021025_32_805 | 257 |
| 544 | 3300042014 | Ga0439457_026479 | Ga0439457_026479_103_879 | 257 |
| 545 | 3300042015 | Ga0439462_0000395 | Ga0439462_0000395_5661_6449 | 257 |
| 546 | 3300042015 | Ga0439462_0003003 | Ga0439462_0003003_2598_3371 | 257 |
| 547 | 3300042015 | Ga0439462_0033542 | Ga0439462_0033542_107_883 | 257 |
| 548 | 3300042115 | Ga0450911_001876 | Ga0450911_001876_557_1330 | 257 |
| 549 | 3300042125 | Ga0450923_000153 | Ga0450923_000153_1654_2439 | 257 |
| 550 | 3300042125 | Ga0450923_004312 | Ga0450923_004312_701_1474 | 257 |
| 551 | 3300042126 | Ga0450888_000733 | Ga0450888_000733_623_1438 | 257 |
| 552 | 3300042133 | Ga0450896_009789 | Ga0450896_009789_284_1057 | 257 |
| 553 | 3300042134 | Ga0450898_009975 | Ga0450898_009975_719_1492 | 257 |
| 554 | 3300042134 | Ga0450898_027951 | Ga0450898_027951_106_879 | 257 |
| 555 | 3300042145 | Ga0450906_003909 | Ga0450906_003909_766_1539 | 257 |
| 556 | 3300042146 | Ga0450907_009943 | Ga0450907_009943_126_899 | 257 |
| 557 | 3300042147 | Ga0450910_003552 | Ga0450910_003552_519_1292 | 257 |
| 558 | 3300042185 | Ga0450909_006945 | Ga0450909_006945_468_1241 | 257 |
| 559 | 3300042185 | Ga0450909_008427 | Ga0450909_008427_394_1170 | 257 |
| 560 | 3300042439 | Ga0439464_0020302 | Ga0439464_0020302_433_1209 | 257 |
| 561 | 3300042531 | Ga0450918_002160 | Ga0450918_002160_2397_3170 | 257 |
| 562 | 3300042532 | Ga0450893_0000734 | Ga0450893_0000734_1082_1897 | 257 |
| 563 | 3300042532 | Ga0450893_0001087 | Ga0450893_0001087_3110_3883 | 257 |
| 564 | 3300042532 | Ga0450893_0028823 | Ga0450893_0028823_155_928 | 257 |
| 565 | 3300042876 | Ga0451577_0000235 | Ga0451577_0000235_84351_85127 | 257 |
| 566 | 3300042876 | Ga0451577_0033005 | Ga0451577_0033005_2698_3504 | 257 |
| 567 | 3300044656 | Ga0466969_0056259 | Ga0466969_0056259_885_1658 | 257 |
| 568 | 3300044656 | Ga0466969_0066543 | Ga0466969_0066543_129_902 | 257 |
| 569 | 3300044673 | Ga0453683_0000588 | Ga0453683_0000588_33879_34655 | 257 |
| 570 | 3300044673 | Ga0453683_0002178 | Ga0453683_0002178_14482_15288 | 257 |
| 571 | 3300044684 | Ga0466966_0005481 | Ga0466966_0005481_7365_8138 | 257 |
| 572 | 3300044712 | Ga0453684_0000906 | Ga0453684_0000906_73476_74252 | 257 |
| 573 | 3300044712 | Ga0453684_0048485 | Ga0453684_0048485_2112_2918 | 257 |
| 574 | 3300044712 | Ga0453684_0421008 | Ga0453684_0421008_562_1344 | 257 |
| 575 | 3300044735 | Ga0466968_0043761 | Ga0466968_0043761_178_999 | 257 |
| 576 | 3300044765 | Ga0466970_0073416 | Ga0466970_0073416_26_799 | 257 |
| 577 | 3300044901 | Ga0466960_0133422 | Ga0466960_0133422_283_1059 | 257 |
| 578 | 3300045049 | Ga0466959_0120105 | Ga0466959_0120105_244_1017 | 257 |
| 579 | 3300045051 | Ga0451576_0016371 | Ga0451576_0016371_6859_7635 | 257 |
| 580 | 3300045051 | Ga0451576_0209915 | Ga0451576_0209915_38_844 | 257 |
| 581 | 3300045836 | Ga0466958_0281017 | Ga0466958_0281017_56_829 | 257 |
| 582 | 3300046453 | Ga0495627_009827 | Ga0495627_009827_2224_2997 | 257 |
| 583 | 3300046460 | Ga0495638_0083365 | Ga0495638_0083365_46_819 | 257 |
| 584 | 3300046462 | Ga0495651_0170788 | Ga0495651_0170788_717_1490 | 257 |
| 585 | 3300046514 | Ga0495618_0328101 | Ga0495618_0328101_22_795 | 257 |
| 586 | 3300046515 | Ga0495620_0024857 | Ga0495620_0024857_360_1133 | 257 |
| 587 | 3300046517 | Ga0495630_0139490 | Ga0495630_0139490_344_1183 | 257 |
| 588 | 3300046520 | Ga0495637_0008818 | Ga0495637_0008818_3911_4684 | 257 |
| 589 | 3300046530 | Ga0495654_0023367 | Ga0495654_0023367_444_1226 | 257 |
| 590 | 3300046530 | Ga0495654_0070369 | Ga0495654_0070369_870_1643 | 257 |
| 591 | 3300046531 | Ga0495665_0068407 | Ga0495665_0068407_558_1397 | 257 |
| 592 | 3300046538 | Ga0495609_0067799 | Ga0495609_0067799_686_1459 | 257 |
| 593 | 3300046542 | Ga0495597_0000271 | Ga0495597_0000271_29475_30257 | 257 |
| 594 | 3300046542 | Ga0495597_0014491 | Ga0495597_0014491_770_1600 | 257 |
| 595 | 3300046558 | Ga0495633_0103415 | Ga0495633_0103415_60_833 | 257 |
| 596 | 3300046615 | Ga0495656_0000586 | Ga0495656_0000586_666_1439 | 257 |
| 597 | 3300046660 | Ga0495625_0000045 | Ga0495625_0000045_72843_73616 | 257 |
| 598 | 3300046660 | Ga0495625_0000379 | Ga0495625_0000379_98_904 | 257 |
| 599 | 3300046674 | Ga0495588_0043933 | Ga0495588_0043933_918_1691 | 257 |
| 600 | 3300046691 | Ga0495670_0082233 | Ga0495670_0082233_628_1401 | 257 |
| 601 | 3300046692 | Ga0495671_0013910 | Ga0495671_0013910_78_884 | 257 |
| 602 | 3300046692 | Ga0495671_0026847 | Ga0495671_0026847_500_1273 | 257 |
| 603 | 3300047321 | Ga0495676_0002862 | Ga0495676_0002862_10052_10825 | 257 |
| 604 | 3300047443 | Ga0495687_000523 | Ga0495687_000523_9358_10188 | 257 |
| 605 | 3300047673 | Ga0495593_0005402 | Ga0495593_0005402_3655_4428 | 257 |
| 606 | 3300048089 | Ga0495614_0004291 | Ga0495614_0004291_5025_5798 | 257 |
| 607 | 3300048090 | Ga0495615_0027805 | Ga0495615_0027805_195_968 | 257 |
| 608 | 3300048091 | Ga0495626_0080112 | Ga0495626_0080112_554_1384 | 257 |
| 609 | 3300048903 | Ga0496100_0009492 | Ga0496100_0009492_592_1365 | 257 |
| 610 | 3300048904 | Ga0496101_0030606 | Ga0496101_0030606_825_1598 | 257 |
| 611 | 3300048904 | Ga0496101_0063417 | Ga0496101_0063417_316_1089 | 257 |
| 612 | 3300048906 | Ga0496103_0041716 | Ga0496103_0041716_387_1226 | 257 |
| 613 | 3300048907 | Ga0496104_0013702 | Ga0496104_0013702_5001_5840 | 257 |
| 614 | 3300048907 | Ga0496104_0170425 | Ga0496104_0170425_1211_1984 | 257 |
| 615 | 3300048908 | Ga0496105_0035506 | Ga0496105_0035506_1509_2348 | 257 |
| 616 | 3300048909 | Ga0496106_0029989 | Ga0496106_0029989_605_1444 | 257 |
| 617 | 3300048909 | Ga0496106_0124152 | Ga0496106_0124152_544_1317 | 257 |
| 618 | 3300048910 | Ga0496107_0072969 | Ga0496107_0072969_974_1747 | 257 |
| 619 | 3300048912 | Ga0496109_0001638 | Ga0496109_0001638_8001_8840 | 257 |
| 620 | 3300048912 | Ga0496109_0386946 | Ga0496109_0386946_227_1000 | 257 |
| 621 | 3300048913 | Ga0496110_0049590 | Ga0496110_0049590_1850_2689 | 257 |
| 622 | 3300048913 | Ga0496110_0204062 | Ga0496110_0204062_228_1001 | 257 |
| 623 | 3300048914 | Ga0496111_0005028 | Ga0496111_0005028_1604_2443 | 257 |
| 624 | 3300048914 | Ga0496111_0093096 | Ga0496111_0093096_1247_2020 | 257 |
| 625 | 3300048915 | Ga0496112_0000852 | Ga0496112_0000852_5001_5840 | 257 |
| 626 | 3300048916 | Ga0496113_0000175 | Ga0496113_0000175_26199_27038 | 257 |
| 627 | 3300048919 | Ga0496116_0048461 | Ga0496116_0048461_61_846 | 257 |
| 628 | 3300048919 | Ga0496116_0073305 | Ga0496116_0073305_975_1748 | 257 |
| 629 | 3300048920 | Ga0496117_0024067 | Ga0496117_0024067_699_1472 | 257 |
| 630 | 3300048920 | Ga0496117_0028409 | Ga0496117_0028409_2120_2905 | 257 |
| 631 | 3300048920 | Ga0496117_0060609 | Ga0496117_0060609_699_1472 | 257 |
| 632 | 3300048921 | Ga0496118_0013925 | Ga0496118_0013925_6244_7017 | 257 |
| 633 | 3300048924 | Ga0496121_0051436 | Ga0496121_0051436_2207_2980 | 257 |
| 634 | 3300048924 | Ga0496121_0095038 | Ga0496121_0095038_918_1691 | 257 |
| 635 | 3300048925 | Ga0496122_0227542 | Ga0496122_0227542_55_828 | 257 |
| 636 | 3300048927 | Ga0496124_0021946 | Ga0496124_0021946_1255_2040 | 257 |
| 637 | 3300048927 | Ga0496124_0150891 | Ga0496124_0150891_483_1256 | 257 |
| 638 | 3300048927 | Ga0496124_0326387 | Ga0496124_0326387_77_850 | 257 |
| 639 | 3300048928 | Ga0496125_0010440 | Ga0496125_0010440_3239_4012 | 257 |
| 640 | 3300048928 | Ga0496125_0095622 | Ga0496125_0095622_492_1265 | 257 |
| 641 | 3300048928 | Ga0496125_0131223 | Ga0496125_0131223_212_985 | 257 |
| 642 | 3300048929 | Ga0496126_0334829 | Ga0496126_0334829_69_842 | 257 |
| 643 | 3300049515 | Ga0501292_009051 | Ga0501292_009051_418_1236 | 257 |
| 644 | 3300049568 | Ga0501031_0001052 | Ga0501031_0001052_9934_10728 | 257 |
| 645 | 3300049571 | Ga0501034_0231344 | Ga0501034_0231344_993_1766 | 257 |
| 646 | 3300049572 | Ga0501036_0565521 | Ga0501036_0565521_149_922 | 257 |
| 647 | 3300049574 | Ga0501038_0315197 | Ga0501038_0315197_164_940 | 257 |
| 648 | 3300049581 | Ga0501047_0117437 | Ga0501047_0117437_1371_2189 | 257 |
| 649 | 3300049663 | Ga0501223_004131 | Ga0501223_004131_2303_3088 | 257 |
| 650 | 3300049679 | Ga0501249_004824 | Ga0501249_004824_927_1700 | 257 |
| 651 | 3300049683 | Ga0501253_012557 | Ga0501253_012557_123_941 | 257 |
| 652 | 3300049704 | Ga0501221_022229 | Ga0501221_022229_268_1041 | 257 |
| 653 | 3300049705 | Ga0501225_0003847 | Ga0501225_0003847_622_1395 | 257 |
| 654 | 3300049759 | Ga0501262_003565 | Ga0501262_003565_371_1144 | 257 |
| 655 | 3300049762 | Ga0501265_004538 | Ga0501265_004538_251_1069 | 257 |
| 656 | 3300050489 | nmdc:mga03683_1072_c1 | nmdc:mga03683_1072_c1_6570_7346 | 257 |
| 657 | 3300050489 | nmdc:mga03683_3450_c2 | nmdc:mga03683_3450_c2_2374_3147 | 257 |
| 658 | 3300050489 | nmdc:mga03683_77218_c1 | nmdc:mga03683_77218_c1_172_945 | 257 |
| 659 | 3300050490 | nmdc:mga03n38_232134_c1 | nmdc:mga03n38_232134_c1_100_873 | 257 |
| 660 | 3300050490 | nmdc:mga03n38_32650_c1 | nmdc:mga03n38_32650_c1_502_1275 | 257 |
| 661 | 3300050492 | nmdc:mga0yw44_460128_c1 | nmdc:mga0yw44_460128_c1_70_846 | 257 |
| 662 | 3300050492 | nmdc:mga0yw44_799_c1 | nmdc:mga0yw44_799_c1_8744_9517 | 257 |
| 663 | 3300050493 | nmdc:mga0k408_20964_c1 | nmdc:mga0k408_20964_c1_1597_2409 | 257 |
| 664 | 3300050493 | nmdc:mga0k408_272923_c1 | nmdc:mga0k408_272923_c1_15_788 | 257 |
| 665 | 3300050493 | nmdc:mga0k408_55334_c1 | nmdc:mga0k408_55334_c1_724_1497 | 257 |
| 666 | 3300050493 | nmdc:mga0k408_67935_c1 | nmdc:mga0k408_67935_c1_574_1350 | 257 |
| 667 | 3300050494 | nmdc:mga06z11_207622_c1 | nmdc:mga06z11_207622_c1_337_1110 | 257 |
| 668 | 3300050495 | nmdc:mga04h51_68198_c1 | nmdc:mga04h51_68198_c1_148_921 | 257 |
| 669 | 3300050496 | nmdc:mga07m45_21486_c1 | nmdc:mga07m45_21486_c1_64_849 | 257 |
| 670 | 3300050496 | nmdc:mga07m45_25573_c1 | nmdc:mga07m45_25573_c1_1320_2093 | 257 |
| 671 | 3300050496 | nmdc:mga07m45_83_c1 | nmdc:mga07m45_83_c1_25173_25946 | 257 |
| 672 | 3300050509 | nmdc:mga0qj67_417234_c1 | nmdc:mga0qj67_417234_c1_295_1071 | 257 |
| 673 | 3300050511 | nmdc:mga08y16_65578_c1 | nmdc:mga08y16_65578_c1_988_1827 | 257 |
| 674 | 3300053079 | Ga0500610_0021582 | Ga0500610_0021582_1449_2222 | 257 |
| 675 | 3300053093 | Ga0500651_0000328 | Ga0500651_0000328_19116_19889 | 257 |
| 676 | 3300053117 | Ga0500593_000328 | Ga0500593_000328_8429_9202 | 257 |
| 677 | 3300053117 | Ga0500593_012616 | Ga0500593_012616_502_1275 | 257 |
| 678 | 3300053121 | Ga0500607_004248 | Ga0500607_004248_8246_9019 | 257 |
| 679 | 3300053129 | Ga0500628_002450 | Ga0500628_002450_473_1246 | 257 |
| 680 | 3300053134 | Ga0500658_0000117 | Ga0500658_0000117_6723_7496 | 257 |
| 681 | 3300053134 | Ga0500658_0000393 | Ga0500658_0000393_5055_5828 | 257 |
| 682 | 3300053139 | Ga0500568_0009858 | Ga0500568_0009858_3453_4226 | 257 |
| 683 | 3300053141 | Ga0500574_024317 | Ga0500574_024317_380_1153 | 257 |
| 684 | 3300053153 | Ga0500616_0055110 | Ga0500616_0055110_152_925 | 257 |
| 685 | 3300053158 | Ga0500627_0017547 | Ga0500627_0017547_1835_2608 | 257 |
| 686 | 3300053161 | Ga0500634_0072388 | Ga0500634_0072388_459_1232 | 257 |
| 687 | 3300053730 | Ga0500645_001273 | Ga0500645_001273_3941_4714 | 257 |
| 688 | iso_pu_bacteria | 2643221611 | 2644072810 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hin-assembly1.cif.gz_A | crystal structure of putative enoyl-coa hydratase from rhodopseudomonas palustris cga009 | 0.9463 | 5 | 254 |
| 4izd-assembly1.cif.gz_B | crystal structure of dmdd e121a in complex with mmpa-coa | 0.9347 | 2 | 251 |
| 4izb-assembly1.cif.gz_B | crystal structure of dmdd, a crotonase superfamily enzyme that catalyzes the hydration and hydrolysis of methylthioacryloyl-coa | 0.9345 | 2 | 242 |
| 5z7r-assembly1.cif.gz_A | crystal structure of crotonase from clostridium acetobutylicum | 0.9336 | 1 | 251 |
| 3myb-assembly1.cif.gz_B | crystal structure of enoyl-coa hydratase mycobacterium smegmatis | 0.9287 | 3 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hinB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9609 | 5 | 199 | 3.90.226.10 |
| 4izcA01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9405 | 2 | 199 | 3.90.226.10 |
| 5z7rC01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9379 | 1 | 199 | 3.90.226.10 |
| 3hinB01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9284 | 5 | 199 | 3.90.226.10 |
| af_B7F9R1_37_234_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9267 | 13 | 198 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A372ENQ7-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9769 | 1 | 257 |
GO:0004300
GO:0006635 |
| AF-A0A371B8H6-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9758 | 1 | 257 |
GO:0004300
GO:0006635 |
| AF-A0A640JNW7-F1-model_v4 | deleted | 0.9757 | 1 | 257 |
|
| AF-A0A2N4SPL2-F1-model_v4 | Enoyl-CoA hydratase (EC 4.2.1.17) | 0.9755 | 1 | 257 |
GO:0004300
GO:0006635 |
| AF-A0A260THM0-F1-model_v4 | deleted | 0.9755 | 3 | 257 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar