F475174

General Info

Members Datasets Scaffolds Average Seq Length
686 476 1372 186

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10018783|Ga0099795_100187832
Length 216
Sequence MIKIAITQPADCKRIEPSMAARCCAFERRRPMQVLATAIPDVKEVKPVRRFDPRGFFSEIFREDLLRQHGIASPFVQENLSLSADRGVVRGLHFQIPPQAQAKLVRVAAGSIFDVAVDIRHGSPTYGHHVGVMLSAAEGNQLYIPEGFAHGFCTLEPNTEVVYKVNRYYSPEHDRGLRWDDSALAIAWPVEEEKALLSDKDRRQPMFAELPRHFDY

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
103 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
104 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
198 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
199 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
200 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
203 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
209 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
236 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
278 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
279 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
280 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
293 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
294 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
295 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
296 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
297 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
298 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
299 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
300 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
301 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
302 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
305 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
306 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
307 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
308 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
309 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
310 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
311 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
312 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
313 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
314 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
318 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
319 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
320 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
321 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
322 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
323 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
324 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
325 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
326 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
327 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
328 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
329 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
330 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
331 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
332 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
333 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
334 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
335 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
336 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
337 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
338 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
339 2751185800 Brucella pituitosa AA2 Isolate Unclassified
340 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
341 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
342 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
343 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
344 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
345 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
346 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
347 2854911287 Brucella lupini LUP21 Isolate Unclassified
348 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
349 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
350 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
351 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
352 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
353 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
354 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
355 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
356 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
357 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
358 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
359 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
360 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
361 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
362 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
363 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
364 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
365 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
366 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
367 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
368 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
369 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
370 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
371 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
372 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
373 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
374 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
375 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
376 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
377 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
378 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
379 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
380 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
381 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
382 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
383 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
384 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
385 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
386 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
387 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
388 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
389 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
390 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
391 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
392 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
393 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
394 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
395 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
396 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
397 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
398 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
399 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
400 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
401 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
402 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
403 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
404 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
405 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
406 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
407 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
408 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
409 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
410 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
411 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
412 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
413 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
414 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
415 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
416 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
417 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
418 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
419 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
420 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
421 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
422 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
423 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
424 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
425 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
426 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
427 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
428 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
429 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
430 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
431 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
432 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
433 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
434 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
435 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
436 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
437 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
438 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
439 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
440 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
441 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
442 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
443 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
444 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
445 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
446 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
447 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
448 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
449 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
450 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
451 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
452 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
453 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
454 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
455 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
456 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
457 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
458 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
459 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
460 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
461 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
462 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
463 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
464 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
465 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
466 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
467 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
468 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
469 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
470 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
471 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
472 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
473 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
474 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
475 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
476 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.24
Metatranscriptomes 0.44
Isolates 23.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.87
Nodule 18.95
Rhizoplane 5.69
Rhizosphere 60.2
Stem 0
Stem Tuber 0
Unclassified 3.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10018783 3300007788 Bacteria 2227
2 JGI25406J46586_10005313 3300003203 Bacteria 5977
3 JGI25406J46586_10006357 3300003203 Bacteria 5449
4 JGI25153J46596_10008957 3300003215 Bacteria 4718
5 rootH1_10193276 3300003323 Bacteria 1996
6 Ga0006562J51391_1012741 3300003578 Bacteria 5060
7 JGI25404J52841_10000732 3300003659 Bacteria 5122
8 Ga0055534_1011924 3300003784 Bacteria 1743
9 Ga0055530_10016351 3300003791 Bacteria 2375
10 Ga0065165_1005965 3300005262 Bacteria 6588
11 Ga0065704_10076914 3300005289 Bacteria 4929
12 Ga0065704_10101107 3300005289 Bacteria 2249
13 Ga0065704_10136505 3300005289 Bacteria 1565
14 Ga0065715_10091015 3300005293 Bacteria 6201
15 Ga0065715_10315726 3300005293 Bacteria 1012
16 Ga0070683_100006765 3300005329 Bacteria 9633
17 Ga0070683_100061609 3300005329 Bacteria 3489
18 Ga0070683_100386486 3300005329 Bacteria 1334
19 Ga0070683_100843070 3300005329 Unclassified 879
20 Ga0070690_100186718 3300005330 Bacteria 1435
21 Ga0070670_100368967 3300005331 Bacteria 1263
22 Ga0070670_100369575 3300005331 Bacteria 1262
23 Ga0068869_100120993 3300005334 Bacteria 2002
24 Ga0070680_100048548 3300005336 Bacteria 3460
25 Ga0070691_10286917 3300005341 Bacteria 895
26 Ga0070661_100153920 3300005344 Bacteria 1739
27 Ga0070661_100463970 3300005344 Bacteria 1009
28 Ga0070692_10184748 3300005345 Bacteria 1211
29 Ga0070675_100543215 3300005354 Bacteria 1050
30 Ga0070671_100011087 3300005355 Bacteria 7237
31 Ga0070671_100197849 3300005355 Bacteria 1704
32 Ga0070673_100221363 3300005364 Bacteria 1638
33 Ga0070659_100007022 3300005366 Bacteria 8156
34 Ga0070709_10063261 3300005434 Bacteria 2362
35 Ga0070709_10382574 3300005434 Bacteria 1046
36 Ga0070714_100489051 3300005435 Bacteria 1172
37 Ga0070714_100873765 3300005435 Bacteria 872
38 Ga0070713_100052387 3300005436 Bacteria 3379
39 Ga0070713_100126300 3300005436 Bacteria 2250
40 Ga0070713_100134652 3300005436 Bacteria 2182
41 Ga0070710_10233544 3300005437 Bacteria 1175
42 Ga0070711_100049233 3300005439 Bacteria 2885
43 Ga0070711_100856462 3300005439 Unclassified 773
44 Ga0070705_100209995 3300005440 Bacteria 1341
45 Ga0070694_100394994 3300005444 Bacteria 1081
46 Ga0070663_100002386 3300005455 Bacteria 10559
47 Ga0070678_100526863 3300005456 Bacteria 1046
48 Ga0070662_100671402 3300005457 Bacteria 875
49 Ga0070662_100682097 3300005457 Bacteria 868
50 Ga0070681_10036557 3300005458 Bacteria 4931
51 Ga0068867_100756670 3300005459 Bacteria 863
52 Ga0070679_100098272 3300005530 Bacteria 2915
53 Ga0070684_100092934 3300005535 Bacteria 2685
54 Ga0070684_100927100 3300005535 Bacteria 816
55 Ga0070697_100032202 3300005536 Bacteria 4218
56 Ga0068853_100017732 3300005539 Bacteria 5876
57 Ga0068853_100390372 3300005539 Bacteria 1301
58 Ga0070695_100016622 3300005545 Bacteria 4457
59 Ga0070696_100018567 3300005546 Bacteria 4702
60 Ga0070693_100034290 3300005547 Bacteria 2808
61 Ga0070693_100066894 3300005547 Bacteria 2104
62 Ga0070704_100030920 3300005549 Bacteria 3594
63 Ga0070704_100813283 3300005549 Bacteria 836
64 Ga0070704_100818062 3300005549 Bacteria 833
65 Ga0068855_100001082 3300005563 Bacteria 33864
66 Ga0068855_100131098 3300005563 Bacteria 2863
67 Ga0070664_100033514 3300005564 Bacteria 4303
68 Ga0070664_100144222 3300005564 Bacteria 2099
69 Ga0070664_100183938 3300005564 Bacteria 1859
70 Ga0070664_100309711 3300005564 Unclassified 1429
71 Ga0068857_100045275 3300005577 Bacteria 3903
72 Ga0068854_100115058 3300005578 Bacteria 2034
73 Ga0068856_100148978 3300005614 Bacteria 2348
74 Ga0068856_100225382 3300005614 Bacteria 1890
75 Ga0068856_100259474 3300005614 Bacteria 1753
76 Ga0070702_100008145 3300005615 Bacteria 5065
77 Ga0068852_100673075 3300005616 Bacteria 1044
78 Ga0068852_101100904 3300005616 Unclassified 815
79 Ga0068859_101247728 3300005617 Bacteria 819
80 Ga0068859_101705811 3300005617 Bacteria 696
81 Ga0068859_101836109 3300005617 Bacteria 669
82 Ga0068866_10731880 3300005718 Bacteria 681
83 Ga0068851_10237985 3300005834 Bacteria 1028
84 Ga0068870_10397394 3300005840 Bacteria 896
85 Ga0068863_100329130 3300005841 Bacteria 1485
86 Ga0068858_100265126 3300005842 Bacteria 1634
87 Ga0068858_100652904 3300005842 Unclassified 1022
88 Ga0068860_100008948 3300005843 Bacteria 9973
89 Ga0068860_100461524 3300005843 Bacteria 1264
90 Ga0081540_1000026 3300005983 Bacteria 155402
91 Ga0081539_10001608 3300005985 Bacteria 37193
92 Ga0070717_10305361 3300006028 Bacteria 1415
93 Ga0070717_10459301 3300006028 Bacteria 1148
94 Ga0070717_10673044 3300006028 Bacteria 940
95 Ga0075365_10054070 3300006038 Bacteria 2661
96 Ga0075363_100109704 3300006048 Bacteria 1533
97 Ga0075363_100192348 3300006048 Bacteria 1164
98 Ga0075364_10035753 3300006051 Bacteria 3211
99 Ga0070716_100000145 3300006173 Bacteria 28411
100 Ga0070712_100076890 3300006175 Bacteria 2404
101 Ga0070712_100226687 3300006175 Bacteria 1482
102 Ga0075362_10003498 3300006177 Bacteria 5509
103 Ga0075366_10292905 3300006195 Bacteria 995
104 Ga0075370_10026388 3300006353 Bacteria 3218
105 Ga0068871_100228823 3300006358 Bacteria 1613
106 Ga0068871_100522503 3300006358 Bacteria 1072
107 Ga0075430_100814067 3300006846 Bacteria 770
108 Ga0075433_10176851 3300006852 Bacteria 1899
109 Ga0075434_100237142 3300006871 Bacteria 1844
110 Ga0075436_100057009 3300006914 Bacteria 2698
111 Ga0097620_101705584 3300006931 Bacteria 696
112 Ga0097620_101836257 3300006931 Bacteria 669
113 Ga0075435_100805974 3300007076 Bacteria 818
114 Ga0099795_10032603 3300007788 Bacteria 1803
115 Ga0105240_10011621 3300009093 Bacteria 12245
116 Ga0105240_10592525 3300009093 Bacteria 1221
117 Ga0111539_10845855 3300009094 Bacteria 1065
118 Ga0111539_10922984 3300009094 Bacteria 1015
119 Ga0105245_10041075 3300009098 Bacteria 4123
120 Ga0105245_10118925 3300009098 Bacteria 2466
121 Ga0105245_10628042 3300009098 Bacteria 1103
122 Ga0105247_10087581 3300009101 Bacteria 1972
123 Ga0105247_10229396 3300009101 Bacteria 1260
124 Ga0105243_10741810 3300009148 Bacteria 962
125 Ga0105241_10006012 3300009174 Bacteria 8955
126 Ga0105241_10047303 3300009174 Bacteria 3271
127 Ga0105241_10107351 3300009174 Bacteria 2230
128 Ga0105241_10161736 3300009174 Bacteria 1841
129 Ga0105248_10003346 3300009177 Bacteria 17822
130 Ga0105248_10342881 3300009177 Bacteria 1682
131 Ga0105248_11679242 3300009177 Bacteria 720
132 Ga0105237_10001961 3300009545 Bacteria 26196
133 Ga0105237_10075352 3300009545 Bacteria 3365
134 Ga0105237_10599005 3300009545 Bacteria 1109
135 Ga0105238_10014352 3300009551 Bacteria 8008
136 Ga0105238_10114493 3300009551 Bacteria 2676
137 Ga0105249_10965492 3300009553 Bacteria 920
138 Ga0105249_11104873 3300009553 Bacteria 863
139 Ga0099796_10002309 3300010159 Bacteria 4156
140 Ga0105239_10338960 3300010375 Bacteria 1696
141 Ga0105239_10508268 3300010375 Bacteria 1370
142 Ga0105246_10042568 3300011119 Bacteria 3076
143 Ga0105246_10993082 3300011119 Unclassified 759
144 Ga0157369_10324579 3300013105 Bacteria 1600
145 Ga0157374_10163835 3300013296 Bacteria 2166
146 Ga0157374_10446882 3300013296 Bacteria 1294
147 Ga0157378_10000137 3300013297 Bacteria 69371
148 Ga0157378_10456827 3300013297 Bacteria 1269
149 Ga0157378_10972849 3300013297 Bacteria 882
150 Ga0157378_11043561 3300013297 Unclassified 853
151 Ga0163162_10011396 3300013306 Bacteria 8669
152 Ga0163162_10370500 3300013306 Bacteria 1565
153 Ga0157372_10686948 3300013307 Bacteria 1191
154 Ga0157375_10624183 3300013308 Bacteria 1236
155 Ga0163163_10279533 3300014325 Bacteria 1721
156 Ga0163163_10387748 3300014325 Bacteria 1455
157 Ga0163163_10610186 3300014325 Bacteria 1154
158 Ga0163163_11698572 3300014325 Bacteria 692
159 Ga0157380_10466905 3300014326 Bacteria 1217
160 Ga0157377_10249301 3300014745 Bacteria 1150
161 Ga0157377_10515330 3300014745 Bacteria 838
162 Ga0157379_10020881 3300014968 Bacteria 5795
163 Ga0157379_10090787 3300014968 Bacteria 2740
164 Ga0157376_10272847 3300014969 Bacteria 1590
165 Ga0163161_10522730 3300017792 Bacteria 969
166 Ga0163161_10546572 3300017792 Unclassified 949
167 Ga0213875_10013483 3300021388 Bacteria 4011
168 Ga0213875_10035642 3300021388 Bacteria 2348
169 Ga0213875_10144699 3300021388 Bacteria 1113
170 Ga0256744_143749 3300023309 Bacteria 747
171 Ga0207425_1028882 3300025245 Bacteria 1122
172 Ga0209673_1007558 3300025273 Bacteria 4979
173 Ga0209675_1000076 3300025291 Bacteria 159428
174 Ga0209676_1002852 3300025292 Bacteria 11407
175 Ga0209758_1000193 3300025297 Bacteria 134744
176 Ga0209050_1000198 3300025298 Bacteria 134820
177 Ga0207692_10201961 3300025898 Bacteria 1169
178 Ga0207642_10675642 3300025899 Bacteria 649
179 Ga0207688_10038915 3300025901 Bacteria 2641
180 Ga0207647_10008863 3300025904 Bacteria 7177
181 Ga0207699_10257888 3300025906 Bacteria 1204
182 Ga0207654_10439417 3300025911 Unclassified 913
183 Ga0207707_10080318 3300025912 Bacteria 2848
184 Ga0207707_10200437 3300025912 Bacteria 1740
185 Ga0207695_10013078 3300025913 Bacteria 9909
186 Ga0207695_10112342 3300025913 Bacteria 2702
187 Ga0207671_10005144 3300025914 Bacteria 12182
188 Ga0207693_10007459 3300025915 Bacteria 8997
189 Ga0207693_10290966 3300025915 Unclassified 1280
190 Ga0207693_10304631 3300025915 Bacteria 1248
191 Ga0207663_10154904 3300025916 Bacteria 1611
192 Ga0207660_10034563 3300025917 Bacteria 3505
193 Ga0207657_10211771 3300025919 Bacteria 1555
194 Ga0207649_10068638 3300025920 Bacteria 2255
195 Ga0207652_10095931 3300025921 Bacteria 2613
196 Ga0207652_10122250 3300025921 Bacteria 2317
197 Ga0207694_10088439 3300025924 Bacteria 2442
198 Ga0207650_10292624 3300025925 Bacteria 1328
199 Ga0207687_10207552 3300025927 Bacteria 1535
200 Ga0207687_10532026 3300025927 Bacteria 984
201 Ga0207700_10004238 3300025928 Bacteria 8425
202 Ga0207700_10130141 3300025928 Bacteria 2054
203 Ga0207700_10473728 3300025928 Bacteria 1106
204 Ga0207664_10193930 3300025929 Bacteria 1750
205 Ga0207664_10473777 3300025929 Bacteria 1119
206 Ga0207644_10042302 3300025931 Bacteria 3228
207 Ga0207644_10342309 3300025931 Bacteria 1213
208 Ga0207690_10982089 3300025932 Bacteria 702
209 Ga0207706_10676467 3300025933 Bacteria 883
210 Ga0207665_10000015 3300025939 Bacteria 133147
211 Ga0207711_10008218 3300025941 Bacteria 8736
212 Ga0207711_11113050 3300025941 Bacteria 731
213 Ga0207689_10083762 3300025942 Bacteria 2622
214 Ga0207661_10018071 3300025944 Bacteria 5234
215 Ga0207661_10326819 3300025944 Bacteria 1380
216 Ga0207661_10502474 3300025944 Bacteria 1108
217 Ga0207679_10499057 3300025945 Unclassified 1086
218 Ga0207667_10005618 3300025949 Bacteria 15301
219 Ga0207667_10131669 3300025949 Bacteria 2576
220 Ga0207651_10331208 3300025960 Bacteria 1276
221 Ga0207651_10765134 3300025960 Bacteria 854
222 Ga0207640_10246025 3300025981 Bacteria 1385
223 Ga0207658_10307000 3300025986 Bacteria 1369
224 Ga0207703_10168856 3300026035 Bacteria 1923
225 Ga0207703_10922849 3300026035 Bacteria 836
226 Ga0207639_10066736 3300026041 Bacteria 2797
227 Ga0207639_10285306 3300026041 Bacteria 1453
228 Ga0207678_10001728 3300026067 Bacteria 20004
229 Ga0207708_10124155 3300026075 Bacteria 2014
230 Ga0207702_10100613 3300026078 Bacteria 2551
231 Ga0207702_10536175 3300026078 Bacteria 1144
232 Ga0207702_10896451 3300026078 Bacteria 879
233 Ga0207648_10484531 3300026089 Bacteria 1130
234 Ga0207676_11284800 3300026095 Bacteria 726
235 Ga0207674_10038241 3300026116 Bacteria 4985
236 Ga0207674_10730497 3300026116 Bacteria 956
237 Ga0207683_10257710 3300026121 Bacteria 1592
238 Ga0207698_10285821 3300026142 Bacteria 1528
239 Ga0207698_10583884 3300026142 Bacteria 1100
240 Ga0207698_11080406 3300026142 Unclassified 815
241 Ga0207428_10369657 3300027907 Bacteria 1053
242 Ga0268264_10006281 3300028381 Bacteria 10020
243 Ga0268264_10435573 3300028381 Bacteria 1267
244 Ga0265325_10000883 3300031241 Bacteria 21638
245 Ga0265340_10000021 3300031247 Bacteria 87640
246 Ga0265340_10007700 3300031247 Bacteria 5841
247 Ga0265339_10008470 3300031249 Bacteria 6545
248 Ga0265331_10005821 3300031250 Bacteria 7387
249 Ga0265316_10011221 3300031344 Bacteria 8103
250 Ga0307513_10121789 3300031456 Bacteria 2574
251 Ga0307513_10252117 3300031456 Bacteria 1561
252 Ga0307509_10468070 3300031507 Bacteria 951
253 Ga0316576_10059742 3300031727 Bacteria 2792
254 Ga0307413_10224420 3300031824 Bacteria 1375
255 Ga0307406_10478602 3300031901 Bacteria 1005
256 Ga0307409_100021901 3300031995 Bacteria 4394
257 Ga0307409_100673953 3300031995 Bacteria 1031
258 Ga0307409_100898414 3300031995 Bacteria 899
259 Ga0307409_101265458 3300031995 Bacteria 762
260 Ga0307409_101444102 3300031995 Unclassified 715
261 Ga0307416_100857444 3300032002 Bacteria 1007
262 Ga0307414_10328306 3300032004 Bacteria 1305
263 Ga0307414_10372659 3300032004 Bacteria 1232
264 Ga0307411_10393337 3300032005 Bacteria 1144
265 Ga0373926_0032688 3300035083 Bacteria 1836
266 Ga0373926_0069335 3300035083 Bacteria 1294
267 Ga0373929_0074793 3300035085 Bacteria 816
268 Ga0373934_0059108 3300035086 Bacteria 1526
269 Ga0373944_0013984 3300035089 Bacteria 2235
270 Ga0373944_0029953 3300035089 Bacteria 1630
271 Ga0373923_0015422 3300035111 Bacteria 2885
272 Ga0373923_0025454 3300035111 Bacteria 2345
273 Ga0373923_0103258 3300035111 Bacteria 1259
274 Ga0373932_0182951 3300035112 Bacteria 736
275 Ga0373936_0024301 3300035113 Bacteria 2365
276 Ga0373945_0105818 3300035116 Bacteria 1106
277 Ga0373945_0327702 3300035116 Unclassified 660
278 Ga0373954_0120505 3300035118 Bacteria 1273
279 Ga0373956_0030002 3300035119 Bacteria 2374
280 Ga0373946_0039897 3300035171 Bacteria 1918
281 Ga0373946_0107435 3300035171 Bacteria 1259
282 Ga0373955_0052696 3300035172 Bacteria 2220
283 Ga0373955_0073000 3300035172 Bacteria 1923
284 Ga0373955_0414661 3300035172 Bacteria 819
285 Ga0373924_0008228 3300035410 Bacteria 3784
286 Ga0373924_0042870 3300035410 Bacteria 1857
287 Ga0373935_0094130 3300035692 Bacteria 1965
288 Ga0373935_0109598 3300035692 Bacteria 1831
289 Ga0373935_0219362 3300035692 Bacteria 1320
290 Ga0373935_0386289 3300035692 Bacteria 1003
291 Ga0373927_0091361 3300035695 Bacteria 1977
292 Ga0373927_0211307 3300035695 Bacteria 1274
293 Ga0373933_0065780 3300035724 Bacteria 2195
294 Ga0373933_0092148 3300035724 Bacteria 1871
295 Ga0373947_0095121 3300035725 Bacteria 1864
296 Ga0373947_0161484 3300035725 Bacteria 1449
297 Ga0373947_0163330 3300035725 Bacteria 1441
298 Ga0373947_0432533 3300035725 Unclassified 890
299 Ga0373937_0014570 3300036401 Bacteria 6944
300 Ga0373937_0016581 3300036401 Bacteria 6544
301 Ga0373937_0016833 3300036401 Bacteria 6499
302 Ga0373937_0054264 3300036401 Bacteria 3677
303 Ga0373937_0230314 3300036401 Bacteria 1745
304 Ga0373937_1094874 3300036401 Bacteria 745
305 Ga0373925_0022624 3300037068 Bacteria 4587
306 Ga0373925_0033185 3300037068 Bacteria 3805
307 Ga0373925_0176149 3300037068 Bacteria 1690
308 Ga0373925_0254570 3300037068 Bacteria 1409
309 Ga0373925_0579677 3300037068 Unclassified 923
310 Ga0395900_0019643 3300037418 Bacteria 6889
311 Ga0395898_0027805 3300037466 Bacteria 5671
312 Ga0395898_1230989 3300037466 Bacteria 679
313 Ga0395905_0012767 3300037471 Bacteria 8079
314 Ga0395905_0698934 3300037471 Bacteria 916
315 Ga0436364_0457007 3300037853 Bacteria 2273
316 Ga0436364_0884684 3300037853 Unclassified 3902
317 Ga0436364_0892395 3300037853 Bacteria 14112
318 Ga0436364_1022767 3300037853 Bacteria 2728
319 Ga0436364_1304001 3300037853 Bacteria 1402
320 Ga0395901_0225133 3300038443 Bacteria 1959
321 Ga0436365_0491762 3300039437 Bacteria 2953
322 Ga0436365_0656636 3300039437 Bacteria 1109
323 Ga0436360_1002537 3300039438 Bacteria 5878
324 Ga0436360_1008693 3300039438 Bacteria 4001
325 Ga0436361_0458016 3300039447 Unclassified 1441
326 Ga0436361_1138492 3300039447 Bacteria 868
327 Ga0436361_1175342 3300039447 Bacteria 622
328 Ga0436363_0594316 3300039450 Bacteria 661
329 Ga0436363_0651146 3300039450 Bacteria 1464
330 Ga0436363_1652652 3300039450 Unclassified 1070
331 Ga0436362_0156731 3300039453 Bacteria 1291
332 Ga0436362_0592899 3300039453 Unclassified 1155
333 Ga0436362_1161106 3300039453 Bacteria 1478
334 Ga0451793_0430518 3300041452 Bacteria 1920
335 Ga0451797_0372802 3300041453 Bacteria 1378
336 Ga0451795_0702556 3300041456 Bacteria 2606
337 Ga0451800_0925057 3300041459 Bacteria 1854
338 Ga0451802_1611071 3300041460 Bacteria 1887
339 Ga0451807_1267673 3300041486 Bacteria 1263
340 Ga0451847_0766722 3300041503 Bacteria 1021
341 Ga0450923_041557 3300042125 Bacteria 968
342 Ga0466963_0393414 3300044694 Bacteria 977
343 Ga0453684_0156847 3300044712 Bacteria 2697
344 Ga0451576_0536622 3300045051 Bacteria 1229
345 Ga0451576_0813709 3300045051 Bacteria 981
346 Ga0466967_0032202 3300045976 Bacteria 4424
347 Ga0495592_0333230 3300046454 Bacteria 977
348 Ga0495638_0056088 3300046460 Bacteria 2445
349 Ga0495651_0063858 3300046462 Bacteria 2814
350 Ga0495651_0293755 3300046462 Bacteria 1093
351 Ga0495653_0176136 3300046463 Bacteria 1472
352 Ga0495653_0277617 3300046463 Bacteria 1101
353 Ga0495662_0030927 3300046476 Bacteria 2585
354 Ga0495664_0001103 3300046477 Bacteria 13985
355 Ga0495608_0031462 3300046511 Bacteria 3588
356 Ga0495608_0061977 3300046511 Bacteria 2458
357 Ga0495608_0401188 3300046511 Bacteria 839
358 Ga0495610_0060873 3300046512 Bacteria 1796
359 Ga0495618_0200136 3300046514 Bacteria 1264
360 Ga0495628_0083890 3300046516 Bacteria 2473
361 Ga0495628_0512943 3300046516 Bacteria 864
362 Ga0495630_0174017 3300046517 Bacteria 1641
363 Ga0495630_0861071 3300046517 Unclassified 691
364 Ga0495632_0007707 3300046519 Bacteria 6724
365 Ga0495644_0031119 3300046523 Bacteria 2016
366 Ga0495666_0123628 3300046526 Bacteria 1211
367 Ga0495652_0059778 3300046529 Bacteria 3224
368 Ga0495652_0179198 3300046529 Bacteria 1628
369 Ga0495640_0064779 3300046533 Bacteria 2470
370 Ga0495640_0086876 3300046533 Bacteria 2070
371 Ga0495640_0443176 3300046533 Unclassified 794
372 Ga0495645_0000981 3300046543 Bacteria 19453
373 Ga0495667_0040729 3300046559 Bacteria 3083
374 Ga0495667_0190971 3300046559 Bacteria 1312
375 Ga0495667_0313245 3300046559 Bacteria 993
376 Ga0495668_0048689 3300046616 Bacteria 2351
377 Ga0495634_0571460 3300046642 Unclassified 658
378 Ga0495635_0040598 3300046663 Bacteria 3216
379 Ga0495635_0074601 3300046663 Bacteria 2324
380 Ga0495635_0653150 3300046663 Bacteria 684
381 Ga0495657_0104293 3300046675 Bacteria 1803
382 Ga0495599_0022295 3300046678 Bacteria 3953
383 Ga0495599_0031894 3300046678 Bacteria 3307
384 Ga0495623_0048921 3300046679 Bacteria 2680
385 Ga0495613_0048855 3300046689 Bacteria 3123
386 Ga0495671_0000577 3300046692 Bacteria 27383
387 Ga0495600_0068081 3300046809 Bacteria 2327
388 Ga0495604_0241085 3300047317 Bacteria 1236
389 Ga0495604_0291119 3300047317 Bacteria 1100
390 Ga0495674_0066456 3300047319 Bacteria 3128
391 Ga0495680_0022707 3300047322 Bacteria 5227
392 Ga0495675_0007005 3300047444 Bacteria 6934
393 Ga0495675_0077983 3300047444 Bacteria 2087
394 Ga0495673_0000019 3300047469 Bacteria 554389
395 Ga0495684_0030984 3300047471 Bacteria 4106
396 Ga0495684_0258590 3300047471 Bacteria 1264
397 Ga0495684_0589155 3300047471 Bacteria 752
398 Ga0495593_0152238 3300047673 Bacteria 1170
399 Ga0495602_0012924 3300048088 Bacteria 8551
400 Ga0495602_0195902 3300048088 Bacteria 1545
401 Ga0496100_0106507 3300048903 Bacteria 1941
402 Ga0496101_0097826 3300048904 Bacteria 2192
403 Ga0496101_0131758 3300048904 Bacteria 1899
404 Ga0496101_0643585 3300048904 Bacteria 838
405 Ga0496102_0006757 3300048905 Bacteria 9794
406 Ga0496102_0042273 3300048905 Bacteria 4130
407 Ga0496102_0091933 3300048905 Bacteria 2809
408 Ga0496103_0024003 3300048906 Bacteria 3679
409 Ga0496103_0024114 3300048906 Bacteria 3669
410 Ga0496104_0350868 3300048907 Bacteria 1388
411 Ga0496104_0582772 3300048907 Bacteria 1029
412 Ga0496104_0590355 3300048907 Bacteria 1021
413 Ga0496105_0298695 3300048908 Bacteria 1295
414 Ga0496106_0110783 3300048909 Bacteria 2137
415 Ga0496106_0175284 3300048909 Bacteria 1701
416 Ga0496106_0357859 3300048909 Bacteria 1172
417 Ga0496107_0006697 3300048910 Bacteria 7933
418 Ga0496108_0470057 3300048911 Bacteria 1099
419 Ga0496108_0567710 3300048911 Bacteria 989
420 Ga0496108_0820502 3300048911 Bacteria 802
421 Ga0496109_0221284 3300048912 Bacteria 1780
422 Ga0496110_0189182 3300048913 Bacteria 1869
423 Ga0496110_0284090 3300048913 Bacteria 1507
424 Ga0496110_0432373 3300048913 Bacteria 1200
425 Ga0496111_0270390 3300048914 Bacteria 1261
426 Ga0496112_0168731 3300048915 Bacteria 2154
427 Ga0496112_0205255 3300048915 Bacteria 1929
428 Ga0496112_0716491 3300048915 Unclassified 928
429 Ga0496113_0087670 3300048916 Bacteria 2393
430 Ga0496113_0227752 3300048916 Bacteria 1486
431 Ga0496113_0335446 3300048916 Bacteria 1213
432 Ga0496116_0006102 3300048919 Bacteria 11021
433 Ga0496119_0217078 3300048922 Bacteria 981
434 Ga0496122_0001988 3300048925 Bacteria 30507
435 Ga0496122_0145955 3300048925 Bacteria 1470
436 Ga0496124_0000857 3300048927 Bacteria 49660
437 Ga0496124_0725266 3300048927 Bacteria 627
438 Ga0496125_0000986 3300048928 Bacteria 44353
439 Ga0496125_0002760 3300048928 Bacteria 22221
440 Ga0496125_0058897 3300048928 Bacteria 3099
441 Ga0496125_0212987 3300048928 Bacteria 1253
442 Ga0496126_0198630 3300048929 Bacteria 1695
443 Ga0501033_0022898 3300049570 Bacteria 4710
444 Ga0501033_0078057 3300049570 Bacteria 2430
445 Ga0501033_0198784 3300049570 Bacteria 1432
446 Ga0501033_0349803 3300049570 Bacteria 1035
447 Ga0501034_0503855 3300049571 Bacteria 1124
448 Ga0501036_0025747 3300049572 Bacteria 4965
449 Ga0501037_0287692 3300049573 Bacteria 1144
450 Ga0501037_0438330 3300049573 Bacteria 892
451 Ga0501037_0610185 3300049573 Bacteria 732
452 Ga0501037_0657965 3300049573 Bacteria 700
453 Ga0501038_0062526 3300049574 Bacteria 3181
454 Ga0501038_0066963 3300049574 Bacteria 3057
455 Ga0501043_0039285 3300049579 Bacteria 3719
456 Ga0501046_0020342 3300049580 Bacteria 5492
457 Ga0501046_0103814 3300049580 Bacteria 2178
458 Ga0501047_0042916 3300049581 Bacteria 4369
459 Ga0501047_0086454 3300049581 Bacteria 3013
460 Ga0501047_0105836 3300049581 Bacteria 2693
461 Ga0501048_0000067 3300049582 Bacteria 53194
462 Ga0501070_0756595 3300049586 Bacteria 765
463 Ga0501073_0470399 3300049589 Unclassified 869
464 Ga0501080_0248814 3300049742 Bacteria 1621
465 Ga0501080_0263992 3300049742 Bacteria 1568
466 Ga0501035_0037577 3300049822 Bacteria 4384
467 Ga0501035_0041654 3300049822 Bacteria 4146
468 Ga0501035_0629477 3300049822 Unclassified 872
469 Ga0501035_0938038 3300049822 Unclassified 683
470 Ga0501044_0044046 3300049823 Bacteria 4634
471 Ga0501044_0100174 3300049823 Bacteria 2916
472 Ga0501044_0314008 3300049823 Bacteria 1493
473 Ga0501044_1064620 3300049823 Bacteria 679
474 nmdc:mga03683_4425_c1 3300050489 Bacteria 4660
475 nmdc:mga0yw44_485775_c1 3300050492 Bacteria 838
476 nmdc:mga0k408_369575_c1 3300050493 Bacteria 855
477 nmdc:mga06z11_342885_c1 3300050494 Bacteria 893
478 nmdc:mga07m45_25079_c1 3300050496 Bacteria 3269
479 nmdc:mga05p37_843093_c1 3300050507 Bacteria 996
480 nmdc:mga08y16_700480_c1 3300050511 Bacteria 1013
481 nmdc:mga0n895_108998_c1 3300050512 Bacteria 2784
482 nmdc:mga0n895_267723_c1 3300050512 Bacteria 1733
483 nmdc:mga0n895_872791_c1 3300050512 Bacteria 886
484 nmdc:mga0rr50_1354583_c1 3300050513 Bacteria 603
485 nmdc:mga08x19_27892_c1 3300050514 Bacteria 3533
486 nmdc:mga0a205_288685_c1 3300050515 Bacteria 1515
487 nmdc:mga0a205_524749_c1 3300050515 Bacteria 1040
488 Ga0495601_0005551 3300053077 Bacteria 7355
489 Ga0495612_0010836 3300053078 Bacteria 3682
490 Ga0495595_0017648 3300053084 Bacteria 3072
491 Ga0495619_0025872 3300053085 Bacteria 3772
492 Ga0495619_0120015 3300053085 Bacteria 1802
493 Ga0500578_0000006 3300053086 Bacteria 234598
494 Ga0500644_0011827 3300053088 Bacteria 2396
495 Ga0500646_0034657 3300053090 Bacteria 1400
496 Ga0500583_0303892 3300053092 Bacteria 780
497 Ga0500651_0041543 3300053093 Bacteria 2898
498 Ga0500651_0232389 3300053093 Bacteria 1078
499 Ga0500650_0041114 3300053098 Bacteria 2134
500 Ga0500556_0000014 3300053104 Bacteria 232989
501 Ga0500562_093437 3300053108 Bacteria 817
502 Ga0500621_000002 3300053126 Bacteria 849473
503 Ga0500628_017949 3300053129 Bacteria 1388
504 Ga0500628_164265 3300053129 Bacteria 627
505 Ga0500642_0148118 3300053130 Bacteria 1101
506 Ga0500652_001508 3300053131 Bacteria 7149
507 Ga0500652_147298 3300053131 Bacteria 978
508 Ga0500655_010123 3300053133 Bacteria 1701
509 Ga0500658_0150621 3300053134 Bacteria 1048
510 Ga0500561_0039133 3300053137 Bacteria 1243
511 Ga0500568_0001037 3300053139 Bacteria 18989
512 Ga0500568_0002272 3300053139 Bacteria 11449
513 Ga0500568_0076023 3300053139 Bacteria 1279
514 Ga0500579_136861 3300053143 Bacteria 1122
515 Ga0500604_0020304 3300053151 Bacteria 1868
516 Ga0500604_0112573 3300053151 Bacteria 904
517 Ga0500604_0129935 3300053151 Bacteria 846
518 Ga0500616_0017418 3300053153 Bacteria 4075
519 Ga0500616_0077889 3300053153 Bacteria 1673
520 Ga0500622_0002520 3300053156 Bacteria 13153
521 Ga0500627_0005107 3300053158 Bacteria 4313
522 Ga0500627_0082466 3300053158 Bacteria 1435
523 Ga0500634_0000009 3300053161 Bacteria 144333
524 Ga0500570_102163 3300053724 Bacteria 1200
525 Ga0501084_0823021 3300054114 Bacteria 782
526 Ga0587076_030260 3300059645 Bacteria 955
527 2509118142 2508501123 Bacteria 6283661
528 2512037629 2511231221 Bacteria 6846400
529 2512929565 2512875016 Bacteria 6529530
530 2513585784 2513237086 Bacteria 7265287
531 2513886390 2513237140 Bacteria 7076289
532 2513906926 2513237143 Bacteria 6664116
533 2514033868 2513237164 Bacteria 7563725
534 2551680851 2551306084 Bacteria 8942552
535 2551684735 2551306085 Bacteria 7347181
536 2551698831 2551306087 Bacteria 7351905
537 2551718430 2551306090 Bacteria 7953713
538 2551739362 2551306093 Bacteria 7064773
539 2585168644 2582581283 Bacteria 6030556
540 2587725088 2585428057 Bacteria 6737412
541 2587731551 2585428058 Bacteria 6853932
542 2588295197 2588253510 Bacteria 6901809
543 2599938725 2599185301 Bacteria 6161860
544 2643967023 2643221592 Bacteria 6608788
545 2644142608 2643221625 Bacteria 6512927
546 2644152271 2643221627 Bacteria 6761570
547 2644271129 2643221648 Bacteria 6521465
548 2644485131 2643221686 Bacteria 6310811
549 2753357642 2751185800 Bacteria 5467370
550 2756673067 2756170246 Bacteria 7451806
551 2765465094 2765235802 Bacteria 5618596
552 2792753163 2791355123 Bacteria 8049106
553 2839993566 2839993093 Bacteria 5512535
554 2840764459 2840764183 Bacteria 6358399
555 2842333866 2842333319 Bacteria 8899485
556 2848864975 2848858292 Bacteria 7391279
557 2854914463 2854911287 Bacteria 5582813
558 2855829181 2855825444 Bacteria 6785811
559 2855844275 2855839649 Bacteria 7135830
560 2856326677 2856320880 Bacteria 7263508
561 2858806338 2858800743 Bacteria 6603254
562 2869168738 2869162929 Bacteria 6399702
563 2869280205 2869278585 Bacteria 7077053
564 2871492831 2871488783 Bacteria 6929816
565 2874144317 2874139085 Bacteria 7021506
566 2876366875 2876363079 Bacteria 6544991
567 2878744308 2878738818 Bacteria 7136951
568 2878756763 2878753008 Bacteria 6922523
569 2881851587 2881845957 Bacteria 6611900
570 2881868841 2881861095 Bacteria 7128710
571 2882462484 2882456835 Bacteria 6863978
572 2882919277 2882912400 Bacteria 6801539
573 2885320697 2885318864 Bacteria 6729568
574 2885329258 2885326080 Bacteria 7134805
575 2888341750 2888337043 Bacteria 6629336
576 2894653176 2894652903 Bacteria 4587256
577 2897804840 2897803580 Bacteria 7000062
578 2903453660 2903448605 Bacteria 7357801
579 2903496437 2903492973 Bacteria 13473544
580 2903524742 2903521522 Bacteria 6525694
581 2903531015 2903528002 Bacteria 6586099
582 2915991233 2915986958 Bacteria 6739310
583 2916014298 2916007675 Bacteria 6898660
584 2916034614 2916028427 Bacteria 6748433
585 2916061113 2916055098 Bacteria 6758838
586 2916069428 2916068649 Bacteria 6943657
587 2921214448 2921208531 Bacteria 6745326
588 2921269189 2921263974 Bacteria 6864552
589 2921295272 2921289301 Bacteria 7316391
590 2924154862 2924150972 Bacteria 7169444
591 2924162336 2924158325 Bacteria 7188855
592 2924179534 2924172951 Bacteria 6749356
593 2924193418 2924186466 Bacteria 6876637
594 2924199305 2924193448 Bacteria 6955718
595 2924212661 2924207177 Bacteria 6917007
596 2924216603 2924214083 Bacteria 7080103
597 2924234186 2924228884 Bacteria 6633132
598 2924719300 2924718760 Bacteria 6331356
599 2924782226 2924776078 Bacteria 7492003
600 2924788353 2924784321 Bacteria 7416538
601 2928525087 2928521798 Bacteria 4960112
602 2937044252 2937042894 Bacteria 6741576
603 2937054962 2937049772 Bacteria 6757901
604 2937068875 2937063883 Bacteria 7199456
605 2937076626 2937071275 Bacteria 6984483
606 2937103318 2937098957 Bacteria 7249374
607 2937118076 2937113482 Bacteria 6505872
608 2937123421 2937119839 Bacteria 6597547
609 2937131220 2937126314 Bacteria 6771275
610 2937850610 2937848649 Bacteria 6983481
611 2937877647 2937877337 Bacteria 7246526
612 2937977718 2937972304 Bacteria 7532020
613 2957391280 2957388812 Bacteria 6778072
614 2957413840 2957408893 Bacteria 6558585
615 2957424713 2957422303 Bacteria 7172205
616 2957447933 2957443900 Bacteria 6869977
617 2957457441 2957450854 Bacteria 6765715
618 2957475517 2957471148 Bacteria 6797643
619 2957482261 2957478035 Bacteria 6756658
620 2957490713 2957484790 Bacteria 6703082
621 2957496801 2957491536 Bacteria 6695180
622 2957504320 2957498199 Bacteria 7126688
623 2957512343 2957505466 Bacteria 7253085
624 2958036076 2958034702 Bacteria 6989922
625 2958047500 2958041894 Bacteria 13082850
626 2958066169 2958064165 Bacteria 7158582
627 2958084754 2958084443 Bacteria 7312792
628 2958093892 2958092219 Bacteria 6861151
629 2958151143 2958144490 Bacteria 6677056
630 2960601768 2960597568 Bacteria 6550735
631 2960624124 2960617483 Bacteria 6727748
632 2960643606 2960637947 Bacteria 7296468
633 2960648999 2960645483 Bacteria 7211087
634 2960659576 2960652885 Bacteria 7083688
635 2960664955 2960660292 Bacteria 7041660
636 2960679283 2960674078 Bacteria 6609048
637 2961173053 2961170736 Bacteria 7072258
638 2963649668 2963644680 Bacteria 6530403
639 2964631647 2964628898 Bacteria 7083044
640 2964641934 2964636051 Bacteria 7091832
641 2964654291 2964649959 Bacteria 6675118
642 2964669972 2964663802 Bacteria 7019362
643 2964682136 2964678106 Bacteria 6792020
644 2964702497 2964698721 Bacteria 6765331
645 2964709666 2964705432 Bacteria 7114648
646 2964718523 2964712639 Bacteria 6695970
647 2964724954 2964719344 Bacteria 7286602
648 2967685997 2967678726 Bacteria 7264382
649 2967726424 2967721400 Bacteria 7073753
650 2967752797 2967748971 Bacteria 6733771
651 2967769017 2967762386 Bacteria 6923502
652 2967782784 2967775926 Bacteria 6738189
653 2967998264 2967996073 Bacteria 6787468
654 2968006310 2968003550 Bacteria 6929263
655 2968022288 2968016561 Bacteria 7022047
656 2968087024 2968083720 Bacteria 7351627
657 2970023811 2970019648 Bacteria 7072033
658 2970038500 2970033650 Bacteria 7118744
659 2970046441 2970040964 Bacteria 6731123
660 2970050836 2970047711 Bacteria 7088379
661 2970056991 2970054988 Bacteria 6611507
662 2970062102 2970061556 Bacteria 7099761
663 2970073473 2970068827 Bacteria 7123112
664 2970078854 2970076120 Bacteria 6697332
665 2970087222 2970082768 Bacteria 6183754
666 2970114529 2970109326 Bacteria 6863976
667 2970121089 2970116247 Bacteria 6501857
668 2970155044 2970149975 Bacteria 6779706
669 2970161144 2970156795 Bacteria 7168044
670 2970168687 2970164137 Bacteria 6861252
671 2970193778 2970191845 Bacteria 7032787
672 2970474877 2970469710 Bacteria 6969209
673 2970505647 2970503327 Bacteria 7099517
674 2970594805 2970593180 Bacteria 7073582
675 2977556496 2977551784 Bacteria 7125765
676 2977576426 2977572785 Bacteria 6763888
677 2977584900 2977579622 Bacteria 6772100
678 2977825943 2977821940 Bacteria 6906439
679 2977837138 2977828996 Bacteria 7007971
680 2977927701 2977922695 Bacteria 6956781
681 2979810368 2979808191 Bacteria 7179355
682 2996354288 2996348954 Bacteria 7239054
683 3004280956 3004275668 Bacteria 7114440
684 8004378351 8004374579 Bacteria 6898112
685 8054002259 8054002106 Bacteria 7987183
686 8057734779 8057733483 Bacteria 6578323
687 Ga0099795_10018783
688 JGI25406J46586_10005313
689 JGI25406J46586_10006357
690 JGI25153J46596_10008957
691 rootH1_10193276
692 Ga0006562J51391_1012741
693 JGI25404J52841_10000732
694 Ga0055534_1011924
695 Ga0055530_10016351
696 Ga0065165_1005965
697 Ga0065704_10076914
698 Ga0065704_10101107
699 Ga0065704_10136505
700 Ga0065715_10091015
701 Ga0065715_10315726
702 Ga0070683_100006765
703 Ga0070683_100061609
704 Ga0070683_100386486
705 Ga0070683_100843070
706 Ga0070690_100186718
707 Ga0070670_100368967
708 Ga0070670_100369575
709 Ga0068869_100120993
710 Ga0070680_100048548
711 Ga0070691_10286917
712 Ga0070661_100153920
713 Ga0070661_100463970
714 Ga0070692_10184748
715 Ga0070675_100543215
716 Ga0070671_100011087
717 Ga0070671_100197849
718 Ga0070673_100221363
719 Ga0070659_100007022
720 Ga0070709_10063261
721 Ga0070709_10382574
722 Ga0070714_100489051
723 Ga0070714_100873765
724 Ga0070713_100052387
725 Ga0070713_100126300
726 Ga0070713_100134652
727 Ga0070710_10233544
728 Ga0070711_100049233
729 Ga0070711_100856462
730 Ga0070705_100209995
731 Ga0070694_100394994
732 Ga0070663_100002386
733 Ga0070678_100526863
734 Ga0070662_100671402
735 Ga0070662_100682097
736 Ga0070681_10036557
737 Ga0068867_100756670
738 Ga0070679_100098272
739 Ga0070684_100092934
740 Ga0070684_100927100
741 Ga0070697_100032202
742 Ga0068853_100017732
743 Ga0068853_100390372
744 Ga0070695_100016622
745 Ga0070696_100018567
746 Ga0070693_100034290
747 Ga0070693_100066894
748 Ga0070704_100030920
749 Ga0070704_100813283
750 Ga0070704_100818062
751 Ga0068855_100001082
752 Ga0068855_100131098
753 Ga0070664_100033514
754 Ga0070664_100144222
755 Ga0070664_100183938
756 Ga0070664_100309711
757 Ga0068857_100045275
758 Ga0068854_100115058
759 Ga0068856_100148978
760 Ga0068856_100225382
761 Ga0068856_100259474
762 Ga0070702_100008145
763 Ga0068852_100673075
764 Ga0068852_101100904
765 Ga0068859_101247728
766 Ga0068859_101705811
767 Ga0068859_101836109
768 Ga0068866_10731880
769 Ga0068851_10237985
770 Ga0068870_10397394
771 Ga0068863_100329130
772 Ga0068858_100265126
773 Ga0068858_100652904
774 Ga0068860_100008948
775 Ga0068860_100461524
776 Ga0081540_1000026
777 Ga0081539_10001608
778 Ga0070717_10305361
779 Ga0070717_10459301
780 Ga0070717_10673044
781 Ga0075365_10054070
782 Ga0075363_100109704
783 Ga0075363_100192348
784 Ga0075364_10035753
785 Ga0070716_100000145
786 Ga0070712_100076890
787 Ga0070712_100226687
788 Ga0075362_10003498
789 Ga0075366_10292905
790 Ga0075370_10026388
791 Ga0068871_100228823
792 Ga0068871_100522503
793 Ga0075430_100814067
794 Ga0075433_10176851
795 Ga0075434_100237142
796 Ga0075436_100057009
797 Ga0097620_101705584
798 Ga0097620_101836257
799 Ga0075435_100805974
800 Ga0099795_10032603
801 Ga0105240_10011621
802 Ga0105240_10592525
803 Ga0111539_10845855
804 Ga0111539_10922984
805 Ga0105245_10041075
806 Ga0105245_10118925
807 Ga0105245_10628042
808 Ga0105247_10087581
809 Ga0105247_10229396
810 Ga0105243_10741810
811 Ga0105241_10006012
812 Ga0105241_10047303
813 Ga0105241_10107351
814 Ga0105241_10161736
815 Ga0105248_10003346
816 Ga0105248_10342881
817 Ga0105248_11679242
818 Ga0105237_10001961
819 Ga0105237_10075352
820 Ga0105237_10599005
821 Ga0105238_10014352
822 Ga0105238_10114493
823 Ga0105249_10965492
824 Ga0105249_11104873
825 Ga0099796_10002309
826 Ga0105239_10338960
827 Ga0105239_10508268
828 Ga0105246_10042568
829 Ga0105246_10993082
830 Ga0157369_10324579
831 Ga0157374_10163835
832 Ga0157374_10446882
833 Ga0157378_10000137
834 Ga0157378_10456827
835 Ga0157378_10972849
836 Ga0157378_11043561
837 Ga0163162_10011396
838 Ga0163162_10370500
839 Ga0157372_10686948
840 Ga0157375_10624183
841 Ga0163163_10279533
842 Ga0163163_10387748
843 Ga0163163_10610186
844 Ga0163163_11698572
845 Ga0157380_10466905
846 Ga0157377_10249301
847 Ga0157377_10515330
848 Ga0157379_10020881
849 Ga0157379_10090787
850 Ga0157376_10272847
851 Ga0163161_10522730
852 Ga0163161_10546572
853 Ga0213875_10013483
854 Ga0213875_10035642
855 Ga0213875_10144699
856 Ga0256744_143749
857 Ga0207425_1028882
858 Ga0209673_1007558
859 Ga0209675_1000076
860 Ga0209676_1002852
861 Ga0209758_1000193
862 Ga0209050_1000198
863 Ga0207692_10201961
864 Ga0207642_10675642
865 Ga0207688_10038915
866 Ga0207647_10008863
867 Ga0207699_10257888
868 Ga0207654_10439417
869 Ga0207707_10080318
870 Ga0207707_10200437
871 Ga0207695_10013078
872 Ga0207695_10112342
873 Ga0207671_10005144
874 Ga0207693_10007459
875 Ga0207693_10290966
876 Ga0207693_10304631
877 Ga0207663_10154904
878 Ga0207660_10034563
879 Ga0207657_10211771
880 Ga0207649_10068638
881 Ga0207652_10095931
882 Ga0207652_10122250
883 Ga0207694_10088439
884 Ga0207650_10292624
885 Ga0207687_10207552
886 Ga0207687_10532026
887 Ga0207700_10004238
888 Ga0207700_10130141
889 Ga0207700_10473728
890 Ga0207664_10193930
891 Ga0207664_10473777
892 Ga0207644_10042302
893 Ga0207644_10342309
894 Ga0207690_10982089
895 Ga0207706_10676467
896 Ga0207665_10000015
897 Ga0207711_10008218
898 Ga0207711_11113050
899 Ga0207689_10083762
900 Ga0207661_10018071
901 Ga0207661_10326819
902 Ga0207661_10502474
903 Ga0207679_10499057
904 Ga0207667_10005618
905 Ga0207667_10131669
906 Ga0207651_10331208
907 Ga0207651_10765134
908 Ga0207640_10246025
909 Ga0207658_10307000
910 Ga0207703_10168856
911 Ga0207703_10922849
912 Ga0207639_10066736
913 Ga0207639_10285306
914 Ga0207678_10001728
915 Ga0207708_10124155
916 Ga0207702_10100613
917 Ga0207702_10536175
918 Ga0207702_10896451
919 Ga0207648_10484531
920 Ga0207676_11284800
921 Ga0207674_10038241
922 Ga0207674_10730497
923 Ga0207683_10257710
924 Ga0207698_10285821
925 Ga0207698_10583884
926 Ga0207698_11080406
927 Ga0207428_10369657
928 Ga0268264_10006281
929 Ga0268264_10435573
930 Ga0265325_10000883
931 Ga0265340_10000021
932 Ga0265340_10007700
933 Ga0265339_10008470
934 Ga0265331_10005821
935 Ga0265316_10011221
936 Ga0307513_10121789
937 Ga0307513_10252117
938 Ga0307509_10468070
939 Ga0316576_10059742
940 Ga0307413_10224420
941 Ga0307406_10478602
942 Ga0307409_100021901
943 Ga0307409_100673953
944 Ga0307409_100898414
945 Ga0307409_101265458
946 Ga0307409_101444102
947 Ga0307416_100857444
948 Ga0307414_10328306
949 Ga0307414_10372659
950 Ga0307411_10393337
951 Ga0373926_0032688
952 Ga0373926_0069335
953 Ga0373929_0074793
954 Ga0373934_0059108
955 Ga0373944_0013984
956 Ga0373944_0029953
957 Ga0373923_0015422
958 Ga0373923_0025454
959 Ga0373923_0103258
960 Ga0373932_0182951
961 Ga0373936_0024301
962 Ga0373945_0105818
963 Ga0373945_0327702
964 Ga0373954_0120505
965 Ga0373956_0030002
966 Ga0373946_0039897
967 Ga0373946_0107435
968 Ga0373955_0052696
969 Ga0373955_0073000
970 Ga0373955_0414661
971 Ga0373924_0008228
972 Ga0373924_0042870
973 Ga0373935_0094130
974 Ga0373935_0109598
975 Ga0373935_0219362
976 Ga0373935_0386289
977 Ga0373927_0091361
978 Ga0373927_0211307
979 Ga0373933_0065780
980 Ga0373933_0092148
981 Ga0373947_0095121
982 Ga0373947_0161484
983 Ga0373947_0163330
984 Ga0373947_0432533
985 Ga0373937_0014570
986 Ga0373937_0016581
987 Ga0373937_0016833
988 Ga0373937_0054264
989 Ga0373937_0230314
990 Ga0373937_1094874
991 Ga0373925_0022624
992 Ga0373925_0033185
993 Ga0373925_0176149
994 Ga0373925_0254570
995 Ga0373925_0579677
996 Ga0395900_0019643
997 Ga0395898_0027805
998 Ga0395898_1230989
999 Ga0395905_0012767
1000 Ga0395905_0698934
1001 Ga0436364_0457007
1002 Ga0436364_0884684
1003 Ga0436364_0892395
1004 Ga0436364_1022767
1005 Ga0436364_1304001
1006 Ga0395901_0225133
1007 Ga0436365_0491762
1008 Ga0436365_0656636
1009 Ga0436360_1002537
1010 Ga0436360_1008693
1011 Ga0436361_0458016
1012 Ga0436361_1138492
1013 Ga0436361_1175342
1014 Ga0436363_0594316
1015 Ga0436363_0651146
1016 Ga0436363_1652652
1017 Ga0436362_0156731
1018 Ga0436362_0592899
1019 Ga0436362_1161106
1020 Ga0451793_0430518
1021 Ga0451797_0372802
1022 Ga0451795_0702556
1023 Ga0451800_0925057
1024 Ga0451802_1611071
1025 Ga0451807_1267673
1026 Ga0451847_0766722
1027 Ga0450923_041557
1028 Ga0466963_0393414
1029 Ga0453684_0156847
1030 Ga0451576_0536622
1031 Ga0451576_0813709
1032 Ga0466967_0032202
1033 Ga0495592_0333230
1034 Ga0495638_0056088
1035 Ga0495651_0063858
1036 Ga0495651_0293755
1037 Ga0495653_0176136
1038 Ga0495653_0277617
1039 Ga0495662_0030927
1040 Ga0495664_0001103
1041 Ga0495608_0031462
1042 Ga0495608_0061977
1043 Ga0495608_0401188
1044 Ga0495610_0060873
1045 Ga0495618_0200136
1046 Ga0495628_0083890
1047 Ga0495628_0512943
1048 Ga0495630_0174017
1049 Ga0495630_0861071
1050 Ga0495632_0007707
1051 Ga0495644_0031119
1052 Ga0495666_0123628
1053 Ga0495652_0059778
1054 Ga0495652_0179198
1055 Ga0495640_0064779
1056 Ga0495640_0086876
1057 Ga0495640_0443176
1058 Ga0495645_0000981
1059 Ga0495667_0040729
1060 Ga0495667_0190971
1061 Ga0495667_0313245
1062 Ga0495668_0048689
1063 Ga0495634_0571460
1064 Ga0495635_0040598
1065 Ga0495635_0074601
1066 Ga0495635_0653150
1067 Ga0495657_0104293
1068 Ga0495599_0022295
1069 Ga0495599_0031894
1070 Ga0495623_0048921
1071 Ga0495613_0048855
1072 Ga0495671_0000577
1073 Ga0495600_0068081
1074 Ga0495604_0241085
1075 Ga0495604_0291119
1076 Ga0495674_0066456
1077 Ga0495680_0022707
1078 Ga0495675_0007005
1079 Ga0495675_0077983
1080 Ga0495673_0000019
1081 Ga0495684_0030984
1082 Ga0495684_0258590
1083 Ga0495684_0589155
1084 Ga0495593_0152238
1085 Ga0495602_0012924
1086 Ga0495602_0195902
1087 Ga0496100_0106507
1088 Ga0496101_0097826
1089 Ga0496101_0131758
1090 Ga0496101_0643585
1091 Ga0496102_0006757
1092 Ga0496102_0042273
1093 Ga0496102_0091933
1094 Ga0496103_0024003
1095 Ga0496103_0024114
1096 Ga0496104_0350868
1097 Ga0496104_0582772
1098 Ga0496104_0590355
1099 Ga0496105_0298695
1100 Ga0496106_0110783
1101 Ga0496106_0175284
1102 Ga0496106_0357859
1103 Ga0496107_0006697
1104 Ga0496108_0470057
1105 Ga0496108_0567710
1106 Ga0496108_0820502
1107 Ga0496109_0221284
1108 Ga0496110_0189182
1109 Ga0496110_0284090
1110 Ga0496110_0432373
1111 Ga0496111_0270390
1112 Ga0496112_0168731
1113 Ga0496112_0205255
1114 Ga0496112_0716491
1115 Ga0496113_0087670
1116 Ga0496113_0227752
1117 Ga0496113_0335446
1118 Ga0496116_0006102
1119 Ga0496119_0217078
1120 Ga0496122_0001988
1121 Ga0496122_0145955
1122 Ga0496124_0000857
1123 Ga0496124_0725266
1124 Ga0496125_0000986
1125 Ga0496125_0002760
1126 Ga0496125_0058897
1127 Ga0496125_0212987
1128 Ga0496126_0198630
1129 Ga0501033_0022898
1130 Ga0501033_0078057
1131 Ga0501033_0198784
1132 Ga0501033_0349803
1133 Ga0501034_0503855
1134 Ga0501036_0025747
1135 Ga0501037_0287692
1136 Ga0501037_0438330
1137 Ga0501037_0610185
1138 Ga0501037_0657965
1139 Ga0501038_0062526
1140 Ga0501038_0066963
1141 Ga0501043_0039285
1142 Ga0501046_0020342
1143 Ga0501046_0103814
1144 Ga0501047_0042916
1145 Ga0501047_0086454
1146 Ga0501047_0105836
1147 Ga0501048_0000067
1148 Ga0501070_0756595
1149 Ga0501073_0470399
1150 Ga0501080_0248814
1151 Ga0501080_0263992
1152 Ga0501035_0037577
1153 Ga0501035_0041654
1154 Ga0501035_0629477
1155 Ga0501035_0938038
1156 Ga0501044_0044046
1157 Ga0501044_0100174
1158 Ga0501044_0314008
1159 Ga0501044_1064620
1160 nmdc:mga03683_4425_c1
1161 nmdc:mga0yw44_485775_c1
1162 nmdc:mga0k408_369575_c1
1163 nmdc:mga06z11_342885_c1
1164 nmdc:mga07m45_25079_c1
1165 nmdc:mga05p37_843093_c1
1166 nmdc:mga08y16_700480_c1
1167 nmdc:mga0n895_108998_c1
1168 nmdc:mga0n895_267723_c1
1169 nmdc:mga0n895_872791_c1
1170 nmdc:mga0rr50_1354583_c1
1171 nmdc:mga08x19_27892_c1
1172 nmdc:mga0a205_288685_c1
1173 nmdc:mga0a205_524749_c1
1174 Ga0495601_0005551
1175 Ga0495612_0010836
1176 Ga0495595_0017648
1177 Ga0495619_0025872
1178 Ga0495619_0120015
1179 Ga0500578_0000006
1180 Ga0500644_0011827
1181 Ga0500646_0034657
1182 Ga0500583_0303892
1183 Ga0500651_0041543
1184 Ga0500651_0232389
1185 Ga0500650_0041114
1186 Ga0500556_0000014
1187 Ga0500562_093437
1188 Ga0500621_000002
1189 Ga0500628_017949
1190 Ga0500628_164265
1191 Ga0500642_0148118
1192 Ga0500652_001508
1193 Ga0500652_147298
1194 Ga0500655_010123
1195 Ga0500658_0150621
1196 Ga0500561_0039133
1197 Ga0500568_0001037
1198 Ga0500568_0002272
1199 Ga0500568_0076023
1200 Ga0500579_136861
1201 Ga0500604_0020304
1202 Ga0500604_0112573
1203 Ga0500604_0129935
1204 Ga0500616_0017418
1205 Ga0500616_0077889
1206 Ga0500622_0002520
1207 Ga0500627_0005107
1208 Ga0500627_0082466
1209 Ga0500634_0000009
1210 Ga0500570_102163
1211 Ga0501084_0823021
1212 Ga0587076_030260
1213 2509118142
1214 2512037629
1215 2512929565
1216 2513585784
1217 2513886390
1218 2513906926
1219 2514033868
1220 2551680851
1221 2551684735
1222 2551698831
1223 2551718430
1224 2551739362
1225 2585168644
1226 2587725088
1227 2587731551
1228 2588295197
1229 2599938725
1230 2643967023
1231 2644142608
1232 2644152271
1233 2644271129
1234 2644485131
1235 2753357642
1236 2756673067
1237 2765465094
1238 2792753163
1239 2839993566
1240 2840764459
1241 2842333866
1242 2848864975
1243 2854914463
1244 2855829181
1245 2855844275
1246 2856326677
1247 2858806338
1248 2869168738
1249 2869280205
1250 2871492831
1251 2874144317
1252 2876366875
1253 2878744308
1254 2878756763
1255 2881851587
1256 2881868841
1257 2882462484
1258 2882919277
1259 2885320697
1260 2885329258
1261 2888341750
1262 2894653176
1263 2897804840
1264 2903453660
1265 2903496437
1266 2903524742
1267 2903531015
1268 2915991233
1269 2916014298
1270 2916034614
1271 2916061113
1272 2916069428
1273 2921214448
1274 2921269189
1275 2921295272
1276 2924154862
1277 2924162336
1278 2924179534
1279 2924193418
1280 2924199305
1281 2924212661
1282 2924216603
1283 2924234186
1284 2924719300
1285 2924782226
1286 2924788353
1287 2928525087
1288 2937044252
1289 2937054962
1290 2937068875
1291 2937076626
1292 2937103318
1293 2937118076
1294 2937123421
1295 2937131220
1296 2937850610
1297 2937877647
1298 2937977718
1299 2957391280
1300 2957413840
1301 2957424713
1302 2957447933
1303 2957457441
1304 2957475517
1305 2957482261
1306 2957490713
1307 2957496801
1308 2957504320
1309 2957512343
1310 2958036076
1311 2958047500
1312 2958066169
1313 2958084754
1314 2958093892
1315 2958151143
1316 2960601768
1317 2960624124
1318 2960643606
1319 2960648999
1320 2960659576
1321 2960664955
1322 2960679283
1323 2961173053
1324 2963649668
1325 2964631647
1326 2964641934
1327 2964654291
1328 2964669972
1329 2964682136
1330 2964702497
1331 2964709666
1332 2964718523
1333 2964724954
1334 2967685997
1335 2967726424
1336 2967752797
1337 2967769017
1338 2967782784
1339 2967998264
1340 2968006310
1341 2968022288
1342 2968087024
1343 2970023811
1344 2970038500
1345 2970046441
1346 2970050836
1347 2970056991
1348 2970062102
1349 2970073473
1350 2970078854
1351 2970087222
1352 2970114529
1353 2970121089
1354 2970155044
1355 2970161144
1356 2970168687
1357 2970193778
1358 2970474877
1359 2970505647
1360 2970594805
1361 2977556496
1362 2977576426
1363 2977584900
1364 2977825943
1365 2977837138
1366 2977927701
1367 2979810368
1368 2996354288
1369 3004280956
1370 8004378351
1371 8054002259
1372 8057734779

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

36

209

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9803 2 175
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9714 2 187
2ixk-assembly1.cif.gz_B rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) 0.9687 2 183
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9606 2 177
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9591 2 183
ID Description Score Start End Superfamily
af_Q17993_17_190_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9548 7 179 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9536 2 175 2.60.120.10
2b9uD00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.953 2 184 2.60.120.10
1epzA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9511 2 178 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9469 1 178 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4R2GVI8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.997 2 184 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2V9KSY8-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9969 2 184 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-Q1QIZ6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9967 2 184 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A7W6IIH0-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9964 2 183 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A562TI62-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9961 11 185 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map