F475174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 686 | 476 | 1372 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10018783|Ga0099795_100187832 |
| Length | 216 |
| Sequence | MIKIAITQPADCKRIEPSMAARCCAFERRRPMQVLATAIPDVKEVKPVRRFDPRGFFSEIFREDLLRQHGIASPFVQENLSLSADRGVVRGLHFQIPPQAQAKLVRVAAGSIFDVAVDIRHGSPTYGHHVGVMLSAAEGNQLYIPEGFAHGFCTLEPNTEVVYKVNRYYSPEHDRGLRWDDSALAIAWPVEEEKALLSDKDRRQPMFAELPRHFDY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 102 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 103 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 155 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 158 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 159 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 160 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 164 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 165 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 166 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 167 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 168 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 169 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 192 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 193 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 194 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 195 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 196 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 202 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 203 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 258 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 259 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 260 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 261 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 262 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 279 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 280 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 281 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 293 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 295 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 296 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 297 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 299 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 300 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 301 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 302 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 303 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 304 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 305 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 307 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 308 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 309 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 310 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 311 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 312 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 314 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 315 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 318 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 319 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 320 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 321 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 322 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 323 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 324 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 325 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 326 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 327 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 328 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 329 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 330 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 331 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 332 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 333 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 334 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 335 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 336 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 337 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 338 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 339 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 340 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 341 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 342 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 343 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 344 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 345 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 346 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 347 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 348 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 349 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 350 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 351 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 352 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 353 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 354 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 355 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 356 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 357 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 358 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 359 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 360 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 361 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 362 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 363 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 364 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 365 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 366 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 367 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 368 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 369 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 370 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 371 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 372 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 373 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 374 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 375 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 376 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 377 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 378 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 379 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 380 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 381 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 382 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 383 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 384 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 385 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 386 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 387 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 388 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 389 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 390 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 391 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 392 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 393 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 394 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 395 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 396 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 397 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 398 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 399 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 400 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 401 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 402 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 403 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 404 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 405 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 406 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 407 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 408 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 409 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 410 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 411 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 412 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 413 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 414 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 415 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 416 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 417 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 418 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 419 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 420 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 421 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 422 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 423 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 424 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 425 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 426 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 427 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 428 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 429 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 430 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 431 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 432 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 433 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 434 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 435 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 436 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 437 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 438 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 439 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 440 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 441 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 442 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 443 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 444 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 445 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 446 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 447 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 448 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 449 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 450 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 451 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 452 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 453 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 454 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 455 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 456 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 457 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 458 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 459 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 460 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 461 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 462 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 463 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 464 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 465 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 466 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 467 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 468 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 469 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 470 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 471 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 472 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 473 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 474 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 475 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 476 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.24 |
| Metatranscriptomes | 0.44 |
| Isolates | 23.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.87 |
| Nodule | 18.95 |
| Rhizoplane | 5.69 |
| Rhizosphere | 60.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099795_10018783 | 3300007788 | Bacteria | 2227 |
| 2 | JGI25406J46586_10005313 | 3300003203 | Bacteria | 5977 |
| 3 | JGI25406J46586_10006357 | 3300003203 | Bacteria | 5449 |
| 4 | JGI25153J46596_10008957 | 3300003215 | Bacteria | 4718 |
| 5 | rootH1_10193276 | 3300003323 | Bacteria | 1996 |
| 6 | Ga0006562J51391_1012741 | 3300003578 | Bacteria | 5060 |
| 7 | JGI25404J52841_10000732 | 3300003659 | Bacteria | 5122 |
| 8 | Ga0055534_1011924 | 3300003784 | Bacteria | 1743 |
| 9 | Ga0055530_10016351 | 3300003791 | Bacteria | 2375 |
| 10 | Ga0065165_1005965 | 3300005262 | Bacteria | 6588 |
| 11 | Ga0065704_10076914 | 3300005289 | Bacteria | 4929 |
| 12 | Ga0065704_10101107 | 3300005289 | Bacteria | 2249 |
| 13 | Ga0065704_10136505 | 3300005289 | Bacteria | 1565 |
| 14 | Ga0065715_10091015 | 3300005293 | Bacteria | 6201 |
| 15 | Ga0065715_10315726 | 3300005293 | Bacteria | 1012 |
| 16 | Ga0070683_100006765 | 3300005329 | Bacteria | 9633 |
| 17 | Ga0070683_100061609 | 3300005329 | Bacteria | 3489 |
| 18 | Ga0070683_100386486 | 3300005329 | Bacteria | 1334 |
| 19 | Ga0070683_100843070 | 3300005329 | Unclassified | 879 |
| 20 | Ga0070690_100186718 | 3300005330 | Bacteria | 1435 |
| 21 | Ga0070670_100368967 | 3300005331 | Bacteria | 1263 |
| 22 | Ga0070670_100369575 | 3300005331 | Bacteria | 1262 |
| 23 | Ga0068869_100120993 | 3300005334 | Bacteria | 2002 |
| 24 | Ga0070680_100048548 | 3300005336 | Bacteria | 3460 |
| 25 | Ga0070691_10286917 | 3300005341 | Bacteria | 895 |
| 26 | Ga0070661_100153920 | 3300005344 | Bacteria | 1739 |
| 27 | Ga0070661_100463970 | 3300005344 | Bacteria | 1009 |
| 28 | Ga0070692_10184748 | 3300005345 | Bacteria | 1211 |
| 29 | Ga0070675_100543215 | 3300005354 | Bacteria | 1050 |
| 30 | Ga0070671_100011087 | 3300005355 | Bacteria | 7237 |
| 31 | Ga0070671_100197849 | 3300005355 | Bacteria | 1704 |
| 32 | Ga0070673_100221363 | 3300005364 | Bacteria | 1638 |
| 33 | Ga0070659_100007022 | 3300005366 | Bacteria | 8156 |
| 34 | Ga0070709_10063261 | 3300005434 | Bacteria | 2362 |
| 35 | Ga0070709_10382574 | 3300005434 | Bacteria | 1046 |
| 36 | Ga0070714_100489051 | 3300005435 | Bacteria | 1172 |
| 37 | Ga0070714_100873765 | 3300005435 | Bacteria | 872 |
| 38 | Ga0070713_100052387 | 3300005436 | Bacteria | 3379 |
| 39 | Ga0070713_100126300 | 3300005436 | Bacteria | 2250 |
| 40 | Ga0070713_100134652 | 3300005436 | Bacteria | 2182 |
| 41 | Ga0070710_10233544 | 3300005437 | Bacteria | 1175 |
| 42 | Ga0070711_100049233 | 3300005439 | Bacteria | 2885 |
| 43 | Ga0070711_100856462 | 3300005439 | Unclassified | 773 |
| 44 | Ga0070705_100209995 | 3300005440 | Bacteria | 1341 |
| 45 | Ga0070694_100394994 | 3300005444 | Bacteria | 1081 |
| 46 | Ga0070663_100002386 | 3300005455 | Bacteria | 10559 |
| 47 | Ga0070678_100526863 | 3300005456 | Bacteria | 1046 |
| 48 | Ga0070662_100671402 | 3300005457 | Bacteria | 875 |
| 49 | Ga0070662_100682097 | 3300005457 | Bacteria | 868 |
| 50 | Ga0070681_10036557 | 3300005458 | Bacteria | 4931 |
| 51 | Ga0068867_100756670 | 3300005459 | Bacteria | 863 |
| 52 | Ga0070679_100098272 | 3300005530 | Bacteria | 2915 |
| 53 | Ga0070684_100092934 | 3300005535 | Bacteria | 2685 |
| 54 | Ga0070684_100927100 | 3300005535 | Bacteria | 816 |
| 55 | Ga0070697_100032202 | 3300005536 | Bacteria | 4218 |
| 56 | Ga0068853_100017732 | 3300005539 | Bacteria | 5876 |
| 57 | Ga0068853_100390372 | 3300005539 | Bacteria | 1301 |
| 58 | Ga0070695_100016622 | 3300005545 | Bacteria | 4457 |
| 59 | Ga0070696_100018567 | 3300005546 | Bacteria | 4702 |
| 60 | Ga0070693_100034290 | 3300005547 | Bacteria | 2808 |
| 61 | Ga0070693_100066894 | 3300005547 | Bacteria | 2104 |
| 62 | Ga0070704_100030920 | 3300005549 | Bacteria | 3594 |
| 63 | Ga0070704_100813283 | 3300005549 | Bacteria | 836 |
| 64 | Ga0070704_100818062 | 3300005549 | Bacteria | 833 |
| 65 | Ga0068855_100001082 | 3300005563 | Bacteria | 33864 |
| 66 | Ga0068855_100131098 | 3300005563 | Bacteria | 2863 |
| 67 | Ga0070664_100033514 | 3300005564 | Bacteria | 4303 |
| 68 | Ga0070664_100144222 | 3300005564 | Bacteria | 2099 |
| 69 | Ga0070664_100183938 | 3300005564 | Bacteria | 1859 |
| 70 | Ga0070664_100309711 | 3300005564 | Unclassified | 1429 |
| 71 | Ga0068857_100045275 | 3300005577 | Bacteria | 3903 |
| 72 | Ga0068854_100115058 | 3300005578 | Bacteria | 2034 |
| 73 | Ga0068856_100148978 | 3300005614 | Bacteria | 2348 |
| 74 | Ga0068856_100225382 | 3300005614 | Bacteria | 1890 |
| 75 | Ga0068856_100259474 | 3300005614 | Bacteria | 1753 |
| 76 | Ga0070702_100008145 | 3300005615 | Bacteria | 5065 |
| 77 | Ga0068852_100673075 | 3300005616 | Bacteria | 1044 |
| 78 | Ga0068852_101100904 | 3300005616 | Unclassified | 815 |
| 79 | Ga0068859_101247728 | 3300005617 | Bacteria | 819 |
| 80 | Ga0068859_101705811 | 3300005617 | Bacteria | 696 |
| 81 | Ga0068859_101836109 | 3300005617 | Bacteria | 669 |
| 82 | Ga0068866_10731880 | 3300005718 | Bacteria | 681 |
| 83 | Ga0068851_10237985 | 3300005834 | Bacteria | 1028 |
| 84 | Ga0068870_10397394 | 3300005840 | Bacteria | 896 |
| 85 | Ga0068863_100329130 | 3300005841 | Bacteria | 1485 |
| 86 | Ga0068858_100265126 | 3300005842 | Bacteria | 1634 |
| 87 | Ga0068858_100652904 | 3300005842 | Unclassified | 1022 |
| 88 | Ga0068860_100008948 | 3300005843 | Bacteria | 9973 |
| 89 | Ga0068860_100461524 | 3300005843 | Bacteria | 1264 |
| 90 | Ga0081540_1000026 | 3300005983 | Bacteria | 155402 |
| 91 | Ga0081539_10001608 | 3300005985 | Bacteria | 37193 |
| 92 | Ga0070717_10305361 | 3300006028 | Bacteria | 1415 |
| 93 | Ga0070717_10459301 | 3300006028 | Bacteria | 1148 |
| 94 | Ga0070717_10673044 | 3300006028 | Bacteria | 940 |
| 95 | Ga0075365_10054070 | 3300006038 | Bacteria | 2661 |
| 96 | Ga0075363_100109704 | 3300006048 | Bacteria | 1533 |
| 97 | Ga0075363_100192348 | 3300006048 | Bacteria | 1164 |
| 98 | Ga0075364_10035753 | 3300006051 | Bacteria | 3211 |
| 99 | Ga0070716_100000145 | 3300006173 | Bacteria | 28411 |
| 100 | Ga0070712_100076890 | 3300006175 | Bacteria | 2404 |
| 101 | Ga0070712_100226687 | 3300006175 | Bacteria | 1482 |
| 102 | Ga0075362_10003498 | 3300006177 | Bacteria | 5509 |
| 103 | Ga0075366_10292905 | 3300006195 | Bacteria | 995 |
| 104 | Ga0075370_10026388 | 3300006353 | Bacteria | 3218 |
| 105 | Ga0068871_100228823 | 3300006358 | Bacteria | 1613 |
| 106 | Ga0068871_100522503 | 3300006358 | Bacteria | 1072 |
| 107 | Ga0075430_100814067 | 3300006846 | Bacteria | 770 |
| 108 | Ga0075433_10176851 | 3300006852 | Bacteria | 1899 |
| 109 | Ga0075434_100237142 | 3300006871 | Bacteria | 1844 |
| 110 | Ga0075436_100057009 | 3300006914 | Bacteria | 2698 |
| 111 | Ga0097620_101705584 | 3300006931 | Bacteria | 696 |
| 112 | Ga0097620_101836257 | 3300006931 | Bacteria | 669 |
| 113 | Ga0075435_100805974 | 3300007076 | Bacteria | 818 |
| 114 | Ga0099795_10032603 | 3300007788 | Bacteria | 1803 |
| 115 | Ga0105240_10011621 | 3300009093 | Bacteria | 12245 |
| 116 | Ga0105240_10592525 | 3300009093 | Bacteria | 1221 |
| 117 | Ga0111539_10845855 | 3300009094 | Bacteria | 1065 |
| 118 | Ga0111539_10922984 | 3300009094 | Bacteria | 1015 |
| 119 | Ga0105245_10041075 | 3300009098 | Bacteria | 4123 |
| 120 | Ga0105245_10118925 | 3300009098 | Bacteria | 2466 |
| 121 | Ga0105245_10628042 | 3300009098 | Bacteria | 1103 |
| 122 | Ga0105247_10087581 | 3300009101 | Bacteria | 1972 |
| 123 | Ga0105247_10229396 | 3300009101 | Bacteria | 1260 |
| 124 | Ga0105243_10741810 | 3300009148 | Bacteria | 962 |
| 125 | Ga0105241_10006012 | 3300009174 | Bacteria | 8955 |
| 126 | Ga0105241_10047303 | 3300009174 | Bacteria | 3271 |
| 127 | Ga0105241_10107351 | 3300009174 | Bacteria | 2230 |
| 128 | Ga0105241_10161736 | 3300009174 | Bacteria | 1841 |
| 129 | Ga0105248_10003346 | 3300009177 | Bacteria | 17822 |
| 130 | Ga0105248_10342881 | 3300009177 | Bacteria | 1682 |
| 131 | Ga0105248_11679242 | 3300009177 | Bacteria | 720 |
| 132 | Ga0105237_10001961 | 3300009545 | Bacteria | 26196 |
| 133 | Ga0105237_10075352 | 3300009545 | Bacteria | 3365 |
| 134 | Ga0105237_10599005 | 3300009545 | Bacteria | 1109 |
| 135 | Ga0105238_10014352 | 3300009551 | Bacteria | 8008 |
| 136 | Ga0105238_10114493 | 3300009551 | Bacteria | 2676 |
| 137 | Ga0105249_10965492 | 3300009553 | Bacteria | 920 |
| 138 | Ga0105249_11104873 | 3300009553 | Bacteria | 863 |
| 139 | Ga0099796_10002309 | 3300010159 | Bacteria | 4156 |
| 140 | Ga0105239_10338960 | 3300010375 | Bacteria | 1696 |
| 141 | Ga0105239_10508268 | 3300010375 | Bacteria | 1370 |
| 142 | Ga0105246_10042568 | 3300011119 | Bacteria | 3076 |
| 143 | Ga0105246_10993082 | 3300011119 | Unclassified | 759 |
| 144 | Ga0157369_10324579 | 3300013105 | Bacteria | 1600 |
| 145 | Ga0157374_10163835 | 3300013296 | Bacteria | 2166 |
| 146 | Ga0157374_10446882 | 3300013296 | Bacteria | 1294 |
| 147 | Ga0157378_10000137 | 3300013297 | Bacteria | 69371 |
| 148 | Ga0157378_10456827 | 3300013297 | Bacteria | 1269 |
| 149 | Ga0157378_10972849 | 3300013297 | Bacteria | 882 |
| 150 | Ga0157378_11043561 | 3300013297 | Unclassified | 853 |
| 151 | Ga0163162_10011396 | 3300013306 | Bacteria | 8669 |
| 152 | Ga0163162_10370500 | 3300013306 | Bacteria | 1565 |
| 153 | Ga0157372_10686948 | 3300013307 | Bacteria | 1191 |
| 154 | Ga0157375_10624183 | 3300013308 | Bacteria | 1236 |
| 155 | Ga0163163_10279533 | 3300014325 | Bacteria | 1721 |
| 156 | Ga0163163_10387748 | 3300014325 | Bacteria | 1455 |
| 157 | Ga0163163_10610186 | 3300014325 | Bacteria | 1154 |
| 158 | Ga0163163_11698572 | 3300014325 | Bacteria | 692 |
| 159 | Ga0157380_10466905 | 3300014326 | Bacteria | 1217 |
| 160 | Ga0157377_10249301 | 3300014745 | Bacteria | 1150 |
| 161 | Ga0157377_10515330 | 3300014745 | Bacteria | 838 |
| 162 | Ga0157379_10020881 | 3300014968 | Bacteria | 5795 |
| 163 | Ga0157379_10090787 | 3300014968 | Bacteria | 2740 |
| 164 | Ga0157376_10272847 | 3300014969 | Bacteria | 1590 |
| 165 | Ga0163161_10522730 | 3300017792 | Bacteria | 969 |
| 166 | Ga0163161_10546572 | 3300017792 | Unclassified | 949 |
| 167 | Ga0213875_10013483 | 3300021388 | Bacteria | 4011 |
| 168 | Ga0213875_10035642 | 3300021388 | Bacteria | 2348 |
| 169 | Ga0213875_10144699 | 3300021388 | Bacteria | 1113 |
| 170 | Ga0256744_143749 | 3300023309 | Bacteria | 747 |
| 171 | Ga0207425_1028882 | 3300025245 | Bacteria | 1122 |
| 172 | Ga0209673_1007558 | 3300025273 | Bacteria | 4979 |
| 173 | Ga0209675_1000076 | 3300025291 | Bacteria | 159428 |
| 174 | Ga0209676_1002852 | 3300025292 | Bacteria | 11407 |
| 175 | Ga0209758_1000193 | 3300025297 | Bacteria | 134744 |
| 176 | Ga0209050_1000198 | 3300025298 | Bacteria | 134820 |
| 177 | Ga0207692_10201961 | 3300025898 | Bacteria | 1169 |
| 178 | Ga0207642_10675642 | 3300025899 | Bacteria | 649 |
| 179 | Ga0207688_10038915 | 3300025901 | Bacteria | 2641 |
| 180 | Ga0207647_10008863 | 3300025904 | Bacteria | 7177 |
| 181 | Ga0207699_10257888 | 3300025906 | Bacteria | 1204 |
| 182 | Ga0207654_10439417 | 3300025911 | Unclassified | 913 |
| 183 | Ga0207707_10080318 | 3300025912 | Bacteria | 2848 |
| 184 | Ga0207707_10200437 | 3300025912 | Bacteria | 1740 |
| 185 | Ga0207695_10013078 | 3300025913 | Bacteria | 9909 |
| 186 | Ga0207695_10112342 | 3300025913 | Bacteria | 2702 |
| 187 | Ga0207671_10005144 | 3300025914 | Bacteria | 12182 |
| 188 | Ga0207693_10007459 | 3300025915 | Bacteria | 8997 |
| 189 | Ga0207693_10290966 | 3300025915 | Unclassified | 1280 |
| 190 | Ga0207693_10304631 | 3300025915 | Bacteria | 1248 |
| 191 | Ga0207663_10154904 | 3300025916 | Bacteria | 1611 |
| 192 | Ga0207660_10034563 | 3300025917 | Bacteria | 3505 |
| 193 | Ga0207657_10211771 | 3300025919 | Bacteria | 1555 |
| 194 | Ga0207649_10068638 | 3300025920 | Bacteria | 2255 |
| 195 | Ga0207652_10095931 | 3300025921 | Bacteria | 2613 |
| 196 | Ga0207652_10122250 | 3300025921 | Bacteria | 2317 |
| 197 | Ga0207694_10088439 | 3300025924 | Bacteria | 2442 |
| 198 | Ga0207650_10292624 | 3300025925 | Bacteria | 1328 |
| 199 | Ga0207687_10207552 | 3300025927 | Bacteria | 1535 |
| 200 | Ga0207687_10532026 | 3300025927 | Bacteria | 984 |
| 201 | Ga0207700_10004238 | 3300025928 | Bacteria | 8425 |
| 202 | Ga0207700_10130141 | 3300025928 | Bacteria | 2054 |
| 203 | Ga0207700_10473728 | 3300025928 | Bacteria | 1106 |
| 204 | Ga0207664_10193930 | 3300025929 | Bacteria | 1750 |
| 205 | Ga0207664_10473777 | 3300025929 | Bacteria | 1119 |
| 206 | Ga0207644_10042302 | 3300025931 | Bacteria | 3228 |
| 207 | Ga0207644_10342309 | 3300025931 | Bacteria | 1213 |
| 208 | Ga0207690_10982089 | 3300025932 | Bacteria | 702 |
| 209 | Ga0207706_10676467 | 3300025933 | Bacteria | 883 |
| 210 | Ga0207665_10000015 | 3300025939 | Bacteria | 133147 |
| 211 | Ga0207711_10008218 | 3300025941 | Bacteria | 8736 |
| 212 | Ga0207711_11113050 | 3300025941 | Bacteria | 731 |
| 213 | Ga0207689_10083762 | 3300025942 | Bacteria | 2622 |
| 214 | Ga0207661_10018071 | 3300025944 | Bacteria | 5234 |
| 215 | Ga0207661_10326819 | 3300025944 | Bacteria | 1380 |
| 216 | Ga0207661_10502474 | 3300025944 | Bacteria | 1108 |
| 217 | Ga0207679_10499057 | 3300025945 | Unclassified | 1086 |
| 218 | Ga0207667_10005618 | 3300025949 | Bacteria | 15301 |
| 219 | Ga0207667_10131669 | 3300025949 | Bacteria | 2576 |
| 220 | Ga0207651_10331208 | 3300025960 | Bacteria | 1276 |
| 221 | Ga0207651_10765134 | 3300025960 | Bacteria | 854 |
| 222 | Ga0207640_10246025 | 3300025981 | Bacteria | 1385 |
| 223 | Ga0207658_10307000 | 3300025986 | Bacteria | 1369 |
| 224 | Ga0207703_10168856 | 3300026035 | Bacteria | 1923 |
| 225 | Ga0207703_10922849 | 3300026035 | Bacteria | 836 |
| 226 | Ga0207639_10066736 | 3300026041 | Bacteria | 2797 |
| 227 | Ga0207639_10285306 | 3300026041 | Bacteria | 1453 |
| 228 | Ga0207678_10001728 | 3300026067 | Bacteria | 20004 |
| 229 | Ga0207708_10124155 | 3300026075 | Bacteria | 2014 |
| 230 | Ga0207702_10100613 | 3300026078 | Bacteria | 2551 |
| 231 | Ga0207702_10536175 | 3300026078 | Bacteria | 1144 |
| 232 | Ga0207702_10896451 | 3300026078 | Bacteria | 879 |
| 233 | Ga0207648_10484531 | 3300026089 | Bacteria | 1130 |
| 234 | Ga0207676_11284800 | 3300026095 | Bacteria | 726 |
| 235 | Ga0207674_10038241 | 3300026116 | Bacteria | 4985 |
| 236 | Ga0207674_10730497 | 3300026116 | Bacteria | 956 |
| 237 | Ga0207683_10257710 | 3300026121 | Bacteria | 1592 |
| 238 | Ga0207698_10285821 | 3300026142 | Bacteria | 1528 |
| 239 | Ga0207698_10583884 | 3300026142 | Bacteria | 1100 |
| 240 | Ga0207698_11080406 | 3300026142 | Unclassified | 815 |
| 241 | Ga0207428_10369657 | 3300027907 | Bacteria | 1053 |
| 242 | Ga0268264_10006281 | 3300028381 | Bacteria | 10020 |
| 243 | Ga0268264_10435573 | 3300028381 | Bacteria | 1267 |
| 244 | Ga0265325_10000883 | 3300031241 | Bacteria | 21638 |
| 245 | Ga0265340_10000021 | 3300031247 | Bacteria | 87640 |
| 246 | Ga0265340_10007700 | 3300031247 | Bacteria | 5841 |
| 247 | Ga0265339_10008470 | 3300031249 | Bacteria | 6545 |
| 248 | Ga0265331_10005821 | 3300031250 | Bacteria | 7387 |
| 249 | Ga0265316_10011221 | 3300031344 | Bacteria | 8103 |
| 250 | Ga0307513_10121789 | 3300031456 | Bacteria | 2574 |
| 251 | Ga0307513_10252117 | 3300031456 | Bacteria | 1561 |
| 252 | Ga0307509_10468070 | 3300031507 | Bacteria | 951 |
| 253 | Ga0316576_10059742 | 3300031727 | Bacteria | 2792 |
| 254 | Ga0307413_10224420 | 3300031824 | Bacteria | 1375 |
| 255 | Ga0307406_10478602 | 3300031901 | Bacteria | 1005 |
| 256 | Ga0307409_100021901 | 3300031995 | Bacteria | 4394 |
| 257 | Ga0307409_100673953 | 3300031995 | Bacteria | 1031 |
| 258 | Ga0307409_100898414 | 3300031995 | Bacteria | 899 |
| 259 | Ga0307409_101265458 | 3300031995 | Bacteria | 762 |
| 260 | Ga0307409_101444102 | 3300031995 | Unclassified | 715 |
| 261 | Ga0307416_100857444 | 3300032002 | Bacteria | 1007 |
| 262 | Ga0307414_10328306 | 3300032004 | Bacteria | 1305 |
| 263 | Ga0307414_10372659 | 3300032004 | Bacteria | 1232 |
| 264 | Ga0307411_10393337 | 3300032005 | Bacteria | 1144 |
| 265 | Ga0373926_0032688 | 3300035083 | Bacteria | 1836 |
| 266 | Ga0373926_0069335 | 3300035083 | Bacteria | 1294 |
| 267 | Ga0373929_0074793 | 3300035085 | Bacteria | 816 |
| 268 | Ga0373934_0059108 | 3300035086 | Bacteria | 1526 |
| 269 | Ga0373944_0013984 | 3300035089 | Bacteria | 2235 |
| 270 | Ga0373944_0029953 | 3300035089 | Bacteria | 1630 |
| 271 | Ga0373923_0015422 | 3300035111 | Bacteria | 2885 |
| 272 | Ga0373923_0025454 | 3300035111 | Bacteria | 2345 |
| 273 | Ga0373923_0103258 | 3300035111 | Bacteria | 1259 |
| 274 | Ga0373932_0182951 | 3300035112 | Bacteria | 736 |
| 275 | Ga0373936_0024301 | 3300035113 | Bacteria | 2365 |
| 276 | Ga0373945_0105818 | 3300035116 | Bacteria | 1106 |
| 277 | Ga0373945_0327702 | 3300035116 | Unclassified | 660 |
| 278 | Ga0373954_0120505 | 3300035118 | Bacteria | 1273 |
| 279 | Ga0373956_0030002 | 3300035119 | Bacteria | 2374 |
| 280 | Ga0373946_0039897 | 3300035171 | Bacteria | 1918 |
| 281 | Ga0373946_0107435 | 3300035171 | Bacteria | 1259 |
| 282 | Ga0373955_0052696 | 3300035172 | Bacteria | 2220 |
| 283 | Ga0373955_0073000 | 3300035172 | Bacteria | 1923 |
| 284 | Ga0373955_0414661 | 3300035172 | Bacteria | 819 |
| 285 | Ga0373924_0008228 | 3300035410 | Bacteria | 3784 |
| 286 | Ga0373924_0042870 | 3300035410 | Bacteria | 1857 |
| 287 | Ga0373935_0094130 | 3300035692 | Bacteria | 1965 |
| 288 | Ga0373935_0109598 | 3300035692 | Bacteria | 1831 |
| 289 | Ga0373935_0219362 | 3300035692 | Bacteria | 1320 |
| 290 | Ga0373935_0386289 | 3300035692 | Bacteria | 1003 |
| 291 | Ga0373927_0091361 | 3300035695 | Bacteria | 1977 |
| 292 | Ga0373927_0211307 | 3300035695 | Bacteria | 1274 |
| 293 | Ga0373933_0065780 | 3300035724 | Bacteria | 2195 |
| 294 | Ga0373933_0092148 | 3300035724 | Bacteria | 1871 |
| 295 | Ga0373947_0095121 | 3300035725 | Bacteria | 1864 |
| 296 | Ga0373947_0161484 | 3300035725 | Bacteria | 1449 |
| 297 | Ga0373947_0163330 | 3300035725 | Bacteria | 1441 |
| 298 | Ga0373947_0432533 | 3300035725 | Unclassified | 890 |
| 299 | Ga0373937_0014570 | 3300036401 | Bacteria | 6944 |
| 300 | Ga0373937_0016581 | 3300036401 | Bacteria | 6544 |
| 301 | Ga0373937_0016833 | 3300036401 | Bacteria | 6499 |
| 302 | Ga0373937_0054264 | 3300036401 | Bacteria | 3677 |
| 303 | Ga0373937_0230314 | 3300036401 | Bacteria | 1745 |
| 304 | Ga0373937_1094874 | 3300036401 | Bacteria | 745 |
| 305 | Ga0373925_0022624 | 3300037068 | Bacteria | 4587 |
| 306 | Ga0373925_0033185 | 3300037068 | Bacteria | 3805 |
| 307 | Ga0373925_0176149 | 3300037068 | Bacteria | 1690 |
| 308 | Ga0373925_0254570 | 3300037068 | Bacteria | 1409 |
| 309 | Ga0373925_0579677 | 3300037068 | Unclassified | 923 |
| 310 | Ga0395900_0019643 | 3300037418 | Bacteria | 6889 |
| 311 | Ga0395898_0027805 | 3300037466 | Bacteria | 5671 |
| 312 | Ga0395898_1230989 | 3300037466 | Bacteria | 679 |
| 313 | Ga0395905_0012767 | 3300037471 | Bacteria | 8079 |
| 314 | Ga0395905_0698934 | 3300037471 | Bacteria | 916 |
| 315 | Ga0436364_0457007 | 3300037853 | Bacteria | 2273 |
| 316 | Ga0436364_0884684 | 3300037853 | Unclassified | 3902 |
| 317 | Ga0436364_0892395 | 3300037853 | Bacteria | 14112 |
| 318 | Ga0436364_1022767 | 3300037853 | Bacteria | 2728 |
| 319 | Ga0436364_1304001 | 3300037853 | Bacteria | 1402 |
| 320 | Ga0395901_0225133 | 3300038443 | Bacteria | 1959 |
| 321 | Ga0436365_0491762 | 3300039437 | Bacteria | 2953 |
| 322 | Ga0436365_0656636 | 3300039437 | Bacteria | 1109 |
| 323 | Ga0436360_1002537 | 3300039438 | Bacteria | 5878 |
| 324 | Ga0436360_1008693 | 3300039438 | Bacteria | 4001 |
| 325 | Ga0436361_0458016 | 3300039447 | Unclassified | 1441 |
| 326 | Ga0436361_1138492 | 3300039447 | Bacteria | 868 |
| 327 | Ga0436361_1175342 | 3300039447 | Bacteria | 622 |
| 328 | Ga0436363_0594316 | 3300039450 | Bacteria | 661 |
| 329 | Ga0436363_0651146 | 3300039450 | Bacteria | 1464 |
| 330 | Ga0436363_1652652 | 3300039450 | Unclassified | 1070 |
| 331 | Ga0436362_0156731 | 3300039453 | Bacteria | 1291 |
| 332 | Ga0436362_0592899 | 3300039453 | Unclassified | 1155 |
| 333 | Ga0436362_1161106 | 3300039453 | Bacteria | 1478 |
| 334 | Ga0451793_0430518 | 3300041452 | Bacteria | 1920 |
| 335 | Ga0451797_0372802 | 3300041453 | Bacteria | 1378 |
| 336 | Ga0451795_0702556 | 3300041456 | Bacteria | 2606 |
| 337 | Ga0451800_0925057 | 3300041459 | Bacteria | 1854 |
| 338 | Ga0451802_1611071 | 3300041460 | Bacteria | 1887 |
| 339 | Ga0451807_1267673 | 3300041486 | Bacteria | 1263 |
| 340 | Ga0451847_0766722 | 3300041503 | Bacteria | 1021 |
| 341 | Ga0450923_041557 | 3300042125 | Bacteria | 968 |
| 342 | Ga0466963_0393414 | 3300044694 | Bacteria | 977 |
| 343 | Ga0453684_0156847 | 3300044712 | Bacteria | 2697 |
| 344 | Ga0451576_0536622 | 3300045051 | Bacteria | 1229 |
| 345 | Ga0451576_0813709 | 3300045051 | Bacteria | 981 |
| 346 | Ga0466967_0032202 | 3300045976 | Bacteria | 4424 |
| 347 | Ga0495592_0333230 | 3300046454 | Bacteria | 977 |
| 348 | Ga0495638_0056088 | 3300046460 | Bacteria | 2445 |
| 349 | Ga0495651_0063858 | 3300046462 | Bacteria | 2814 |
| 350 | Ga0495651_0293755 | 3300046462 | Bacteria | 1093 |
| 351 | Ga0495653_0176136 | 3300046463 | Bacteria | 1472 |
| 352 | Ga0495653_0277617 | 3300046463 | Bacteria | 1101 |
| 353 | Ga0495662_0030927 | 3300046476 | Bacteria | 2585 |
| 354 | Ga0495664_0001103 | 3300046477 | Bacteria | 13985 |
| 355 | Ga0495608_0031462 | 3300046511 | Bacteria | 3588 |
| 356 | Ga0495608_0061977 | 3300046511 | Bacteria | 2458 |
| 357 | Ga0495608_0401188 | 3300046511 | Bacteria | 839 |
| 358 | Ga0495610_0060873 | 3300046512 | Bacteria | 1796 |
| 359 | Ga0495618_0200136 | 3300046514 | Bacteria | 1264 |
| 360 | Ga0495628_0083890 | 3300046516 | Bacteria | 2473 |
| 361 | Ga0495628_0512943 | 3300046516 | Bacteria | 864 |
| 362 | Ga0495630_0174017 | 3300046517 | Bacteria | 1641 |
| 363 | Ga0495630_0861071 | 3300046517 | Unclassified | 691 |
| 364 | Ga0495632_0007707 | 3300046519 | Bacteria | 6724 |
| 365 | Ga0495644_0031119 | 3300046523 | Bacteria | 2016 |
| 366 | Ga0495666_0123628 | 3300046526 | Bacteria | 1211 |
| 367 | Ga0495652_0059778 | 3300046529 | Bacteria | 3224 |
| 368 | Ga0495652_0179198 | 3300046529 | Bacteria | 1628 |
| 369 | Ga0495640_0064779 | 3300046533 | Bacteria | 2470 |
| 370 | Ga0495640_0086876 | 3300046533 | Bacteria | 2070 |
| 371 | Ga0495640_0443176 | 3300046533 | Unclassified | 794 |
| 372 | Ga0495645_0000981 | 3300046543 | Bacteria | 19453 |
| 373 | Ga0495667_0040729 | 3300046559 | Bacteria | 3083 |
| 374 | Ga0495667_0190971 | 3300046559 | Bacteria | 1312 |
| 375 | Ga0495667_0313245 | 3300046559 | Bacteria | 993 |
| 376 | Ga0495668_0048689 | 3300046616 | Bacteria | 2351 |
| 377 | Ga0495634_0571460 | 3300046642 | Unclassified | 658 |
| 378 | Ga0495635_0040598 | 3300046663 | Bacteria | 3216 |
| 379 | Ga0495635_0074601 | 3300046663 | Bacteria | 2324 |
| 380 | Ga0495635_0653150 | 3300046663 | Bacteria | 684 |
| 381 | Ga0495657_0104293 | 3300046675 | Bacteria | 1803 |
| 382 | Ga0495599_0022295 | 3300046678 | Bacteria | 3953 |
| 383 | Ga0495599_0031894 | 3300046678 | Bacteria | 3307 |
| 384 | Ga0495623_0048921 | 3300046679 | Bacteria | 2680 |
| 385 | Ga0495613_0048855 | 3300046689 | Bacteria | 3123 |
| 386 | Ga0495671_0000577 | 3300046692 | Bacteria | 27383 |
| 387 | Ga0495600_0068081 | 3300046809 | Bacteria | 2327 |
| 388 | Ga0495604_0241085 | 3300047317 | Bacteria | 1236 |
| 389 | Ga0495604_0291119 | 3300047317 | Bacteria | 1100 |
| 390 | Ga0495674_0066456 | 3300047319 | Bacteria | 3128 |
| 391 | Ga0495680_0022707 | 3300047322 | Bacteria | 5227 |
| 392 | Ga0495675_0007005 | 3300047444 | Bacteria | 6934 |
| 393 | Ga0495675_0077983 | 3300047444 | Bacteria | 2087 |
| 394 | Ga0495673_0000019 | 3300047469 | Bacteria | 554389 |
| 395 | Ga0495684_0030984 | 3300047471 | Bacteria | 4106 |
| 396 | Ga0495684_0258590 | 3300047471 | Bacteria | 1264 |
| 397 | Ga0495684_0589155 | 3300047471 | Bacteria | 752 |
| 398 | Ga0495593_0152238 | 3300047673 | Bacteria | 1170 |
| 399 | Ga0495602_0012924 | 3300048088 | Bacteria | 8551 |
| 400 | Ga0495602_0195902 | 3300048088 | Bacteria | 1545 |
| 401 | Ga0496100_0106507 | 3300048903 | Bacteria | 1941 |
| 402 | Ga0496101_0097826 | 3300048904 | Bacteria | 2192 |
| 403 | Ga0496101_0131758 | 3300048904 | Bacteria | 1899 |
| 404 | Ga0496101_0643585 | 3300048904 | Bacteria | 838 |
| 405 | Ga0496102_0006757 | 3300048905 | Bacteria | 9794 |
| 406 | Ga0496102_0042273 | 3300048905 | Bacteria | 4130 |
| 407 | Ga0496102_0091933 | 3300048905 | Bacteria | 2809 |
| 408 | Ga0496103_0024003 | 3300048906 | Bacteria | 3679 |
| 409 | Ga0496103_0024114 | 3300048906 | Bacteria | 3669 |
| 410 | Ga0496104_0350868 | 3300048907 | Bacteria | 1388 |
| 411 | Ga0496104_0582772 | 3300048907 | Bacteria | 1029 |
| 412 | Ga0496104_0590355 | 3300048907 | Bacteria | 1021 |
| 413 | Ga0496105_0298695 | 3300048908 | Bacteria | 1295 |
| 414 | Ga0496106_0110783 | 3300048909 | Bacteria | 2137 |
| 415 | Ga0496106_0175284 | 3300048909 | Bacteria | 1701 |
| 416 | Ga0496106_0357859 | 3300048909 | Bacteria | 1172 |
| 417 | Ga0496107_0006697 | 3300048910 | Bacteria | 7933 |
| 418 | Ga0496108_0470057 | 3300048911 | Bacteria | 1099 |
| 419 | Ga0496108_0567710 | 3300048911 | Bacteria | 989 |
| 420 | Ga0496108_0820502 | 3300048911 | Bacteria | 802 |
| 421 | Ga0496109_0221284 | 3300048912 | Bacteria | 1780 |
| 422 | Ga0496110_0189182 | 3300048913 | Bacteria | 1869 |
| 423 | Ga0496110_0284090 | 3300048913 | Bacteria | 1507 |
| 424 | Ga0496110_0432373 | 3300048913 | Bacteria | 1200 |
| 425 | Ga0496111_0270390 | 3300048914 | Bacteria | 1261 |
| 426 | Ga0496112_0168731 | 3300048915 | Bacteria | 2154 |
| 427 | Ga0496112_0205255 | 3300048915 | Bacteria | 1929 |
| 428 | Ga0496112_0716491 | 3300048915 | Unclassified | 928 |
| 429 | Ga0496113_0087670 | 3300048916 | Bacteria | 2393 |
| 430 | Ga0496113_0227752 | 3300048916 | Bacteria | 1486 |
| 431 | Ga0496113_0335446 | 3300048916 | Bacteria | 1213 |
| 432 | Ga0496116_0006102 | 3300048919 | Bacteria | 11021 |
| 433 | Ga0496119_0217078 | 3300048922 | Bacteria | 981 |
| 434 | Ga0496122_0001988 | 3300048925 | Bacteria | 30507 |
| 435 | Ga0496122_0145955 | 3300048925 | Bacteria | 1470 |
| 436 | Ga0496124_0000857 | 3300048927 | Bacteria | 49660 |
| 437 | Ga0496124_0725266 | 3300048927 | Bacteria | 627 |
| 438 | Ga0496125_0000986 | 3300048928 | Bacteria | 44353 |
| 439 | Ga0496125_0002760 | 3300048928 | Bacteria | 22221 |
| 440 | Ga0496125_0058897 | 3300048928 | Bacteria | 3099 |
| 441 | Ga0496125_0212987 | 3300048928 | Bacteria | 1253 |
| 442 | Ga0496126_0198630 | 3300048929 | Bacteria | 1695 |
| 443 | Ga0501033_0022898 | 3300049570 | Bacteria | 4710 |
| 444 | Ga0501033_0078057 | 3300049570 | Bacteria | 2430 |
| 445 | Ga0501033_0198784 | 3300049570 | Bacteria | 1432 |
| 446 | Ga0501033_0349803 | 3300049570 | Bacteria | 1035 |
| 447 | Ga0501034_0503855 | 3300049571 | Bacteria | 1124 |
| 448 | Ga0501036_0025747 | 3300049572 | Bacteria | 4965 |
| 449 | Ga0501037_0287692 | 3300049573 | Bacteria | 1144 |
| 450 | Ga0501037_0438330 | 3300049573 | Bacteria | 892 |
| 451 | Ga0501037_0610185 | 3300049573 | Bacteria | 732 |
| 452 | Ga0501037_0657965 | 3300049573 | Bacteria | 700 |
| 453 | Ga0501038_0062526 | 3300049574 | Bacteria | 3181 |
| 454 | Ga0501038_0066963 | 3300049574 | Bacteria | 3057 |
| 455 | Ga0501043_0039285 | 3300049579 | Bacteria | 3719 |
| 456 | Ga0501046_0020342 | 3300049580 | Bacteria | 5492 |
| 457 | Ga0501046_0103814 | 3300049580 | Bacteria | 2178 |
| 458 | Ga0501047_0042916 | 3300049581 | Bacteria | 4369 |
| 459 | Ga0501047_0086454 | 3300049581 | Bacteria | 3013 |
| 460 | Ga0501047_0105836 | 3300049581 | Bacteria | 2693 |
| 461 | Ga0501048_0000067 | 3300049582 | Bacteria | 53194 |
| 462 | Ga0501070_0756595 | 3300049586 | Bacteria | 765 |
| 463 | Ga0501073_0470399 | 3300049589 | Unclassified | 869 |
| 464 | Ga0501080_0248814 | 3300049742 | Bacteria | 1621 |
| 465 | Ga0501080_0263992 | 3300049742 | Bacteria | 1568 |
| 466 | Ga0501035_0037577 | 3300049822 | Bacteria | 4384 |
| 467 | Ga0501035_0041654 | 3300049822 | Bacteria | 4146 |
| 468 | Ga0501035_0629477 | 3300049822 | Unclassified | 872 |
| 469 | Ga0501035_0938038 | 3300049822 | Unclassified | 683 |
| 470 | Ga0501044_0044046 | 3300049823 | Bacteria | 4634 |
| 471 | Ga0501044_0100174 | 3300049823 | Bacteria | 2916 |
| 472 | Ga0501044_0314008 | 3300049823 | Bacteria | 1493 |
| 473 | Ga0501044_1064620 | 3300049823 | Bacteria | 679 |
| 474 | nmdc:mga03683_4425_c1 | 3300050489 | Bacteria | 4660 |
| 475 | nmdc:mga0yw44_485775_c1 | 3300050492 | Bacteria | 838 |
| 476 | nmdc:mga0k408_369575_c1 | 3300050493 | Bacteria | 855 |
| 477 | nmdc:mga06z11_342885_c1 | 3300050494 | Bacteria | 893 |
| 478 | nmdc:mga07m45_25079_c1 | 3300050496 | Bacteria | 3269 |
| 479 | nmdc:mga05p37_843093_c1 | 3300050507 | Bacteria | 996 |
| 480 | nmdc:mga08y16_700480_c1 | 3300050511 | Bacteria | 1013 |
| 481 | nmdc:mga0n895_108998_c1 | 3300050512 | Bacteria | 2784 |
| 482 | nmdc:mga0n895_267723_c1 | 3300050512 | Bacteria | 1733 |
| 483 | nmdc:mga0n895_872791_c1 | 3300050512 | Bacteria | 886 |
| 484 | nmdc:mga0rr50_1354583_c1 | 3300050513 | Bacteria | 603 |
| 485 | nmdc:mga08x19_27892_c1 | 3300050514 | Bacteria | 3533 |
| 486 | nmdc:mga0a205_288685_c1 | 3300050515 | Bacteria | 1515 |
| 487 | nmdc:mga0a205_524749_c1 | 3300050515 | Bacteria | 1040 |
| 488 | Ga0495601_0005551 | 3300053077 | Bacteria | 7355 |
| 489 | Ga0495612_0010836 | 3300053078 | Bacteria | 3682 |
| 490 | Ga0495595_0017648 | 3300053084 | Bacteria | 3072 |
| 491 | Ga0495619_0025872 | 3300053085 | Bacteria | 3772 |
| 492 | Ga0495619_0120015 | 3300053085 | Bacteria | 1802 |
| 493 | Ga0500578_0000006 | 3300053086 | Bacteria | 234598 |
| 494 | Ga0500644_0011827 | 3300053088 | Bacteria | 2396 |
| 495 | Ga0500646_0034657 | 3300053090 | Bacteria | 1400 |
| 496 | Ga0500583_0303892 | 3300053092 | Bacteria | 780 |
| 497 | Ga0500651_0041543 | 3300053093 | Bacteria | 2898 |
| 498 | Ga0500651_0232389 | 3300053093 | Bacteria | 1078 |
| 499 | Ga0500650_0041114 | 3300053098 | Bacteria | 2134 |
| 500 | Ga0500556_0000014 | 3300053104 | Bacteria | 232989 |
| 501 | Ga0500562_093437 | 3300053108 | Bacteria | 817 |
| 502 | Ga0500621_000002 | 3300053126 | Bacteria | 849473 |
| 503 | Ga0500628_017949 | 3300053129 | Bacteria | 1388 |
| 504 | Ga0500628_164265 | 3300053129 | Bacteria | 627 |
| 505 | Ga0500642_0148118 | 3300053130 | Bacteria | 1101 |
| 506 | Ga0500652_001508 | 3300053131 | Bacteria | 7149 |
| 507 | Ga0500652_147298 | 3300053131 | Bacteria | 978 |
| 508 | Ga0500655_010123 | 3300053133 | Bacteria | 1701 |
| 509 | Ga0500658_0150621 | 3300053134 | Bacteria | 1048 |
| 510 | Ga0500561_0039133 | 3300053137 | Bacteria | 1243 |
| 511 | Ga0500568_0001037 | 3300053139 | Bacteria | 18989 |
| 512 | Ga0500568_0002272 | 3300053139 | Bacteria | 11449 |
| 513 | Ga0500568_0076023 | 3300053139 | Bacteria | 1279 |
| 514 | Ga0500579_136861 | 3300053143 | Bacteria | 1122 |
| 515 | Ga0500604_0020304 | 3300053151 | Bacteria | 1868 |
| 516 | Ga0500604_0112573 | 3300053151 | Bacteria | 904 |
| 517 | Ga0500604_0129935 | 3300053151 | Bacteria | 846 |
| 518 | Ga0500616_0017418 | 3300053153 | Bacteria | 4075 |
| 519 | Ga0500616_0077889 | 3300053153 | Bacteria | 1673 |
| 520 | Ga0500622_0002520 | 3300053156 | Bacteria | 13153 |
| 521 | Ga0500627_0005107 | 3300053158 | Bacteria | 4313 |
| 522 | Ga0500627_0082466 | 3300053158 | Bacteria | 1435 |
| 523 | Ga0500634_0000009 | 3300053161 | Bacteria | 144333 |
| 524 | Ga0500570_102163 | 3300053724 | Bacteria | 1200 |
| 525 | Ga0501084_0823021 | 3300054114 | Bacteria | 782 |
| 526 | Ga0587076_030260 | 3300059645 | Bacteria | 955 |
| 527 | 2509118142 | 2508501123 | Bacteria | 6283661 |
| 528 | 2512037629 | 2511231221 | Bacteria | 6846400 |
| 529 | 2512929565 | 2512875016 | Bacteria | 6529530 |
| 530 | 2513585784 | 2513237086 | Bacteria | 7265287 |
| 531 | 2513886390 | 2513237140 | Bacteria | 7076289 |
| 532 | 2513906926 | 2513237143 | Bacteria | 6664116 |
| 533 | 2514033868 | 2513237164 | Bacteria | 7563725 |
| 534 | 2551680851 | 2551306084 | Bacteria | 8942552 |
| 535 | 2551684735 | 2551306085 | Bacteria | 7347181 |
| 536 | 2551698831 | 2551306087 | Bacteria | 7351905 |
| 537 | 2551718430 | 2551306090 | Bacteria | 7953713 |
| 538 | 2551739362 | 2551306093 | Bacteria | 7064773 |
| 539 | 2585168644 | 2582581283 | Bacteria | 6030556 |
| 540 | 2587725088 | 2585428057 | Bacteria | 6737412 |
| 541 | 2587731551 | 2585428058 | Bacteria | 6853932 |
| 542 | 2588295197 | 2588253510 | Bacteria | 6901809 |
| 543 | 2599938725 | 2599185301 | Bacteria | 6161860 |
| 544 | 2643967023 | 2643221592 | Bacteria | 6608788 |
| 545 | 2644142608 | 2643221625 | Bacteria | 6512927 |
| 546 | 2644152271 | 2643221627 | Bacteria | 6761570 |
| 547 | 2644271129 | 2643221648 | Bacteria | 6521465 |
| 548 | 2644485131 | 2643221686 | Bacteria | 6310811 |
| 549 | 2753357642 | 2751185800 | Bacteria | 5467370 |
| 550 | 2756673067 | 2756170246 | Bacteria | 7451806 |
| 551 | 2765465094 | 2765235802 | Bacteria | 5618596 |
| 552 | 2792753163 | 2791355123 | Bacteria | 8049106 |
| 553 | 2839993566 | 2839993093 | Bacteria | 5512535 |
| 554 | 2840764459 | 2840764183 | Bacteria | 6358399 |
| 555 | 2842333866 | 2842333319 | Bacteria | 8899485 |
| 556 | 2848864975 | 2848858292 | Bacteria | 7391279 |
| 557 | 2854914463 | 2854911287 | Bacteria | 5582813 |
| 558 | 2855829181 | 2855825444 | Bacteria | 6785811 |
| 559 | 2855844275 | 2855839649 | Bacteria | 7135830 |
| 560 | 2856326677 | 2856320880 | Bacteria | 7263508 |
| 561 | 2858806338 | 2858800743 | Bacteria | 6603254 |
| 562 | 2869168738 | 2869162929 | Bacteria | 6399702 |
| 563 | 2869280205 | 2869278585 | Bacteria | 7077053 |
| 564 | 2871492831 | 2871488783 | Bacteria | 6929816 |
| 565 | 2874144317 | 2874139085 | Bacteria | 7021506 |
| 566 | 2876366875 | 2876363079 | Bacteria | 6544991 |
| 567 | 2878744308 | 2878738818 | Bacteria | 7136951 |
| 568 | 2878756763 | 2878753008 | Bacteria | 6922523 |
| 569 | 2881851587 | 2881845957 | Bacteria | 6611900 |
| 570 | 2881868841 | 2881861095 | Bacteria | 7128710 |
| 571 | 2882462484 | 2882456835 | Bacteria | 6863978 |
| 572 | 2882919277 | 2882912400 | Bacteria | 6801539 |
| 573 | 2885320697 | 2885318864 | Bacteria | 6729568 |
| 574 | 2885329258 | 2885326080 | Bacteria | 7134805 |
| 575 | 2888341750 | 2888337043 | Bacteria | 6629336 |
| 576 | 2894653176 | 2894652903 | Bacteria | 4587256 |
| 577 | 2897804840 | 2897803580 | Bacteria | 7000062 |
| 578 | 2903453660 | 2903448605 | Bacteria | 7357801 |
| 579 | 2903496437 | 2903492973 | Bacteria | 13473544 |
| 580 | 2903524742 | 2903521522 | Bacteria | 6525694 |
| 581 | 2903531015 | 2903528002 | Bacteria | 6586099 |
| 582 | 2915991233 | 2915986958 | Bacteria | 6739310 |
| 583 | 2916014298 | 2916007675 | Bacteria | 6898660 |
| 584 | 2916034614 | 2916028427 | Bacteria | 6748433 |
| 585 | 2916061113 | 2916055098 | Bacteria | 6758838 |
| 586 | 2916069428 | 2916068649 | Bacteria | 6943657 |
| 587 | 2921214448 | 2921208531 | Bacteria | 6745326 |
| 588 | 2921269189 | 2921263974 | Bacteria | 6864552 |
| 589 | 2921295272 | 2921289301 | Bacteria | 7316391 |
| 590 | 2924154862 | 2924150972 | Bacteria | 7169444 |
| 591 | 2924162336 | 2924158325 | Bacteria | 7188855 |
| 592 | 2924179534 | 2924172951 | Bacteria | 6749356 |
| 593 | 2924193418 | 2924186466 | Bacteria | 6876637 |
| 594 | 2924199305 | 2924193448 | Bacteria | 6955718 |
| 595 | 2924212661 | 2924207177 | Bacteria | 6917007 |
| 596 | 2924216603 | 2924214083 | Bacteria | 7080103 |
| 597 | 2924234186 | 2924228884 | Bacteria | 6633132 |
| 598 | 2924719300 | 2924718760 | Bacteria | 6331356 |
| 599 | 2924782226 | 2924776078 | Bacteria | 7492003 |
| 600 | 2924788353 | 2924784321 | Bacteria | 7416538 |
| 601 | 2928525087 | 2928521798 | Bacteria | 4960112 |
| 602 | 2937044252 | 2937042894 | Bacteria | 6741576 |
| 603 | 2937054962 | 2937049772 | Bacteria | 6757901 |
| 604 | 2937068875 | 2937063883 | Bacteria | 7199456 |
| 605 | 2937076626 | 2937071275 | Bacteria | 6984483 |
| 606 | 2937103318 | 2937098957 | Bacteria | 7249374 |
| 607 | 2937118076 | 2937113482 | Bacteria | 6505872 |
| 608 | 2937123421 | 2937119839 | Bacteria | 6597547 |
| 609 | 2937131220 | 2937126314 | Bacteria | 6771275 |
| 610 | 2937850610 | 2937848649 | Bacteria | 6983481 |
| 611 | 2937877647 | 2937877337 | Bacteria | 7246526 |
| 612 | 2937977718 | 2937972304 | Bacteria | 7532020 |
| 613 | 2957391280 | 2957388812 | Bacteria | 6778072 |
| 614 | 2957413840 | 2957408893 | Bacteria | 6558585 |
| 615 | 2957424713 | 2957422303 | Bacteria | 7172205 |
| 616 | 2957447933 | 2957443900 | Bacteria | 6869977 |
| 617 | 2957457441 | 2957450854 | Bacteria | 6765715 |
| 618 | 2957475517 | 2957471148 | Bacteria | 6797643 |
| 619 | 2957482261 | 2957478035 | Bacteria | 6756658 |
| 620 | 2957490713 | 2957484790 | Bacteria | 6703082 |
| 621 | 2957496801 | 2957491536 | Bacteria | 6695180 |
| 622 | 2957504320 | 2957498199 | Bacteria | 7126688 |
| 623 | 2957512343 | 2957505466 | Bacteria | 7253085 |
| 624 | 2958036076 | 2958034702 | Bacteria | 6989922 |
| 625 | 2958047500 | 2958041894 | Bacteria | 13082850 |
| 626 | 2958066169 | 2958064165 | Bacteria | 7158582 |
| 627 | 2958084754 | 2958084443 | Bacteria | 7312792 |
| 628 | 2958093892 | 2958092219 | Bacteria | 6861151 |
| 629 | 2958151143 | 2958144490 | Bacteria | 6677056 |
| 630 | 2960601768 | 2960597568 | Bacteria | 6550735 |
| 631 | 2960624124 | 2960617483 | Bacteria | 6727748 |
| 632 | 2960643606 | 2960637947 | Bacteria | 7296468 |
| 633 | 2960648999 | 2960645483 | Bacteria | 7211087 |
| 634 | 2960659576 | 2960652885 | Bacteria | 7083688 |
| 635 | 2960664955 | 2960660292 | Bacteria | 7041660 |
| 636 | 2960679283 | 2960674078 | Bacteria | 6609048 |
| 637 | 2961173053 | 2961170736 | Bacteria | 7072258 |
| 638 | 2963649668 | 2963644680 | Bacteria | 6530403 |
| 639 | 2964631647 | 2964628898 | Bacteria | 7083044 |
| 640 | 2964641934 | 2964636051 | Bacteria | 7091832 |
| 641 | 2964654291 | 2964649959 | Bacteria | 6675118 |
| 642 | 2964669972 | 2964663802 | Bacteria | 7019362 |
| 643 | 2964682136 | 2964678106 | Bacteria | 6792020 |
| 644 | 2964702497 | 2964698721 | Bacteria | 6765331 |
| 645 | 2964709666 | 2964705432 | Bacteria | 7114648 |
| 646 | 2964718523 | 2964712639 | Bacteria | 6695970 |
| 647 | 2964724954 | 2964719344 | Bacteria | 7286602 |
| 648 | 2967685997 | 2967678726 | Bacteria | 7264382 |
| 649 | 2967726424 | 2967721400 | Bacteria | 7073753 |
| 650 | 2967752797 | 2967748971 | Bacteria | 6733771 |
| 651 | 2967769017 | 2967762386 | Bacteria | 6923502 |
| 652 | 2967782784 | 2967775926 | Bacteria | 6738189 |
| 653 | 2967998264 | 2967996073 | Bacteria | 6787468 |
| 654 | 2968006310 | 2968003550 | Bacteria | 6929263 |
| 655 | 2968022288 | 2968016561 | Bacteria | 7022047 |
| 656 | 2968087024 | 2968083720 | Bacteria | 7351627 |
| 657 | 2970023811 | 2970019648 | Bacteria | 7072033 |
| 658 | 2970038500 | 2970033650 | Bacteria | 7118744 |
| 659 | 2970046441 | 2970040964 | Bacteria | 6731123 |
| 660 | 2970050836 | 2970047711 | Bacteria | 7088379 |
| 661 | 2970056991 | 2970054988 | Bacteria | 6611507 |
| 662 | 2970062102 | 2970061556 | Bacteria | 7099761 |
| 663 | 2970073473 | 2970068827 | Bacteria | 7123112 |
| 664 | 2970078854 | 2970076120 | Bacteria | 6697332 |
| 665 | 2970087222 | 2970082768 | Bacteria | 6183754 |
| 666 | 2970114529 | 2970109326 | Bacteria | 6863976 |
| 667 | 2970121089 | 2970116247 | Bacteria | 6501857 |
| 668 | 2970155044 | 2970149975 | Bacteria | 6779706 |
| 669 | 2970161144 | 2970156795 | Bacteria | 7168044 |
| 670 | 2970168687 | 2970164137 | Bacteria | 6861252 |
| 671 | 2970193778 | 2970191845 | Bacteria | 7032787 |
| 672 | 2970474877 | 2970469710 | Bacteria | 6969209 |
| 673 | 2970505647 | 2970503327 | Bacteria | 7099517 |
| 674 | 2970594805 | 2970593180 | Bacteria | 7073582 |
| 675 | 2977556496 | 2977551784 | Bacteria | 7125765 |
| 676 | 2977576426 | 2977572785 | Bacteria | 6763888 |
| 677 | 2977584900 | 2977579622 | Bacteria | 6772100 |
| 678 | 2977825943 | 2977821940 | Bacteria | 6906439 |
| 679 | 2977837138 | 2977828996 | Bacteria | 7007971 |
| 680 | 2977927701 | 2977922695 | Bacteria | 6956781 |
| 681 | 2979810368 | 2979808191 | Bacteria | 7179355 |
| 682 | 2996354288 | 2996348954 | Bacteria | 7239054 |
| 683 | 3004280956 | 3004275668 | Bacteria | 7114440 |
| 684 | 8004378351 | 8004374579 | Bacteria | 6898112 |
| 685 | 8054002259 | 8054002106 | Bacteria | 7987183 |
| 686 | 8057734779 | 8057733483 | Bacteria | 6578323 |
| 687 | Ga0099795_10018783 | |||
| 688 | JGI25406J46586_10005313 | |||
| 689 | JGI25406J46586_10006357 | |||
| 690 | JGI25153J46596_10008957 | |||
| 691 | rootH1_10193276 | |||
| 692 | Ga0006562J51391_1012741 | |||
| 693 | JGI25404J52841_10000732 | |||
| 694 | Ga0055534_1011924 | |||
| 695 | Ga0055530_10016351 | |||
| 696 | Ga0065165_1005965 | |||
| 697 | Ga0065704_10076914 | |||
| 698 | Ga0065704_10101107 | |||
| 699 | Ga0065704_10136505 | |||
| 700 | Ga0065715_10091015 | |||
| 701 | Ga0065715_10315726 | |||
| 702 | Ga0070683_100006765 | |||
| 703 | Ga0070683_100061609 | |||
| 704 | Ga0070683_100386486 | |||
| 705 | Ga0070683_100843070 | |||
| 706 | Ga0070690_100186718 | |||
| 707 | Ga0070670_100368967 | |||
| 708 | Ga0070670_100369575 | |||
| 709 | Ga0068869_100120993 | |||
| 710 | Ga0070680_100048548 | |||
| 711 | Ga0070691_10286917 | |||
| 712 | Ga0070661_100153920 | |||
| 713 | Ga0070661_100463970 | |||
| 714 | Ga0070692_10184748 | |||
| 715 | Ga0070675_100543215 | |||
| 716 | Ga0070671_100011087 | |||
| 717 | Ga0070671_100197849 | |||
| 718 | Ga0070673_100221363 | |||
| 719 | Ga0070659_100007022 | |||
| 720 | Ga0070709_10063261 | |||
| 721 | Ga0070709_10382574 | |||
| 722 | Ga0070714_100489051 | |||
| 723 | Ga0070714_100873765 | |||
| 724 | Ga0070713_100052387 | |||
| 725 | Ga0070713_100126300 | |||
| 726 | Ga0070713_100134652 | |||
| 727 | Ga0070710_10233544 | |||
| 728 | Ga0070711_100049233 | |||
| 729 | Ga0070711_100856462 | |||
| 730 | Ga0070705_100209995 | |||
| 731 | Ga0070694_100394994 | |||
| 732 | Ga0070663_100002386 | |||
| 733 | Ga0070678_100526863 | |||
| 734 | Ga0070662_100671402 | |||
| 735 | Ga0070662_100682097 | |||
| 736 | Ga0070681_10036557 | |||
| 737 | Ga0068867_100756670 | |||
| 738 | Ga0070679_100098272 | |||
| 739 | Ga0070684_100092934 | |||
| 740 | Ga0070684_100927100 | |||
| 741 | Ga0070697_100032202 | |||
| 742 | Ga0068853_100017732 | |||
| 743 | Ga0068853_100390372 | |||
| 744 | Ga0070695_100016622 | |||
| 745 | Ga0070696_100018567 | |||
| 746 | Ga0070693_100034290 | |||
| 747 | Ga0070693_100066894 | |||
| 748 | Ga0070704_100030920 | |||
| 749 | Ga0070704_100813283 | |||
| 750 | Ga0070704_100818062 | |||
| 751 | Ga0068855_100001082 | |||
| 752 | Ga0068855_100131098 | |||
| 753 | Ga0070664_100033514 | |||
| 754 | Ga0070664_100144222 | |||
| 755 | Ga0070664_100183938 | |||
| 756 | Ga0070664_100309711 | |||
| 757 | Ga0068857_100045275 | |||
| 758 | Ga0068854_100115058 | |||
| 759 | Ga0068856_100148978 | |||
| 760 | Ga0068856_100225382 | |||
| 761 | Ga0068856_100259474 | |||
| 762 | Ga0070702_100008145 | |||
| 763 | Ga0068852_100673075 | |||
| 764 | Ga0068852_101100904 | |||
| 765 | Ga0068859_101247728 | |||
| 766 | Ga0068859_101705811 | |||
| 767 | Ga0068859_101836109 | |||
| 768 | Ga0068866_10731880 | |||
| 769 | Ga0068851_10237985 | |||
| 770 | Ga0068870_10397394 | |||
| 771 | Ga0068863_100329130 | |||
| 772 | Ga0068858_100265126 | |||
| 773 | Ga0068858_100652904 | |||
| 774 | Ga0068860_100008948 | |||
| 775 | Ga0068860_100461524 | |||
| 776 | Ga0081540_1000026 | |||
| 777 | Ga0081539_10001608 | |||
| 778 | Ga0070717_10305361 | |||
| 779 | Ga0070717_10459301 | |||
| 780 | Ga0070717_10673044 | |||
| 781 | Ga0075365_10054070 | |||
| 782 | Ga0075363_100109704 | |||
| 783 | Ga0075363_100192348 | |||
| 784 | Ga0075364_10035753 | |||
| 785 | Ga0070716_100000145 | |||
| 786 | Ga0070712_100076890 | |||
| 787 | Ga0070712_100226687 | |||
| 788 | Ga0075362_10003498 | |||
| 789 | Ga0075366_10292905 | |||
| 790 | Ga0075370_10026388 | |||
| 791 | Ga0068871_100228823 | |||
| 792 | Ga0068871_100522503 | |||
| 793 | Ga0075430_100814067 | |||
| 794 | Ga0075433_10176851 | |||
| 795 | Ga0075434_100237142 | |||
| 796 | Ga0075436_100057009 | |||
| 797 | Ga0097620_101705584 | |||
| 798 | Ga0097620_101836257 | |||
| 799 | Ga0075435_100805974 | |||
| 800 | Ga0099795_10032603 | |||
| 801 | Ga0105240_10011621 | |||
| 802 | Ga0105240_10592525 | |||
| 803 | Ga0111539_10845855 | |||
| 804 | Ga0111539_10922984 | |||
| 805 | Ga0105245_10041075 | |||
| 806 | Ga0105245_10118925 | |||
| 807 | Ga0105245_10628042 | |||
| 808 | Ga0105247_10087581 | |||
| 809 | Ga0105247_10229396 | |||
| 810 | Ga0105243_10741810 | |||
| 811 | Ga0105241_10006012 | |||
| 812 | Ga0105241_10047303 | |||
| 813 | Ga0105241_10107351 | |||
| 814 | Ga0105241_10161736 | |||
| 815 | Ga0105248_10003346 | |||
| 816 | Ga0105248_10342881 | |||
| 817 | Ga0105248_11679242 | |||
| 818 | Ga0105237_10001961 | |||
| 819 | Ga0105237_10075352 | |||
| 820 | Ga0105237_10599005 | |||
| 821 | Ga0105238_10014352 | |||
| 822 | Ga0105238_10114493 | |||
| 823 | Ga0105249_10965492 | |||
| 824 | Ga0105249_11104873 | |||
| 825 | Ga0099796_10002309 | |||
| 826 | Ga0105239_10338960 | |||
| 827 | Ga0105239_10508268 | |||
| 828 | Ga0105246_10042568 | |||
| 829 | Ga0105246_10993082 | |||
| 830 | Ga0157369_10324579 | |||
| 831 | Ga0157374_10163835 | |||
| 832 | Ga0157374_10446882 | |||
| 833 | Ga0157378_10000137 | |||
| 834 | Ga0157378_10456827 | |||
| 835 | Ga0157378_10972849 | |||
| 836 | Ga0157378_11043561 | |||
| 837 | Ga0163162_10011396 | |||
| 838 | Ga0163162_10370500 | |||
| 839 | Ga0157372_10686948 | |||
| 840 | Ga0157375_10624183 | |||
| 841 | Ga0163163_10279533 | |||
| 842 | Ga0163163_10387748 | |||
| 843 | Ga0163163_10610186 | |||
| 844 | Ga0163163_11698572 | |||
| 845 | Ga0157380_10466905 | |||
| 846 | Ga0157377_10249301 | |||
| 847 | Ga0157377_10515330 | |||
| 848 | Ga0157379_10020881 | |||
| 849 | Ga0157379_10090787 | |||
| 850 | Ga0157376_10272847 | |||
| 851 | Ga0163161_10522730 | |||
| 852 | Ga0163161_10546572 | |||
| 853 | Ga0213875_10013483 | |||
| 854 | Ga0213875_10035642 | |||
| 855 | Ga0213875_10144699 | |||
| 856 | Ga0256744_143749 | |||
| 857 | Ga0207425_1028882 | |||
| 858 | Ga0209673_1007558 | |||
| 859 | Ga0209675_1000076 | |||
| 860 | Ga0209676_1002852 | |||
| 861 | Ga0209758_1000193 | |||
| 862 | Ga0209050_1000198 | |||
| 863 | Ga0207692_10201961 | |||
| 864 | Ga0207642_10675642 | |||
| 865 | Ga0207688_10038915 | |||
| 866 | Ga0207647_10008863 | |||
| 867 | Ga0207699_10257888 | |||
| 868 | Ga0207654_10439417 | |||
| 869 | Ga0207707_10080318 | |||
| 870 | Ga0207707_10200437 | |||
| 871 | Ga0207695_10013078 | |||
| 872 | Ga0207695_10112342 | |||
| 873 | Ga0207671_10005144 | |||
| 874 | Ga0207693_10007459 | |||
| 875 | Ga0207693_10290966 | |||
| 876 | Ga0207693_10304631 | |||
| 877 | Ga0207663_10154904 | |||
| 878 | Ga0207660_10034563 | |||
| 879 | Ga0207657_10211771 | |||
| 880 | Ga0207649_10068638 | |||
| 881 | Ga0207652_10095931 | |||
| 882 | Ga0207652_10122250 | |||
| 883 | Ga0207694_10088439 | |||
| 884 | Ga0207650_10292624 | |||
| 885 | Ga0207687_10207552 | |||
| 886 | Ga0207687_10532026 | |||
| 887 | Ga0207700_10004238 | |||
| 888 | Ga0207700_10130141 | |||
| 889 | Ga0207700_10473728 | |||
| 890 | Ga0207664_10193930 | |||
| 891 | Ga0207664_10473777 | |||
| 892 | Ga0207644_10042302 | |||
| 893 | Ga0207644_10342309 | |||
| 894 | Ga0207690_10982089 | |||
| 895 | Ga0207706_10676467 | |||
| 896 | Ga0207665_10000015 | |||
| 897 | Ga0207711_10008218 | |||
| 898 | Ga0207711_11113050 | |||
| 899 | Ga0207689_10083762 | |||
| 900 | Ga0207661_10018071 | |||
| 901 | Ga0207661_10326819 | |||
| 902 | Ga0207661_10502474 | |||
| 903 | Ga0207679_10499057 | |||
| 904 | Ga0207667_10005618 | |||
| 905 | Ga0207667_10131669 | |||
| 906 | Ga0207651_10331208 | |||
| 907 | Ga0207651_10765134 | |||
| 908 | Ga0207640_10246025 | |||
| 909 | Ga0207658_10307000 | |||
| 910 | Ga0207703_10168856 | |||
| 911 | Ga0207703_10922849 | |||
| 912 | Ga0207639_10066736 | |||
| 913 | Ga0207639_10285306 | |||
| 914 | Ga0207678_10001728 | |||
| 915 | Ga0207708_10124155 | |||
| 916 | Ga0207702_10100613 | |||
| 917 | Ga0207702_10536175 | |||
| 918 | Ga0207702_10896451 | |||
| 919 | Ga0207648_10484531 | |||
| 920 | Ga0207676_11284800 | |||
| 921 | Ga0207674_10038241 | |||
| 922 | Ga0207674_10730497 | |||
| 923 | Ga0207683_10257710 | |||
| 924 | Ga0207698_10285821 | |||
| 925 | Ga0207698_10583884 | |||
| 926 | Ga0207698_11080406 | |||
| 927 | Ga0207428_10369657 | |||
| 928 | Ga0268264_10006281 | |||
| 929 | Ga0268264_10435573 | |||
| 930 | Ga0265325_10000883 | |||
| 931 | Ga0265340_10000021 | |||
| 932 | Ga0265340_10007700 | |||
| 933 | Ga0265339_10008470 | |||
| 934 | Ga0265331_10005821 | |||
| 935 | Ga0265316_10011221 | |||
| 936 | Ga0307513_10121789 | |||
| 937 | Ga0307513_10252117 | |||
| 938 | Ga0307509_10468070 | |||
| 939 | Ga0316576_10059742 | |||
| 940 | Ga0307413_10224420 | |||
| 941 | Ga0307406_10478602 | |||
| 942 | Ga0307409_100021901 | |||
| 943 | Ga0307409_100673953 | |||
| 944 | Ga0307409_100898414 | |||
| 945 | Ga0307409_101265458 | |||
| 946 | Ga0307409_101444102 | |||
| 947 | Ga0307416_100857444 | |||
| 948 | Ga0307414_10328306 | |||
| 949 | Ga0307414_10372659 | |||
| 950 | Ga0307411_10393337 | |||
| 951 | Ga0373926_0032688 | |||
| 952 | Ga0373926_0069335 | |||
| 953 | Ga0373929_0074793 | |||
| 954 | Ga0373934_0059108 | |||
| 955 | Ga0373944_0013984 | |||
| 956 | Ga0373944_0029953 | |||
| 957 | Ga0373923_0015422 | |||
| 958 | Ga0373923_0025454 | |||
| 959 | Ga0373923_0103258 | |||
| 960 | Ga0373932_0182951 | |||
| 961 | Ga0373936_0024301 | |||
| 962 | Ga0373945_0105818 | |||
| 963 | Ga0373945_0327702 | |||
| 964 | Ga0373954_0120505 | |||
| 965 | Ga0373956_0030002 | |||
| 966 | Ga0373946_0039897 | |||
| 967 | Ga0373946_0107435 | |||
| 968 | Ga0373955_0052696 | |||
| 969 | Ga0373955_0073000 | |||
| 970 | Ga0373955_0414661 | |||
| 971 | Ga0373924_0008228 | |||
| 972 | Ga0373924_0042870 | |||
| 973 | Ga0373935_0094130 | |||
| 974 | Ga0373935_0109598 | |||
| 975 | Ga0373935_0219362 | |||
| 976 | Ga0373935_0386289 | |||
| 977 | Ga0373927_0091361 | |||
| 978 | Ga0373927_0211307 | |||
| 979 | Ga0373933_0065780 | |||
| 980 | Ga0373933_0092148 | |||
| 981 | Ga0373947_0095121 | |||
| 982 | Ga0373947_0161484 | |||
| 983 | Ga0373947_0163330 | |||
| 984 | Ga0373947_0432533 | |||
| 985 | Ga0373937_0014570 | |||
| 986 | Ga0373937_0016581 | |||
| 987 | Ga0373937_0016833 | |||
| 988 | Ga0373937_0054264 | |||
| 989 | Ga0373937_0230314 | |||
| 990 | Ga0373937_1094874 | |||
| 991 | Ga0373925_0022624 | |||
| 992 | Ga0373925_0033185 | |||
| 993 | Ga0373925_0176149 | |||
| 994 | Ga0373925_0254570 | |||
| 995 | Ga0373925_0579677 | |||
| 996 | Ga0395900_0019643 | |||
| 997 | Ga0395898_0027805 | |||
| 998 | Ga0395898_1230989 | |||
| 999 | Ga0395905_0012767 | |||
| 1000 | Ga0395905_0698934 | |||
| 1001 | Ga0436364_0457007 | |||
| 1002 | Ga0436364_0884684 | |||
| 1003 | Ga0436364_0892395 | |||
| 1004 | Ga0436364_1022767 | |||
| 1005 | Ga0436364_1304001 | |||
| 1006 | Ga0395901_0225133 | |||
| 1007 | Ga0436365_0491762 | |||
| 1008 | Ga0436365_0656636 | |||
| 1009 | Ga0436360_1002537 | |||
| 1010 | Ga0436360_1008693 | |||
| 1011 | Ga0436361_0458016 | |||
| 1012 | Ga0436361_1138492 | |||
| 1013 | Ga0436361_1175342 | |||
| 1014 | Ga0436363_0594316 | |||
| 1015 | Ga0436363_0651146 | |||
| 1016 | Ga0436363_1652652 | |||
| 1017 | Ga0436362_0156731 | |||
| 1018 | Ga0436362_0592899 | |||
| 1019 | Ga0436362_1161106 | |||
| 1020 | Ga0451793_0430518 | |||
| 1021 | Ga0451797_0372802 | |||
| 1022 | Ga0451795_0702556 | |||
| 1023 | Ga0451800_0925057 | |||
| 1024 | Ga0451802_1611071 | |||
| 1025 | Ga0451807_1267673 | |||
| 1026 | Ga0451847_0766722 | |||
| 1027 | Ga0450923_041557 | |||
| 1028 | Ga0466963_0393414 | |||
| 1029 | Ga0453684_0156847 | |||
| 1030 | Ga0451576_0536622 | |||
| 1031 | Ga0451576_0813709 | |||
| 1032 | Ga0466967_0032202 | |||
| 1033 | Ga0495592_0333230 | |||
| 1034 | Ga0495638_0056088 | |||
| 1035 | Ga0495651_0063858 | |||
| 1036 | Ga0495651_0293755 | |||
| 1037 | Ga0495653_0176136 | |||
| 1038 | Ga0495653_0277617 | |||
| 1039 | Ga0495662_0030927 | |||
| 1040 | Ga0495664_0001103 | |||
| 1041 | Ga0495608_0031462 | |||
| 1042 | Ga0495608_0061977 | |||
| 1043 | Ga0495608_0401188 | |||
| 1044 | Ga0495610_0060873 | |||
| 1045 | Ga0495618_0200136 | |||
| 1046 | Ga0495628_0083890 | |||
| 1047 | Ga0495628_0512943 | |||
| 1048 | Ga0495630_0174017 | |||
| 1049 | Ga0495630_0861071 | |||
| 1050 | Ga0495632_0007707 | |||
| 1051 | Ga0495644_0031119 | |||
| 1052 | Ga0495666_0123628 | |||
| 1053 | Ga0495652_0059778 | |||
| 1054 | Ga0495652_0179198 | |||
| 1055 | Ga0495640_0064779 | |||
| 1056 | Ga0495640_0086876 | |||
| 1057 | Ga0495640_0443176 | |||
| 1058 | Ga0495645_0000981 | |||
| 1059 | Ga0495667_0040729 | |||
| 1060 | Ga0495667_0190971 | |||
| 1061 | Ga0495667_0313245 | |||
| 1062 | Ga0495668_0048689 | |||
| 1063 | Ga0495634_0571460 | |||
| 1064 | Ga0495635_0040598 | |||
| 1065 | Ga0495635_0074601 | |||
| 1066 | Ga0495635_0653150 | |||
| 1067 | Ga0495657_0104293 | |||
| 1068 | Ga0495599_0022295 | |||
| 1069 | Ga0495599_0031894 | |||
| 1070 | Ga0495623_0048921 | |||
| 1071 | Ga0495613_0048855 | |||
| 1072 | Ga0495671_0000577 | |||
| 1073 | Ga0495600_0068081 | |||
| 1074 | Ga0495604_0241085 | |||
| 1075 | Ga0495604_0291119 | |||
| 1076 | Ga0495674_0066456 | |||
| 1077 | Ga0495680_0022707 | |||
| 1078 | Ga0495675_0007005 | |||
| 1079 | Ga0495675_0077983 | |||
| 1080 | Ga0495673_0000019 | |||
| 1081 | Ga0495684_0030984 | |||
| 1082 | Ga0495684_0258590 | |||
| 1083 | Ga0495684_0589155 | |||
| 1084 | Ga0495593_0152238 | |||
| 1085 | Ga0495602_0012924 | |||
| 1086 | Ga0495602_0195902 | |||
| 1087 | Ga0496100_0106507 | |||
| 1088 | Ga0496101_0097826 | |||
| 1089 | Ga0496101_0131758 | |||
| 1090 | Ga0496101_0643585 | |||
| 1091 | Ga0496102_0006757 | |||
| 1092 | Ga0496102_0042273 | |||
| 1093 | Ga0496102_0091933 | |||
| 1094 | Ga0496103_0024003 | |||
| 1095 | Ga0496103_0024114 | |||
| 1096 | Ga0496104_0350868 | |||
| 1097 | Ga0496104_0582772 | |||
| 1098 | Ga0496104_0590355 | |||
| 1099 | Ga0496105_0298695 | |||
| 1100 | Ga0496106_0110783 | |||
| 1101 | Ga0496106_0175284 | |||
| 1102 | Ga0496106_0357859 | |||
| 1103 | Ga0496107_0006697 | |||
| 1104 | Ga0496108_0470057 | |||
| 1105 | Ga0496108_0567710 | |||
| 1106 | Ga0496108_0820502 | |||
| 1107 | Ga0496109_0221284 | |||
| 1108 | Ga0496110_0189182 | |||
| 1109 | Ga0496110_0284090 | |||
| 1110 | Ga0496110_0432373 | |||
| 1111 | Ga0496111_0270390 | |||
| 1112 | Ga0496112_0168731 | |||
| 1113 | Ga0496112_0205255 | |||
| 1114 | Ga0496112_0716491 | |||
| 1115 | Ga0496113_0087670 | |||
| 1116 | Ga0496113_0227752 | |||
| 1117 | Ga0496113_0335446 | |||
| 1118 | Ga0496116_0006102 | |||
| 1119 | Ga0496119_0217078 | |||
| 1120 | Ga0496122_0001988 | |||
| 1121 | Ga0496122_0145955 | |||
| 1122 | Ga0496124_0000857 | |||
| 1123 | Ga0496124_0725266 | |||
| 1124 | Ga0496125_0000986 | |||
| 1125 | Ga0496125_0002760 | |||
| 1126 | Ga0496125_0058897 | |||
| 1127 | Ga0496125_0212987 | |||
| 1128 | Ga0496126_0198630 | |||
| 1129 | Ga0501033_0022898 | |||
| 1130 | Ga0501033_0078057 | |||
| 1131 | Ga0501033_0198784 | |||
| 1132 | Ga0501033_0349803 | |||
| 1133 | Ga0501034_0503855 | |||
| 1134 | Ga0501036_0025747 | |||
| 1135 | Ga0501037_0287692 | |||
| 1136 | Ga0501037_0438330 | |||
| 1137 | Ga0501037_0610185 | |||
| 1138 | Ga0501037_0657965 | |||
| 1139 | Ga0501038_0062526 | |||
| 1140 | Ga0501038_0066963 | |||
| 1141 | Ga0501043_0039285 | |||
| 1142 | Ga0501046_0020342 | |||
| 1143 | Ga0501046_0103814 | |||
| 1144 | Ga0501047_0042916 | |||
| 1145 | Ga0501047_0086454 | |||
| 1146 | Ga0501047_0105836 | |||
| 1147 | Ga0501048_0000067 | |||
| 1148 | Ga0501070_0756595 | |||
| 1149 | Ga0501073_0470399 | |||
| 1150 | Ga0501080_0248814 | |||
| 1151 | Ga0501080_0263992 | |||
| 1152 | Ga0501035_0037577 | |||
| 1153 | Ga0501035_0041654 | |||
| 1154 | Ga0501035_0629477 | |||
| 1155 | Ga0501035_0938038 | |||
| 1156 | Ga0501044_0044046 | |||
| 1157 | Ga0501044_0100174 | |||
| 1158 | Ga0501044_0314008 | |||
| 1159 | Ga0501044_1064620 | |||
| 1160 | nmdc:mga03683_4425_c1 | |||
| 1161 | nmdc:mga0yw44_485775_c1 | |||
| 1162 | nmdc:mga0k408_369575_c1 | |||
| 1163 | nmdc:mga06z11_342885_c1 | |||
| 1164 | nmdc:mga07m45_25079_c1 | |||
| 1165 | nmdc:mga05p37_843093_c1 | |||
| 1166 | nmdc:mga08y16_700480_c1 | |||
| 1167 | nmdc:mga0n895_108998_c1 | |||
| 1168 | nmdc:mga0n895_267723_c1 | |||
| 1169 | nmdc:mga0n895_872791_c1 | |||
| 1170 | nmdc:mga0rr50_1354583_c1 | |||
| 1171 | nmdc:mga08x19_27892_c1 | |||
| 1172 | nmdc:mga0a205_288685_c1 | |||
| 1173 | nmdc:mga0a205_524749_c1 | |||
| 1174 | Ga0495601_0005551 | |||
| 1175 | Ga0495612_0010836 | |||
| 1176 | Ga0495595_0017648 | |||
| 1177 | Ga0495619_0025872 | |||
| 1178 | Ga0495619_0120015 | |||
| 1179 | Ga0500578_0000006 | |||
| 1180 | Ga0500644_0011827 | |||
| 1181 | Ga0500646_0034657 | |||
| 1182 | Ga0500583_0303892 | |||
| 1183 | Ga0500651_0041543 | |||
| 1184 | Ga0500651_0232389 | |||
| 1185 | Ga0500650_0041114 | |||
| 1186 | Ga0500556_0000014 | |||
| 1187 | Ga0500562_093437 | |||
| 1188 | Ga0500621_000002 | |||
| 1189 | Ga0500628_017949 | |||
| 1190 | Ga0500628_164265 | |||
| 1191 | Ga0500642_0148118 | |||
| 1192 | Ga0500652_001508 | |||
| 1193 | Ga0500652_147298 | |||
| 1194 | Ga0500655_010123 | |||
| 1195 | Ga0500658_0150621 | |||
| 1196 | Ga0500561_0039133 | |||
| 1197 | Ga0500568_0001037 | |||
| 1198 | Ga0500568_0002272 | |||
| 1199 | Ga0500568_0076023 | |||
| 1200 | Ga0500579_136861 | |||
| 1201 | Ga0500604_0020304 | |||
| 1202 | Ga0500604_0112573 | |||
| 1203 | Ga0500604_0129935 | |||
| 1204 | Ga0500616_0017418 | |||
| 1205 | Ga0500616_0077889 | |||
| 1206 | Ga0500622_0002520 | |||
| 1207 | Ga0500627_0005107 | |||
| 1208 | Ga0500627_0082466 | |||
| 1209 | Ga0500634_0000009 | |||
| 1210 | Ga0500570_102163 | |||
| 1211 | Ga0501084_0823021 | |||
| 1212 | Ga0587076_030260 | |||
| 1213 | 2509118142 | |||
| 1214 | 2512037629 | |||
| 1215 | 2512929565 | |||
| 1216 | 2513585784 | |||
| 1217 | 2513886390 | |||
| 1218 | 2513906926 | |||
| 1219 | 2514033868 | |||
| 1220 | 2551680851 | |||
| 1221 | 2551684735 | |||
| 1222 | 2551698831 | |||
| 1223 | 2551718430 | |||
| 1224 | 2551739362 | |||
| 1225 | 2585168644 | |||
| 1226 | 2587725088 | |||
| 1227 | 2587731551 | |||
| 1228 | 2588295197 | |||
| 1229 | 2599938725 | |||
| 1230 | 2643967023 | |||
| 1231 | 2644142608 | |||
| 1232 | 2644152271 | |||
| 1233 | 2644271129 | |||
| 1234 | 2644485131 | |||
| 1235 | 2753357642 | |||
| 1236 | 2756673067 | |||
| 1237 | 2765465094 | |||
| 1238 | 2792753163 | |||
| 1239 | 2839993566 | |||
| 1240 | 2840764459 | |||
| 1241 | 2842333866 | |||
| 1242 | 2848864975 | |||
| 1243 | 2854914463 | |||
| 1244 | 2855829181 | |||
| 1245 | 2855844275 | |||
| 1246 | 2856326677 | |||
| 1247 | 2858806338 | |||
| 1248 | 2869168738 | |||
| 1249 | 2869280205 | |||
| 1250 | 2871492831 | |||
| 1251 | 2874144317 | |||
| 1252 | 2876366875 | |||
| 1253 | 2878744308 | |||
| 1254 | 2878756763 | |||
| 1255 | 2881851587 | |||
| 1256 | 2881868841 | |||
| 1257 | 2882462484 | |||
| 1258 | 2882919277 | |||
| 1259 | 2885320697 | |||
| 1260 | 2885329258 | |||
| 1261 | 2888341750 | |||
| 1262 | 2894653176 | |||
| 1263 | 2897804840 | |||
| 1264 | 2903453660 | |||
| 1265 | 2903496437 | |||
| 1266 | 2903524742 | |||
| 1267 | 2903531015 | |||
| 1268 | 2915991233 | |||
| 1269 | 2916014298 | |||
| 1270 | 2916034614 | |||
| 1271 | 2916061113 | |||
| 1272 | 2916069428 | |||
| 1273 | 2921214448 | |||
| 1274 | 2921269189 | |||
| 1275 | 2921295272 | |||
| 1276 | 2924154862 | |||
| 1277 | 2924162336 | |||
| 1278 | 2924179534 | |||
| 1279 | 2924193418 | |||
| 1280 | 2924199305 | |||
| 1281 | 2924212661 | |||
| 1282 | 2924216603 | |||
| 1283 | 2924234186 | |||
| 1284 | 2924719300 | |||
| 1285 | 2924782226 | |||
| 1286 | 2924788353 | |||
| 1287 | 2928525087 | |||
| 1288 | 2937044252 | |||
| 1289 | 2937054962 | |||
| 1290 | 2937068875 | |||
| 1291 | 2937076626 | |||
| 1292 | 2937103318 | |||
| 1293 | 2937118076 | |||
| 1294 | 2937123421 | |||
| 1295 | 2937131220 | |||
| 1296 | 2937850610 | |||
| 1297 | 2937877647 | |||
| 1298 | 2937977718 | |||
| 1299 | 2957391280 | |||
| 1300 | 2957413840 | |||
| 1301 | 2957424713 | |||
| 1302 | 2957447933 | |||
| 1303 | 2957457441 | |||
| 1304 | 2957475517 | |||
| 1305 | 2957482261 | |||
| 1306 | 2957490713 | |||
| 1307 | 2957496801 | |||
| 1308 | 2957504320 | |||
| 1309 | 2957512343 | |||
| 1310 | 2958036076 | |||
| 1311 | 2958047500 | |||
| 1312 | 2958066169 | |||
| 1313 | 2958084754 | |||
| 1314 | 2958093892 | |||
| 1315 | 2958151143 | |||
| 1316 | 2960601768 | |||
| 1317 | 2960624124 | |||
| 1318 | 2960643606 | |||
| 1319 | 2960648999 | |||
| 1320 | 2960659576 | |||
| 1321 | 2960664955 | |||
| 1322 | 2960679283 | |||
| 1323 | 2961173053 | |||
| 1324 | 2963649668 | |||
| 1325 | 2964631647 | |||
| 1326 | 2964641934 | |||
| 1327 | 2964654291 | |||
| 1328 | 2964669972 | |||
| 1329 | 2964682136 | |||
| 1330 | 2964702497 | |||
| 1331 | 2964709666 | |||
| 1332 | 2964718523 | |||
| 1333 | 2964724954 | |||
| 1334 | 2967685997 | |||
| 1335 | 2967726424 | |||
| 1336 | 2967752797 | |||
| 1337 | 2967769017 | |||
| 1338 | 2967782784 | |||
| 1339 | 2967998264 | |||
| 1340 | 2968006310 | |||
| 1341 | 2968022288 | |||
| 1342 | 2968087024 | |||
| 1343 | 2970023811 | |||
| 1344 | 2970038500 | |||
| 1345 | 2970046441 | |||
| 1346 | 2970050836 | |||
| 1347 | 2970056991 | |||
| 1348 | 2970062102 | |||
| 1349 | 2970073473 | |||
| 1350 | 2970078854 | |||
| 1351 | 2970087222 | |||
| 1352 | 2970114529 | |||
| 1353 | 2970121089 | |||
| 1354 | 2970155044 | |||
| 1355 | 2970161144 | |||
| 1356 | 2970168687 | |||
| 1357 | 2970193778 | |||
| 1358 | 2970474877 | |||
| 1359 | 2970505647 | |||
| 1360 | 2970594805 | |||
| 1361 | 2977556496 | |||
| 1362 | 2977576426 | |||
| 1363 | 2977584900 | |||
| 1364 | 2977825943 | |||
| 1365 | 2977837138 | |||
| 1366 | 2977927701 | |||
| 1367 | 2979810368 | |||
| 1368 | 2996354288 | |||
| 1369 | 3004280956 | |||
| 1370 | 8004378351 | |||
| 1371 | 8054002259 | |||
| 1372 | 8057734779 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.9803 | 2 | 175 |
| 7pvi-assembly1.cif.gz_BBB | dtdp-sugar epimerase | 0.9714 | 2 | 187 |
| 2ixk-assembly1.cif.gz_B | rmlc p aeruginosa with dtdp-4-keto rhamnnose (the product of the reaction) | 0.9687 | 2 | 183 |
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.9606 | 2 | 177 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9591 | 2 | 183 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q17993_17_190_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9548 | 7 | 179 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9536 | 2 | 175 | 2.60.120.10 |
| 2b9uD00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.953 | 2 | 184 | 2.60.120.10 |
| 1epzA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9511 | 2 | 178 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9469 | 1 | 178 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R2GVI8-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.997 | 2 | 184 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A2V9KSY8-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9969 | 2 | 184 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-Q1QIZ6-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9967 | 2 | 184 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A7W6IIH0-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9964 | 2 | 183 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A562TI62-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9961 | 11 | 185 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |